Leucine-rich repeat flightless-interacting protein 2

Overview
NameLeucine-rich repeat flightless-interacting protein 2
Smed IDSMED30000118
Length (bp)1950
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Leucine-rich repeat flightless-interacting protein 2 (SMED30000118) t-SNE clustered cells

Violin plots show distribution of expression levels for Leucine-rich repeat flightless-interacting protein 2 (SMED30000118) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Leucine-rich repeat flightless-interacting protein 2 (SMED30000118) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Leucine-rich repeat flightless-interacting protein 2 (SMED30000118) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30000118

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 10

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
gutSMED30000118h1SMcG0011163 Contig4772uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
gutSMED30000118h1SMcG0011163 Contig4772newmark_estsPMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
intestinal phagocyteSMED30000118h1SMcG0011163 Contig4772uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30000118h1SMcG0011163 Contig4772newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
gutSMED30000118h1SMcG0015578 Contig4772uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
gutSMED30000118h1SMcG0015578 Contig4772newmark_estsPMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
intestinal phagocyteSMED30000118h1SMcG0015578 Contig4772uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30000118h1SMcG0015578 Contig4772newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
parenchymal cellSMED30000118h1SMcG0015578 dd_Smed_v4_5214_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30000118h1SMcG0015578 dd_Smed_v4_5214_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Leucine-rich repeat flightless-interacting protein 2 vs. Ensembl Human
Match: LRRFIP1 (LRR binding FLII interacting protein 1 [Source:HGNC Symbol;Acc:HGNC:6702])

HSP 1 Score: 74.3294 bits (181), Expect = 3.394e-13
Identity = 44/84 (52.38%), Postives = 58/84 (69.05%), Query Frame = 3
Query:  876 EYKRQLQISQQKVTALEADVIRLEGQVKRHKSIAESCEKQEEELKQAKRKYQREFREAQNKIEDLKSENATLQKKLEKYAKQKS 1127
            + K +L  S+Q++TALE +VIRLE QV R+KS AE+ EK E+ELK  KRK QRE R A +K E+L+  N  L K+LEK    +S
Sbjct:  551 DLKFKLAKSEQEITALEQNVIRLESQVSRYKSAAENAEKIEDELKAEKRKLQRELRSALDKTEELEVSNGHLVKRLEKMKANRS 634          
BLAST of Leucine-rich repeat flightless-interacting protein 2 vs. Ensembl Human
Match: LRRFIP2 (LRR binding FLII interacting protein 2 [Source:HGNC Symbol;Acc:HGNC:6703])

HSP 1 Score: 73.559 bits (179), Expect = 3.400e-13
Identity = 41/78 (52.56%), Postives = 56/78 (71.79%), Query Frame = 3
Query:  876 EYKRQLQISQQKVTALEADVIRLEGQVKRHKSIAESCEKQEEELKQAKRKYQREFREAQNKIEDLKSENATLQKKLEK 1109
            EYK +L  ++Q +T LE  + RLEGQV R+K+ AE+ EK E+ELK  KRK QRE R A +KIE+++  N+ L K+LEK
Sbjct:  311 EYKFKLSKAEQDITTLEQSISRLEGQVLRYKTAAENAEKVEDELKAEKRKLQRELRTALDKIEEMEMTNSHLAKRLEK 388          
BLAST of Leucine-rich repeat flightless-interacting protein 2 vs. Ensembl Human
Match: LRRFIP2 (LRR binding FLII interacting protein 2 [Source:HGNC Symbol;Acc:HGNC:6703])

HSP 1 Score: 73.559 bits (179), Expect = 3.790e-13
Identity = 41/78 (52.56%), Postives = 56/78 (71.79%), Query Frame = 3
Query:  876 EYKRQLQISQQKVTALEADVIRLEGQVKRHKSIAESCEKQEEELKQAKRKYQREFREAQNKIEDLKSENATLQKKLEK 1109
            EYK +L  ++Q +T LE  + RLEGQV R+K+ AE+ EK E+ELK  KRK QRE R A +KIE+++  N+ L K+LEK
Sbjct:  335 EYKFKLSKAEQDITTLEQSISRLEGQVLRYKTAAENAEKVEDELKAEKRKLQRELRTALDKIEEMEMTNSHLAKRLEK 412          
BLAST of Leucine-rich repeat flightless-interacting protein 2 vs. Ensembl Human
Match: LRRFIP2 (LRR binding FLII interacting protein 2 [Source:HGNC Symbol;Acc:HGNC:6703])

HSP 1 Score: 73.559 bits (179), Expect = 3.790e-13
Identity = 41/78 (52.56%), Postives = 56/78 (71.79%), Query Frame = 3
Query:  876 EYKRQLQISQQKVTALEADVIRLEGQVKRHKSIAESCEKQEEELKQAKRKYQREFREAQNKIEDLKSENATLQKKLEK 1109
            EYK +L  ++Q +T LE  + RLEGQV R+K+ AE+ EK E+ELK  KRK QRE R A +KIE+++  N+ L K+LEK
Sbjct:  335 EYKFKLSKAEQDITTLEQSISRLEGQVLRYKTAAENAEKVEDELKAEKRKLQRELRTALDKIEEMEMTNSHLAKRLEK 412          
BLAST of Leucine-rich repeat flightless-interacting protein 2 vs. Ensembl Human
Match: LRRFIP2 (LRR binding FLII interacting protein 2 [Source:HGNC Symbol;Acc:HGNC:6703])

HSP 1 Score: 73.559 bits (179), Expect = 4.396e-13
Identity = 41/78 (52.56%), Postives = 56/78 (71.79%), Query Frame = 3
Query:  876 EYKRQLQISQQKVTALEADVIRLEGQVKRHKSIAESCEKQEEELKQAKRKYQREFREAQNKIEDLKSENATLQKKLEK 1109
            EYK +L  ++Q +T LE  + RLEGQV R+K+ AE+ EK E+ELK  KRK QRE R A +KIE+++  N+ L K+LEK
Sbjct:  414 EYKFKLSKAEQDITTLEQSISRLEGQVLRYKTAAENAEKVEDELKAEKRKLQRELRTALDKIEEMEMTNSHLAKRLEK 491          
BLAST of Leucine-rich repeat flightless-interacting protein 2 vs. Ensembl Celegans
Match: flap-1 (FLi1-Associated Protein homolog [Source:UniProtKB/TrEMBL;Acc:Q8MQ17])

HSP 1 Score: 53.5286 bits (127), Expect = 2.631e-7
Identity = 32/86 (37.21%), Postives = 57/86 (66.28%), Query Frame = 3
Query:  876 EYKRQLQISQQKVTALEADVIRLEGQVKRHKSIAESCEKQEEELKQAKRKYQREFREAQNKIEDLKSENATLQKKLEKYAKQKSKK 1133
            E K ++Q  +++ T  + +VIR+EGQ+KR+KS A+  EK+ +ELK   R+ ++E R+ +N +++ K  N  LQ +LEK   Q++ +
Sbjct:  286 EMKLKMQDLERENTNQQGNVIRMEGQMKRYKSNADVAEKELDELKTQMRQTKKELRDKENALDEQKETNKHLQSRLEKMRMQRTGR 371          
BLAST of Leucine-rich repeat flightless-interacting protein 2 vs. Ensembl Celegans
Match: flap-1 (FLi1-Associated Protein homolog [Source:UniProtKB/TrEMBL;Acc:Q8MQ17])

HSP 1 Score: 53.5286 bits (127), Expect = 2.728e-7
Identity = 32/86 (37.21%), Postives = 57/86 (66.28%), Query Frame = 3
Query:  876 EYKRQLQISQQKVTALEADVIRLEGQVKRHKSIAESCEKQEEELKQAKRKYQREFREAQNKIEDLKSENATLQKKLEKYAKQKSKK 1133
            E K ++Q  +++ T  + +VIR+EGQ+KR+KS A+  EK+ +ELK   R+ ++E R+ +N +++ K  N  LQ +LEK   Q++ +
Sbjct:  266 EMKLKMQDLERENTNQQGNVIRMEGQMKRYKSNADVAEKELDELKTQMRQTKKELRDKENALDEQKETNKHLQSRLEKMRMQRTGR 351          
BLAST of Leucine-rich repeat flightless-interacting protein 2 vs. Ensembl Zebrafish
Match: BX247888.2 (pep chromosome:GRCz11:CHR_ALT_CTG9_1_11:24103430:24111429:1 gene:ENSDARG00000115755.1 transcript:ENSDART00000184057.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:BX247888.2)

HSP 1 Score: 78.1814 bits (191), Expect = 4.931e-17
Identity = 44/81 (54.32%), Postives = 60/81 (74.07%), Query Frame = 3
Query:  867 QGQEYKRQLQISQQKVTALEADVIRLEGQVKRHKSIAESCEKQEEELKQAKRKYQREFREAQNKIEDLKSENATLQKKLEK 1109
            Q  + K +L  S+Q++TALE +V RLEGQV R+K+ +E+ EK E+ELK  KRK QRE R A +KIE+L+S N+ L K+LEK
Sbjct:   14 QVNDLKFKLVKSEQEITALEQNVTRLEGQVSRYKAASENAEKVEDELKAEKRKLQRELRSALDKIEELESSNSHLSKRLEK 94          
BLAST of Leucine-rich repeat flightless-interacting protein 2 vs. Ensembl Zebrafish
Match: lrrfip1a (leucine rich repeat (in FLII) interacting protein 1a [Source:ZFIN;Acc:ZDB-GENE-030131-99])

HSP 1 Score: 77.7962 bits (190), Expect = 1.227e-15
Identity = 44/82 (53.66%), Postives = 60/82 (73.17%), Query Frame = 3
Query:  867 QGQEYKRQLQISQQKVTALEADVIRLEGQVKRHKSIAESCEKQEEELKQAKRKYQREFREAQNKIEDLKSENATLQKKLEKY 1112
            Q  + K +L  S+Q++TALE +V RLEGQV R+K+ +E+ EK E+ELK  KRK QRE R A +KIE+L+S N+ L K+LEK 
Sbjct:  153 QVNDLKFKLVKSEQEITALEQNVTRLEGQVSRYKAASENAEKVEDELKAEKRKLQRELRSALDKIEELESSNSHLSKRLEKI 234          
BLAST of Leucine-rich repeat flightless-interacting protein 2 vs. Ensembl Zebrafish
Match: BX247888.2 (pep chromosome:GRCz11:CHR_ALT_CTG9_1_11:24062529:24111429:1 gene:ENSDARG00000115755.1 transcript:ENSDART00000180693.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:BX247888.2)

HSP 1 Score: 78.5666 bits (192), Expect = 5.665e-15
Identity = 44/81 (54.32%), Postives = 60/81 (74.07%), Query Frame = 3
Query:  867 QGQEYKRQLQISQQKVTALEADVIRLEGQVKRHKSIAESCEKQEEELKQAKRKYQREFREAQNKIEDLKSENATLQKKLEK 1109
            Q  + K +L  S+Q++TALE +V RLEGQV R+K+ +E+ EK E+ELK  KRK QRE R A +KIE+L+S N+ L K+LEK
Sbjct:  319 QVNDLKFKLVKSEQEITALEQNVTRLEGQVSRYKAASENAEKVEDELKAEKRKLQRELRSALDKIEELESSNSHLSKRLEK 399          
BLAST of Leucine-rich repeat flightless-interacting protein 2 vs. Ensembl Zebrafish
Match: BX247888.2 (pep chromosome:GRCz11:CHR_ALT_CTG9_1_11:24062535:24108781:1 gene:ENSDARG00000115755.1 transcript:ENSDART00000187451.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:BX247888.2)

HSP 1 Score: 78.1814 bits (191), Expect = 7.799e-15
Identity = 44/82 (53.66%), Postives = 60/82 (73.17%), Query Frame = 3
Query:  867 QGQEYKRQLQISQQKVTALEADVIRLEGQVKRHKSIAESCEKQEEELKQAKRKYQREFREAQNKIEDLKSENATLQKKLEKY 1112
            Q  + K +L  S+Q++TALE +V RLEGQV R+K+ +E+ EK E+ELK  KRK QRE R A +KIE+L+S N+ L K+LEK 
Sbjct:  355 QVNDLKFKLVKSEQEITALEQNVTRLEGQVSRYKAASENAEKVEDELKAEKRKLQRELRSALDKIEELESSNSHLSKRLEKI 436          
BLAST of Leucine-rich repeat flightless-interacting protein 2 vs. Ensembl Zebrafish
Match: BX247888.2 (pep chromosome:GRCz11:CHR_ALT_CTG9_1_11:24062529:24111429:1 gene:ENSDARG00000115755.1 transcript:ENSDART00000190999.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:BX247888.2)

HSP 1 Score: 78.1814 bits (191), Expect = 9.709e-15
Identity = 44/81 (54.32%), Postives = 60/81 (74.07%), Query Frame = 3
Query:  867 QGQEYKRQLQISQQKVTALEADVIRLEGQVKRHKSIAESCEKQEEELKQAKRKYQREFREAQNKIEDLKSENATLQKKLEK 1109
            Q  + K +L  S+Q++TALE +V RLEGQV R+K+ +E+ EK E+ELK  KRK QRE R A +KIE+L+S N+ L K+LEK
Sbjct:  381 QVNDLKFKLVKSEQEITALEQNVTRLEGQVSRYKAASENAEKVEDELKAEKRKLQRELRSALDKIEELESSNSHLSKRLEK 461          
BLAST of Leucine-rich repeat flightless-interacting protein 2 vs. Ensembl Xenopus
Match: bhmt (betaine--homocysteine S-methyltransferase [Source:Xenbase;Acc:XB-GENE-1008382])

HSP 1 Score: 72.7886 bits (177), Expect = 3.288e-13
Identity = 40/78 (51.28%), Postives = 57/78 (73.08%), Query Frame = 3
Query:  876 EYKRQLQISQQKVTALEADVIRLEGQVKRHKSIAESCEKQEEELKQAKRKYQREFREAQNKIEDLKSENATLQKKLEK 1109
            EYK ++  ++Q +T LE +V+RLEGQV R+KS AE+ EK E+ELK  KR+ QRE R A +K+E+++  N  L K+LEK
Sbjct:  253 EYKFKISKAEQDMTTLEQNVMRLEGQVVRYKSAAENAEKVEDELKAEKRRLQRELRTALDKMEEMEMTNNHLVKRLEK 330          
BLAST of Leucine-rich repeat flightless-interacting protein 2 vs. Ensembl Xenopus
Match: bhmt (betaine--homocysteine S-methyltransferase [Source:Xenbase;Acc:XB-GENE-1008382])

HSP 1 Score: 72.7886 bits (177), Expect = 4.964e-13
Identity = 40/78 (51.28%), Postives = 57/78 (73.08%), Query Frame = 3
Query:  876 EYKRQLQISQQKVTALEADVIRLEGQVKRHKSIAESCEKQEEELKQAKRKYQREFREAQNKIEDLKSENATLQKKLEK 1109
            EYK ++  ++Q +T LE +V+RLEGQV R+KS AE+ EK E+ELK  KR+ QRE R A +K+E+++  N  L K+LEK
Sbjct:  295 EYKFKISKAEQDMTTLEQNVMRLEGQVVRYKSAAENAEKVEDELKAEKRRLQRELRTALDKMEEMEMTNNHLVKRLEK 372          
BLAST of Leucine-rich repeat flightless-interacting protein 2 vs. Ensembl Xenopus
Match: bhmt (betaine--homocysteine S-methyltransferase [Source:Xenbase;Acc:XB-GENE-1008382])

HSP 1 Score: 72.4034 bits (176), Expect = 5.747e-13
Identity = 40/78 (51.28%), Postives = 57/78 (73.08%), Query Frame = 3
Query:  876 EYKRQLQISQQKVTALEADVIRLEGQVKRHKSIAESCEKQEEELKQAKRKYQREFREAQNKIEDLKSENATLQKKLEK 1109
            EYK ++  ++Q +T LE +V+RLEGQV R+KS AE+ EK E+ELK  KR+ QRE R A +K+E+++  N  L K+LEK
Sbjct:  309 EYKFKISKAEQDMTTLEQNVMRLEGQVVRYKSAAENAEKVEDELKAEKRRLQRELRTALDKMEEMEMTNNHLVKRLEK 386          
BLAST of Leucine-rich repeat flightless-interacting protein 2 vs. Ensembl Xenopus
Match: bhmt (betaine--homocysteine S-methyltransferase [Source:Xenbase;Acc:XB-GENE-1008382])

HSP 1 Score: 72.0182 bits (175), Expect = 8.261e-13
Identity = 40/78 (51.28%), Postives = 57/78 (73.08%), Query Frame = 3
Query:  876 EYKRQLQISQQKVTALEADVIRLEGQVKRHKSIAESCEKQEEELKQAKRKYQREFREAQNKIEDLKSENATLQKKLEK 1109
            EYK ++  ++Q +T LE +V+RLEGQV R+KS AE+ EK E+ELK  KR+ QRE R A +K+E+++  N  L K+LEK
Sbjct:  310 EYKFKISKAEQDMTTLEQNVMRLEGQVVRYKSAAENAEKVEDELKAEKRRLQRELRTALDKMEEMEMTNNHLVKRLEK 387          
BLAST of Leucine-rich repeat flightless-interacting protein 2 vs. Ensembl Xenopus
Match: bhmt (betaine--homocysteine S-methyltransferase [Source:Xenbase;Acc:XB-GENE-1008382])

HSP 1 Score: 72.4034 bits (176), Expect = 9.196e-13
Identity = 40/78 (51.28%), Postives = 57/78 (73.08%), Query Frame = 3
Query:  876 EYKRQLQISQQKVTALEADVIRLEGQVKRHKSIAESCEKQEEELKQAKRKYQREFREAQNKIEDLKSENATLQKKLEK 1109
            EYK ++  ++Q +T LE +V+RLEGQV R+KS AE+ EK E+ELK  KR+ QRE R A +K+E+++  N  L K+LEK
Sbjct:  349 EYKFKISKAEQDMTTLEQNVMRLEGQVVRYKSAAENAEKVEDELKAEKRRLQRELRTALDKMEEMEMTNNHLVKRLEK 426          
BLAST of Leucine-rich repeat flightless-interacting protein 2 vs. Ensembl Mouse
Match: Lrrfip1 (leucine rich repeat (in FLII) interacting protein 1 [Source:MGI Symbol;Acc:MGI:1342770])

HSP 1 Score: 73.559 bits (179), Expect = 2.362e-13
Identity = 43/84 (51.19%), Postives = 58/84 (69.05%), Query Frame = 3
Query:  876 EYKRQLQISQQKVTALEADVIRLEGQVKRHKSIAESCEKQEEELKQAKRKYQREFREAQNKIEDLKSENATLQKKLEKYAKQKS 1127
            + K +L  S+Q++TALE +VIRLE QV R++S AE+ EK E+ELK  KRK QRE R A +K E+L+  N  L K+LEK    +S
Sbjct:  339 DLKFKLAKSEQEITALEQNVIRLESQVTRYRSAAENAEKIEDELKAEKRKLQRELRSALDKTEELEVSNGHLVKRLEKMKANRS 422          
BLAST of Leucine-rich repeat flightless-interacting protein 2 vs. Ensembl Mouse
Match: Lrrfip2 (leucine rich repeat (in FLII) interacting protein 2 [Source:MGI Symbol;Acc:MGI:1918518])

HSP 1 Score: 72.7886 bits (177), Expect = 2.792e-13
Identity = 40/78 (51.28%), Postives = 56/78 (71.79%), Query Frame = 3
Query:  876 EYKRQLQISQQKVTALEADVIRLEGQVKRHKSIAESCEKQEEELKQAKRKYQREFREAQNKIEDLKSENATLQKKLEK 1109
            EYK +L  ++Q +  LE  + RLEGQV R+K+ AE+ EK E+ELK  +RK QRE R AQ+KIE+++  N+ L K+LEK
Sbjct:  284 EYKFKLSKAEQDIATLEQSISRLEGQVLRYKTAAENAEKIEDELKAERRKLQRELRTAQDKIEEMEMTNSHLAKRLEK 361          
BLAST of Leucine-rich repeat flightless-interacting protein 2 vs. Ensembl Mouse
Match: Lrrfip2 (leucine rich repeat (in FLII) interacting protein 2 [Source:MGI Symbol;Acc:MGI:1918518])

HSP 1 Score: 73.1738 bits (178), Expect = 3.355e-13
Identity = 40/78 (51.28%), Postives = 56/78 (71.79%), Query Frame = 3
Query:  876 EYKRQLQISQQKVTALEADVIRLEGQVKRHKSIAESCEKQEEELKQAKRKYQREFREAQNKIEDLKSENATLQKKLEK 1109
            EYK +L  ++Q +  LE  + RLEGQV R+K+ AE+ EK E+ELK  +RK QRE R AQ+KIE+++  N+ L K+LEK
Sbjct:  348 EYKFKLSKAEQDIATLEQSISRLEGQVLRYKTAAENAEKIEDELKAERRKLQRELRTAQDKIEEMEMTNSHLAKRLEK 425          
BLAST of Leucine-rich repeat flightless-interacting protein 2 vs. Ensembl Mouse
Match: Lrrfip2 (leucine rich repeat (in FLII) interacting protein 2 [Source:MGI Symbol;Acc:MGI:1918518])

HSP 1 Score: 72.7886 bits (177), Expect = 3.549e-13
Identity = 40/79 (50.63%), Postives = 56/79 (70.89%), Query Frame = 3
Query:  876 EYKRQLQISQQKVTALEADVIRLEGQVKRHKSIAESCEKQEEELKQAKRKYQREFREAQNKIEDLKSENATLQKKLEKY 1112
            EYK +L  ++Q +  LE  + RLEGQV R+K+ AE+ EK E+ELK  +RK QRE R AQ+KIE+++  N+ L K+LEK 
Sbjct:  314 EYKFKLSKAEQDIATLEQSISRLEGQVLRYKTAAENAEKIEDELKAERRKLQRELRTAQDKIEEMEMTNSHLAKRLEKM 392          
BLAST of Leucine-rich repeat flightless-interacting protein 2 vs. Ensembl Mouse
Match: Lrrfip2 (leucine rich repeat (in FLII) interacting protein 2 [Source:MGI Symbol;Acc:MGI:1918518])

HSP 1 Score: 72.7886 bits (177), Expect = 3.715e-13
Identity = 40/78 (51.28%), Postives = 56/78 (71.79%), Query Frame = 3
Query:  876 EYKRQLQISQQKVTALEADVIRLEGQVKRHKSIAESCEKQEEELKQAKRKYQREFREAQNKIEDLKSENATLQKKLEK 1109
            EYK +L  ++Q +  LE  + RLEGQV R+K+ AE+ EK E+ELK  +RK QRE R AQ+KIE+++  N+ L K+LEK
Sbjct:  311 EYKFKLSKAEQDIATLEQSISRLEGQVLRYKTAAENAEKIEDELKAERRKLQRELRTAQDKIEEMEMTNSHLAKRLEK 388          
BLAST of Leucine-rich repeat flightless-interacting protein 2 vs. UniProt/SwissProt
Match: sp|Q6GNW0|LRRF2_XENLA (Leucine-rich repeat flightless-interacting protein 2 OS=Xenopus laevis OX=8355 GN=lrrfip2 PE=2 SV=2)

HSP 1 Score: 75.485 bits (184), Expect = 7.270e-13
Identity = 42/78 (53.85%), Postives = 57/78 (73.08%), Query Frame = 3
Query:  876 EYKRQLQISQQKVTALEADVIRLEGQVKRHKSIAESCEKQEEELKQAKRKYQREFREAQNKIEDLKSENATLQKKLEK 1109
            EYK +L  S+Q +T LE +V+RLEGQV R+KS AE+ EK E+ELK  KR+ QRE R A +K+E+++  N  L K+LEK
Sbjct:  640 EYKFRLSKSEQDITTLEQNVMRLEGQVVRYKSAAENAEKVEDELKAEKRRLQRELRTALDKMEEMEMTNNHLVKRLEK 717          
BLAST of Leucine-rich repeat flightless-interacting protein 2 vs. UniProt/SwissProt
Match: sp|Q4V7E8|LRRF2_RAT (Leucine-rich repeat flightless-interacting protein 2 OS=Rattus norvegicus OX=10116 GN=Lrrfip2 PE=1 SV=1)

HSP 1 Score: 73.9442 bits (180), Expect = 1.561e-12
Identity = 41/78 (52.56%), Postives = 56/78 (71.79%), Query Frame = 3
Query:  876 EYKRQLQISQQKVTALEADVIRLEGQVKRHKSIAESCEKQEEELKQAKRKYQREFREAQNKIEDLKSENATLQKKLEK 1109
            EYK +L  ++Q +  LE  + RLEGQV R+K+ AE+ EK E+ELK  KRK QRE R AQ+KIE+++  N+ L K+LEK
Sbjct:  348 EYKFKLSKAEQDIATLEQSISRLEGQVLRYKTAAENAEKIEDELKAEKRKLQRELRTAQDKIEEMEMTNSHLAKRLEK 425          
BLAST of Leucine-rich repeat flightless-interacting protein 2 vs. UniProt/SwissProt
Match: sp|Q9Y608|LRRF2_HUMAN (Leucine-rich repeat flightless-interacting protein 2 OS=Homo sapiens OX=9606 GN=LRRFIP2 PE=1 SV=1)

HSP 1 Score: 73.9442 bits (180), Expect = 2.707e-12
Identity = 41/78 (52.56%), Postives = 56/78 (71.79%), Query Frame = 3
Query:  876 EYKRQLQISQQKVTALEADVIRLEGQVKRHKSIAESCEKQEEELKQAKRKYQREFREAQNKIEDLKSENATLQKKLEK 1109
            EYK +L  ++Q +T LE  + RLEGQV R+K+ AE+ EK E+ELK  KRK QRE R A +KIE+++  N+ L K+LEK
Sbjct:  632 EYKFKLSKAEQDITTLEQSISRLEGQVLRYKTAAENAEKVEDELKAEKRKLQRELRTALDKIEEMEMTNSHLAKRLEK 709          
BLAST of Leucine-rich repeat flightless-interacting protein 2 vs. UniProt/SwissProt
Match: sp|Q91WK0|LRRF2_MOUSE (Leucine-rich repeat flightless-interacting protein 2 OS=Mus musculus OX=10090 GN=Lrrfip2 PE=1 SV=1)

HSP 1 Score: 72.7886 bits (177), Expect = 2.814e-12
Identity = 40/78 (51.28%), Postives = 56/78 (71.79%), Query Frame = 3
Query:  876 EYKRQLQISQQKVTALEADVIRLEGQVKRHKSIAESCEKQEEELKQAKRKYQREFREAQNKIEDLKSENATLQKKLEK 1109
            EYK +L  ++Q +  LE  + RLEGQV R+K+ AE+ EK E+ELK  +RK QRE R AQ+KIE+++  N+ L K+LEK
Sbjct:  326 EYKFKLSKAEQDIATLEQSISRLEGQVLRYKTAAENAEKIEDELKAERRKLQRELRTAQDKIEEMEMTNSHLAKRLEK 403          
BLAST of Leucine-rich repeat flightless-interacting protein 2 vs. UniProt/SwissProt
Match: sp|B2GUE2|LRRF2_XENTR (Leucine-rich repeat flightless-interacting protein 2 OS=Xenopus tropicalis OX=8364 GN=lrrfip2 PE=2 SV=1)

HSP 1 Score: 72.4034 bits (176), Expect = 3.262e-12
Identity = 40/78 (51.28%), Postives = 57/78 (73.08%), Query Frame = 3
Query:  876 EYKRQLQISQQKVTALEADVIRLEGQVKRHKSIAESCEKQEEELKQAKRKYQREFREAQNKIEDLKSENATLQKKLEK 1109
            EYK ++  ++Q +T LE +V+RLEGQV R+KS AE+ EK E+ELK  KR+ QRE R A +K+E+++  N  L K+LEK
Sbjct:  315 EYKFKISKAEQDMTTLEQNVMRLEGQVVRYKSAAENAEKVEDELKAEKRRLQRELRTALDKMEEMEMTNNHLVKRLEK 392          
BLAST of Leucine-rich repeat flightless-interacting protein 2 vs. TrEMBL
Match: A0A095AUT6 (Leucine-rich repeat flightless-interacting protein 2 OS=Schistosoma haematobium OX=6185 GN=MS3_06650 PE=4 SV=1)

HSP 1 Score: 104.76 bits (260), Expect = 4.951e-22
Identity = 50/87 (57.47%), Postives = 72/87 (82.76%), Query Frame = 3
Query:  858 TKSQGQEYKRQLQISQQKVTALEADVIRLEGQVKRHKSIAESCEKQEEELKQAKRKYQREFREAQNKIEDLKSENATLQKKLEKYAK 1118
            +++Q QEYK +   S QK++ALE+D++RLEGQ KR+K+IA++CE+QEE LKQ +RK QRE RE Q+K+EDLK+ENA LQ+ ++KY +
Sbjct:   80 SRNQAQEYKLKFHESSQKISALESDIVRLEGQTKRYKAIADACEEQEEILKQDRRKCQRELREVQSKLEDLKAENARLQRVVDKYNR 166          
BLAST of Leucine-rich repeat flightless-interacting protein 2 vs. TrEMBL
Match: A0A0R3SWN4 (Uncharacterized protein OS=Hymenolepis diminuta OX=6216 GN=HDID_LOCUS10106 PE=4 SV=1)

HSP 1 Score: 106.301 bits (264), Expect = 2.109e-21
Identity = 53/95 (55.79%), Postives = 72/95 (75.79%), Query Frame = 3
Query:  855 ATKSQGQEYKRQLQISQQKVTALEADVIRLEGQVKRHKSIAESCEKQEEELKQAKRKYQREFREAQNKIEDLKSENATLQKKLEKYAKQKSKKET 1139
            A +SQ Q+YK +L+ + QK+T LE D+IRLEGQVKR K+IAE+ E QE++LKQ +RK QRE REA + I+DLKSEN TLQ+K++K ++      T
Sbjct:  210 AARSQAQDYKFRLEQANQKITGLEGDIIRLEGQVKRFKTIAENAETQEDQLKQERRKLQRELREALSTIDDLKSENFTLQRKIDKLSRSGPGLPT 304          
BLAST of Leucine-rich repeat flightless-interacting protein 2 vs. TrEMBL
Match: A0A0R3TQR6 (Uncharacterized protein OS=Rodentolepis nana OX=102285 GN=HNAJ_LOCUS9889 PE=4 SV=1)

HSP 1 Score: 103.605 bits (257), Expect = 7.470e-21
Identity = 50/93 (53.76%), Postives = 71/93 (76.34%), Query Frame = 3
Query:  861 KSQGQEYKRQLQISQQKVTALEADVIRLEGQVKRHKSIAESCEKQEEELKQAKRKYQREFREAQNKIEDLKSENATLQKKLEKYAKQKSKKET 1139
            +SQ Q+YK +L+ + QK++ LE D+IRLEGQVKR K+IAE  E QE++LKQ +RK QRE REA + ++DLKSEN+TLQ+K++K ++      T
Sbjct:  164 RSQAQDYKFRLEQANQKISGLEGDIIRLEGQVKRFKTIAEDAETQEDQLKQERRKLQRELREALSTVDDLKSENSTLQRKIDKLSRGGPGLPT 256          
BLAST of Leucine-rich repeat flightless-interacting protein 2 vs. TrEMBL
Match: H2KS12 (Leucine-rich repeat flightless-interacting protein 2 OS=Clonorchis sinensis OX=79923 GN=CLF_107788 PE=4 SV=1)

HSP 1 Score: 106.301 bits (264), Expect = 7.759e-21
Identity = 51/83 (61.45%), Postives = 71/83 (85.54%), Query Frame = 3
Query:  861 KSQGQEYKRQLQISQQKVTALEADVIRLEGQVKRHKSIAESCEKQEEELKQAKRKYQREFREAQNKIEDLKSENATLQKKLEK 1109
            +SQ QEYK +LQ + QK  +LE+D++RLEGQ+KR+K+IA+SCE+QE +LKQ +RK+QRE RE Q+++ED KSENA LQ+KL+K
Sbjct:  282 RSQAQEYKYKLQEALQKNASLESDIVRLEGQIKRYKTIADSCEQQEADLKQDRRKFQRELREVQSQLEDYKSENARLQRKLDK 364          
BLAST of Leucine-rich repeat flightless-interacting protein 2 vs. TrEMBL
Match: A0A430Q714 (Uncharacterized protein OS=Schistosoma bovis OX=6184 GN=DC041_0004519 PE=4 SV=1)

HSP 1 Score: 105.145 bits (261), Expect = 1.087e-20
Identity = 50/87 (57.47%), Postives = 72/87 (82.76%), Query Frame = 3
Query:  858 TKSQGQEYKRQLQISQQKVTALEADVIRLEGQVKRHKSIAESCEKQEEELKQAKRKYQREFREAQNKIEDLKSENATLQKKLEKYAK 1118
            +++Q QEYK +   S QK++ALE+D++RLEGQ KR+K+IA++CE+QEE LKQ +RK QRE RE Q+K+EDLK+ENA LQ+ ++KY +
Sbjct:  255 SRNQAQEYKLKFHESSQKISALESDIVRLEGQTKRYKAIADACEEQEEILKQDRRKCQRELREVQSKLEDLKAENARLQRVVDKYNR 341          
BLAST of Leucine-rich repeat flightless-interacting protein 2 vs. Ensembl Cavefish
Match: lrrfip1a (leucine-rich repeat flightless-interacting protein 2-like [Source:NCBI gene;Acc:103029480])

HSP 1 Score: 79.7221 bits (195), Expect = 2.935e-15
Identity = 44/70 (62.86%), Postives = 54/70 (77.14%), Query Frame = 3
Query:  900 SQQKVTALEADVIRLEGQVKRHKSIAESCEKQEEELKQAKRKYQREFREAQNKIEDLKSENATLQKKLEK 1109
            S+Q+VTALE +  RLEGQV R+KS AE+ EK E+ELK  KRK QRE R A +KIE+LKS N+ L K+LEK
Sbjct:  479 SEQEVTALEQNATRLEGQVSRYKSAAENAEKVEDELKAEKRKLQRELRSALDKIEELKSSNSHLTKRLEK 548          
BLAST of Leucine-rich repeat flightless-interacting protein 2 vs. Ensembl Cavefish
Match: lrrfip1b (leucine rich repeat (in FLII) interacting protein 1b [Source:ZFIN;Acc:ZDB-GENE-050208-324])

HSP 1 Score: 74.3294 bits (181), Expect = 1.613e-13
Identity = 39/76 (51.32%), Postives = 56/76 (73.68%), Query Frame = 3
Query:  900 SQQKVTALEADVIRLEGQVKRHKSIAESCEKQEEELKQAKRKYQREFREAQNKIEDLKSENATLQKKLEKYAKQKS 1127
            S+Q+V ALE +VIRLEGQV R+K  +E+ EK E++LK  KRK QRE R A ++I++L++ N+ L K+LEK    +S
Sbjct:  432 SEQEVAALEQNVIRLEGQVSRYKGASETAEKVEDDLKVEKRKLQRELRAALDRIDELEASNSHLSKRLEKMKANRS 507          
BLAST of Leucine-rich repeat flightless-interacting protein 2 vs. Ensembl Cavefish
Match: lrrfip2 (LRR binding FLII interacting protein 2 [Source:NCBI gene;Acc:103025030])

HSP 1 Score: 70.0922 bits (170), Expect = 2.589e-12
Identity = 39/79 (49.37%), Postives = 57/79 (72.15%), Query Frame = 3
Query:  876 EYKRQLQISQQKVTALEADVIRLEGQVKRHKSIAESCEKQEEELKQAKRKYQREFREAQNKIEDLKSENATLQKKLEKY 1112
            EYK +L  ++Q++  +E +V RLEGQV R+K+ A++ EK E+ELK  KRK QRE R A +KIE+++  N+ L K+LEK 
Sbjct:  316 EYKFKLSKAEQEMGTMEQNVSRLEGQVSRYKAAADNSEKVEDELKAEKRKLQRELRTALDKIEEMEMTNSHLVKRLEKM 394          
BLAST of Leucine-rich repeat flightless-interacting protein 2 vs. Ensembl Cavefish
Match: lrrfip2 (LRR binding FLII interacting protein 2 [Source:NCBI gene;Acc:103025030])

HSP 1 Score: 70.0922 bits (170), Expect = 2.831e-12
Identity = 39/78 (50.00%), Postives = 57/78 (73.08%), Query Frame = 3
Query:  876 EYKRQLQISQQKVTALEADVIRLEGQVKRHKSIAESCEKQEEELKQAKRKYQREFREAQNKIEDLKSENATLQKKLEK 1109
            EYK +L  ++Q++  +E +V RLEGQV R+K+ A++ EK E+ELK  KRK QRE R A +KIE+++  N+ L K+LEK
Sbjct:  340 EYKFKLSKAEQEMGTMEQNVSRLEGQVSRYKAAADNSEKVEDELKAEKRKLQRELRTALDKIEEMEMTNSHLVKRLEK 417          
BLAST of Leucine-rich repeat flightless-interacting protein 2 vs. Ensembl Sea Lamprey
Match: lrrfip2 (leucine rich repeat (in FLII) interacting protein 2 [Source:ZFIN;Acc:ZDB-GENE-030131-7781])

HSP 1 Score: 74.7146 bits (182), Expect = 2.176e-14
Identity = 40/78 (51.28%), Postives = 58/78 (74.36%), Query Frame = 3
Query:  876 EYKRQLQISQQKVTALEADVIRLEGQVKRHKSIAESCEKQEEELKQAKRKYQREFREAQNKIEDLKSENATLQKKLEK 1109
            E+K +L  ++Q +TALE  + RLEGQV R+K+ +E+ EK E+ELK  KRK QRE R AQ+++E+L+  N+ L K+LEK
Sbjct:  454 EHKFKLSKAEQDITALEQSIARLEGQVARYKTASENAEKVEDELKAEKRKLQRELRSAQDRVEELEITNSQLTKRLEK 531          
BLAST of Leucine-rich repeat flightless-interacting protein 2 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010593.1 (pep scaffold:Pmarinus_7.0:GL477281:1754:14363:1 gene:ENSPMAG00000009592.1 transcript:ENSPMAT00000010593.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 62.7734 bits (151), Expect = 1.365e-10
Identity = 33/84 (39.29%), Postives = 54/84 (64.29%), Query Frame = 3
Query:  858 TKSQGQEYKRQLQISQQKVTALEADVIRLEGQVKRHKSIAESCEKQEEELKQAKRKYQREFREAQNKIEDLKSENATLQKKLEK 1109
            T     EYK +L  S+Q+   LE +++RL+GQ+ RHK+ A+  EK+E+ELK  +R+ QRE   A  K++++++ N  L  +L K
Sbjct:  376 TNKHLSEYKYKLAKSEQEKATLEKNILRLQGQISRHKAAADGAEKEEDELKADRRRLQRELHMALEKLDEMETTNNHLMMRLSK 459          
BLAST of Leucine-rich repeat flightless-interacting protein 2 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010594.1 (pep scaffold:Pmarinus_7.0:GL477281:1760:14318:1 gene:ENSPMAG00000009592.1 transcript:ENSPMAT00000010594.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 61.6178 bits (148), Expect = 2.380e-10
Identity = 32/82 (39.02%), Postives = 53/82 (64.63%), Query Frame = 3
Query:  858 TKSQGQEYKRQLQISQQKVTALEADVIRLEGQVKRHKSIAESCEKQEEELKQAKRKYQREFREAQNKIEDLKSENATLQKKL 1103
            T     EYK +L  S+Q+   LE +++RL+GQ+ RHK+ A+  EK+E+ELK  +R+ QRE   A  K++++++ N  L  +L
Sbjct:  374 TNKHLSEYKYKLAKSEQEKATLEKNILRLQGQISRHKAAADGAEKEEDELKADRRRLQRELHMALEKLDEMETTNNHLMMRL 455          
BLAST of Leucine-rich repeat flightless-interacting protein 2 vs. Ensembl Medaka
Match: ENSORLT00000022840.2 (leucine-rich repeat flightless-interacting protein 2 [Source:NCBI gene;Acc:101173988])

HSP 1 Score: 79.7221 bits (195), Expect = 4.033e-15
Identity = 49/91 (53.85%), Postives = 63/91 (69.23%), Query Frame = 3
Query:  843 IMILATKSQGQ--EYKRQLQISQQKVTALEADVIRLEGQVKRHKSIAESCEKQEEELKQAKRKYQREFREAQNKIEDLKSENATLQKKLEK 1109
            IM L   S  Q  + K +L  ++Q VTALE +V RLEG V R+KS+AE+ EK E+ELK  KRK QRE R A +KIE+L+S N+ L K+LEK
Sbjct:  530 IMDLQRDSSRQINDLKFKLVKAEQDVTALEQNVTRLEGHVTRYKSLAENAEKVEDELKAEKRKLQRELRSALDKIEELESSNSHLNKRLEK 620          
BLAST of Leucine-rich repeat flightless-interacting protein 2 vs. Ensembl Medaka
Match: ENSORLT00000035063.1 (leucine-rich repeat flightless-interacting protein 2 [Source:NCBI gene;Acc:101173988])

HSP 1 Score: 79.7221 bits (195), Expect = 4.644e-15
Identity = 49/91 (53.85%), Postives = 63/91 (69.23%), Query Frame = 3
Query:  843 IMILATKSQGQ--EYKRQLQISQQKVTALEADVIRLEGQVKRHKSIAESCEKQEEELKQAKRKYQREFREAQNKIEDLKSENATLQKKLEK 1109
            IM L   S  Q  + K +L  ++Q VTALE +V RLEG V R+KS+AE+ EK E+ELK  KRK QRE R A +KIE+L+S N+ L K+LEK
Sbjct:  573 IMDLQRDSSRQINDLKFKLVKAEQDVTALEQNVTRLEGHVTRYKSLAENAEKVEDELKAEKRKLQRELRSALDKIEELESSNSHLNKRLEK 663          
BLAST of Leucine-rich repeat flightless-interacting protein 2 vs. Ensembl Medaka
Match: ENSORLT00000043255.1 (leucine-rich repeat flightless-interacting protein 2 [Source:NCBI gene;Acc:101173988])

HSP 1 Score: 79.337 bits (194), Expect = 5.312e-15
Identity = 49/91 (53.85%), Postives = 63/91 (69.23%), Query Frame = 3
Query:  843 IMILATKSQGQ--EYKRQLQISQQKVTALEADVIRLEGQVKRHKSIAESCEKQEEELKQAKRKYQREFREAQNKIEDLKSENATLQKKLEK 1109
            IM L   S  Q  + K +L  ++Q VTALE +V RLEG V R+KS+AE+ EK E+ELK  KRK QRE R A +KIE+L+S N+ L K+LEK
Sbjct:  597 IMDLQRDSSRQINDLKFKLVKAEQDVTALEQNVTRLEGHVTRYKSLAENAEKVEDELKAEKRKLQRELRSALDKIEELESSNSHLNKRLEK 687          
BLAST of Leucine-rich repeat flightless-interacting protein 2 vs. Ensembl Medaka
Match: ENSORLT00000039655.1 (pep primary_assembly:ASM223467v1:2:25019886:25025427:-1 gene:ENSORLG00000026167.1 transcript:ENSORLT00000039655.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 70.4774 bits (171), Expect = 1.520e-14
Identity = 41/82 (50.00%), Postives = 58/82 (70.73%), Query Frame = 3
Query:  867 QGQEYKRQLQISQQKVTALEADVIRLEGQVKRHKSIAESCEKQEEELKQAKRKYQREFREAQNKIEDLKSENATLQKKLEKY 1112
            Q  E K +L  ++Q+VTALE +VIRL+GQV R+K+ +E+ EK E+ LK  KRK QRE R A ++I +L++ N  L K+LEK 
Sbjct:   10 QISELKFKLVKAEQEVTALEQNVIRLDGQVTRYKTASEAAEKIEDSLKVEKRKLQRELRSALDRIGELEAANKHLSKRLEKM 91          
BLAST of Leucine-rich repeat flightless-interacting protein 2 vs. Ensembl Medaka
Match: lrrfip2 (LRR binding FLII interacting protein 2 [Source:NCBI gene;Acc:111948791])

HSP 1 Score: 67.3958 bits (163), Expect = 2.063e-11
Identity = 36/78 (46.15%), Postives = 56/78 (71.79%), Query Frame = 3
Query:  876 EYKRQLQISQQKVTALEADVIRLEGQVKRHKSIAESCEKQEEELKQAKRKYQREFREAQNKIEDLKSENATLQKKLEK 1109
            EYK +L  ++Q++T +E ++ RLE Q+ R+K  A++ EK E+ELK  KRK QRE R A +K+E+++  N+ L K+LEK
Sbjct:  339 EYKFKLSKAEQEITTMELNITRLEAQMARYKVAADNSEKVEDELKAEKRKLQRELRTALDKLEEMEMTNSHLVKRLEK 416          
BLAST of Leucine-rich repeat flightless-interacting protein 2 vs. Planmine SMEST
Match: SMESG000041553.1 (SMESG000041553.1)

HSP 1 Score: 181.415 bits (459), Expect = 7.473e-51
Identity = 94/95 (98.95%), Postives = 94/95 (98.95%), Query Frame = 3
Query:  855 ATKSQGQEYKRQLQISQQKVTALEADVIRLEGQVKRHKSIAESCEKQEEELKQAKRKYQREFREAQNKIEDLKSENATLQKKLEKYAKQKSKKET 1139
             TKSQGQEYKRQLQISQQKVTALEADVIRLEGQVKRHKSIAESCEKQEEELKQAKRKYQREFREAQNKIEDLKSENATLQKKLEKYAKQKSKKET
Sbjct:  293 TTKSQGQEYKRQLQISQQKVTALEADVIRLEGQVKRHKSIAESCEKQEEELKQAKRKYQREFREAQNKIEDLKSENATLQKKLEKYAKQKSKKET 387          
BLAST of Leucine-rich repeat flightless-interacting protein 2 vs. Planmine SMEST
Match: SMESG000041553.1 (SMESG000041553.1)

HSP 1 Score: 174.866 bits (442), Expect = 2.576e-48
Identity = 94/102 (92.16%), Postives = 94/102 (92.16%), Query Frame = 3
Query:  855 ATKSQGQEYKRQLQISQQKVTALEADV-------IRLEGQVKRHKSIAESCEKQEEELKQAKRKYQREFREAQNKIEDLKSENATLQKKLEKYAKQKSKKET 1139
             TKSQGQEYKRQLQISQQKVTALEADV       IRLEGQVKRHKSIAESCEKQEEELKQAKRKYQREFREAQNKIEDLKSENATLQKKLEKYAKQKSKKET
Sbjct:  293 TTKSQGQEYKRQLQISQQKVTALEADVKTLENKVIRLEGQVKRHKSIAESCEKQEEELKQAKRKYQREFREAQNKIEDLKSENATLQKKLEKYAKQKSKKET 394          
The following BLAST results are available for this feature:
BLAST of Leucine-rich repeat flightless-interacting protein 2 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
LRRFIP13.394e-1352.38LRR binding FLII interacting protein 1 [Source:HGN... [more]
LRRFIP23.400e-1352.56LRR binding FLII interacting protein 2 [Source:HGN... [more]
LRRFIP23.790e-1352.56LRR binding FLII interacting protein 2 [Source:HGN... [more]
LRRFIP23.790e-1352.56LRR binding FLII interacting protein 2 [Source:HGN... [more]
LRRFIP24.396e-1352.56LRR binding FLII interacting protein 2 [Source:HGN... [more]
back to top
BLAST of Leucine-rich repeat flightless-interacting protein 2 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 2
Match NameE-valueIdentityDescription
flap-12.631e-737.21FLi1-Associated Protein homolog [Source:UniProtKB... [more]
flap-12.728e-737.21FLi1-Associated Protein homolog [Source:UniProtKB... [more]
back to top
BLAST of Leucine-rich repeat flightless-interacting protein 2 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Leucine-rich repeat flightless-interacting protein 2 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
BX247888.24.931e-1754.32pep chromosome:GRCz11:CHR_ALT_CTG9_1_11:24103430:2... [more]
lrrfip1a1.227e-1553.66leucine rich repeat (in FLII) interacting protein ... [more]
BX247888.25.665e-1554.32pep chromosome:GRCz11:CHR_ALT_CTG9_1_11:24062529:2... [more]
BX247888.27.799e-1553.66pep chromosome:GRCz11:CHR_ALT_CTG9_1_11:24062535:2... [more]
BX247888.29.709e-1554.32pep chromosome:GRCz11:CHR_ALT_CTG9_1_11:24062529:2... [more]
back to top
BLAST of Leucine-rich repeat flightless-interacting protein 2 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
bhmt3.288e-1351.28betaine--homocysteine S-methyltransferase [Source:... [more]
bhmt4.964e-1351.28betaine--homocysteine S-methyltransferase [Source:... [more]
bhmt5.747e-1351.28betaine--homocysteine S-methyltransferase [Source:... [more]
bhmt8.261e-1351.28betaine--homocysteine S-methyltransferase [Source:... [more]
bhmt9.196e-1351.28betaine--homocysteine S-methyltransferase [Source:... [more]
back to top
BLAST of Leucine-rich repeat flightless-interacting protein 2 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Lrrfip12.362e-1351.19leucine rich repeat (in FLII) interacting protein ... [more]
Lrrfip22.792e-1351.28leucine rich repeat (in FLII) interacting protein ... [more]
Lrrfip23.355e-1351.28leucine rich repeat (in FLII) interacting protein ... [more]
Lrrfip23.549e-1350.63leucine rich repeat (in FLII) interacting protein ... [more]
Lrrfip23.715e-1351.28leucine rich repeat (in FLII) interacting protein ... [more]
back to top
BLAST of Leucine-rich repeat flightless-interacting protein 2 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q6GNW0|LRRF2_XENLA7.270e-1353.85Leucine-rich repeat flightless-interacting protein... [more]
sp|Q4V7E8|LRRF2_RAT1.561e-1252.56Leucine-rich repeat flightless-interacting protein... [more]
sp|Q9Y608|LRRF2_HUMAN2.707e-1252.56Leucine-rich repeat flightless-interacting protein... [more]
sp|Q91WK0|LRRF2_MOUSE2.814e-1251.28Leucine-rich repeat flightless-interacting protein... [more]
sp|B2GUE2|LRRF2_XENTR3.262e-1251.28Leucine-rich repeat flightless-interacting protein... [more]
back to top
BLAST of Leucine-rich repeat flightless-interacting protein 2 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A095AUT64.951e-2257.47Leucine-rich repeat flightless-interacting protein... [more]
A0A0R3SWN42.109e-2155.79Uncharacterized protein OS=Hymenolepis diminuta OX... [more]
A0A0R3TQR67.470e-2153.76Uncharacterized protein OS=Rodentolepis nana OX=10... [more]
H2KS127.759e-2161.45Leucine-rich repeat flightless-interacting protein... [more]
A0A430Q7141.087e-2057.47Uncharacterized protein OS=Schistosoma bovis OX=61... [more]
back to top
BLAST of Leucine-rich repeat flightless-interacting protein 2 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 4
Match NameE-valueIdentityDescription
lrrfip1a2.935e-1562.86leucine-rich repeat flightless-interacting protein... [more]
lrrfip1b1.613e-1351.32leucine rich repeat (in FLII) interacting protein ... [more]
lrrfip22.589e-1249.37LRR binding FLII interacting protein 2 [Source:NCB... [more]
lrrfip22.831e-1250.00LRR binding FLII interacting protein 2 [Source:NCB... [more]
back to top
BLAST of Leucine-rich repeat flightless-interacting protein 2 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 3
Match NameE-valueIdentityDescription
lrrfip22.176e-1451.28leucine rich repeat (in FLII) interacting protein ... [more]
ENSPMAT00000010593.11.365e-1039.29pep scaffold:Pmarinus_7.0:GL477281:1754:14363:1 ge... [more]
ENSPMAT00000010594.12.380e-1039.02pep scaffold:Pmarinus_7.0:GL477281:1760:14318:1 ge... [more]
back to top
BLAST of Leucine-rich repeat flightless-interacting protein 2 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Leucine-rich repeat flightless-interacting protein 2 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Leucine-rich repeat flightless-interacting protein 2 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000022840.24.033e-1553.85leucine-rich repeat flightless-interacting protein... [more]
ENSORLT00000035063.14.644e-1553.85leucine-rich repeat flightless-interacting protein... [more]
ENSORLT00000043255.15.312e-1553.85leucine-rich repeat flightless-interacting protein... [more]
ENSORLT00000039655.11.520e-1450.00pep primary_assembly:ASM223467v1:2:25019886:250254... [more]
lrrfip22.063e-1146.15LRR binding FLII interacting protein 2 [Source:NCB... [more]
back to top
BLAST of Leucine-rich repeat flightless-interacting protein 2 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000041553.17.473e-5198.95SMESG000041553.1[more]
SMESG000041553.12.576e-4892.16SMESG000041553.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30000118 ID=SMED30000118|Name=Leucine-rich repeat flightless-interacting protein 2|organism=Schmidtea mediterranea sexual|type=transcript|length=1950bp
ATCGAATATTTAATCATTGGAATATATTTTTCAAGTTATAGATTATTGTC
ACGATTTCACCCTCCAAAACAATTTCGTAAAATGGTTTTGTGAAATCGTA
TTTATAATCGTGGGCCGCGAAATTATATTATGGCGGTCACATGATGGTTC
GGGTTAGCCACCTTAATTTAAAAAATTACATGCAATGTTTTTAAATTTAG
AAAAGGTTACATTTTAGTTTGTTTCTGGCGTTTTCAGAGACATATTTAGC
AATTATATGCGGAATTGGGCCTTTTCGAAACCCCGATGCAATGTTTGCTT
TATCTTACCCATTATTACATTTAACTTTGTTTATTTTTTTGAACAATCTT
TGATTACAAATTTCTATATAACATAAATGAATCCAATGTTAACCATTGGC
ATTCTTTATTAACATTCCTTTGATATTTTTTCAAAAAAATTACGATGTAA
TGAAACGCTACAAAGTTCAACCCTTGCACTATATATTTAAATGTTCGAAG
TCCTCTGTTGTGTAAAATAGTTAGTAATTCAGCATATTCTAAAGTTTAAG
GGTGCAGAAATGACATTCCTATTATAGATAGAAGCGCCTCTTTCTTTTAG
TGGGTTTCGGATTTGAATCCATGGCAGAAAAAACATTAATATTTGGAAAT
TCTGAACGTTTCAGTTTAGATTTGGGTTTGTTGCAAATTTTTTTAATTTT
TTCAAATTTTTGTCCAATATTTAAACATAATTTCTTTCAAGTTTTGAGCA
GCAGTTATTTTAAAATTTGGGCACAATTGTAATGTTAAAAATCGATATTA
AAGTGAAATAAAATCATTCTCTAATCTAATAATACATCTTTAATCATGAT
TCTAGCCACAAAAAGTCAAGGACAGGAATATAAAAGACAATTGCAGATTT
CCCAACAGAAAGTGACAGCCTTAGAAGCAGATGTCATCCGATTAGAAGGA
CAAGTTAAACGTCACAAATCCATTGCTGAAAGTTGTGAGAAACAAGAAGA
AGAATTAAAACAAGCTAAAAGGAAATACCAGAGAGAATTTCGAGAAGCTC
AAAATAAAATCGAAGACCTTAAATCGGAAAATGCAACTCTACAGAAAAAA
CTCGAGAAATATGCGAAACAGAAATCAAAAAAAGAAACAAATTGAAATTA
GAATTATTTTGCGAATTTTAATTATTAGAAATTTTGATTCTTCATATTTT
AATATGAAATATTTTGTAGTACAATTTTATAATAAATTAGACCAATTGCC
ACAGCTCAATATGTGAAATAACAATTGTGTAGGATTATTTCCGGGCGATA
GATTCGATAAATCCTTTTCCTAATCTCCACCATTGATATCTAACAAACCA
AAAAGATAAATGTAAATATATTTTTTGTTAAATTTTTCTTTGGTTATAAT
ATTGATTTTGTCTGTTTATCGTTAAAATAAAAGATGGACTATTTTTAGCA
GGAAATTAATTTCCAAGGATTTTTGGAATTTTTGTGTGCATTTATCGATT
TATAATAATTAGCTAATTTAGATGTGTGTTCGATTTTTATTGACTTATAC
TTGTGTCAGGTTTCGATTTTTATTGATTTTATTTTTATCTCTTGGATGTT
TCGGGAACACTGCAAGATTTCATTTTGTAATTAAACACGTCGATGTATTC
AAAAAGTGCTGATATTTTTATTTCAGTATCGCACGCACACACAATATGAT
TATTTGTGGAACACAGTATCCGGGAAATGTTCCCATCGGCAATTTTGGCA
CAATCCGTTTTTATGAAATTTTGGATGGCGATTCCTTATGCTTATCTCTC
GATTGCAGAATATTTTGTAATTAAACAAATCGATATTTATTAAGTCCATA
TATTTATATCAGTTTCTCACACGATATAATTACTGTAAATGCACTATTGG
CACACTTTGCTCTATTGATAAAATTCAGGTTGTCATTGATAATAGCTATT
back to top

protein sequence of SMED30000118-orf-1

>SMED30000118-orf-1 ID=SMED30000118-orf-1|Name=SMED30000118-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=100bp
MILATKSQGQEYKRQLQISQQKVTALEADVIRLEGQVKRHKSIAESCEKQ
EEELKQAKRKYQREFREAQNKIEDLKSENATLQKKLEKYAKQKSKKETN*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000034epidermis
PLANA:0000070intestinal phagocyte
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR019139LRRFIP1/2
Vocabulary: biological process
TermDefinition
GO:0006355regulation of transcription, DNA-templated
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 9..99
NoneNo IPR availablePANTHERPTHR19212:SF6LEUCINE-RICH REPEAT FLIGHTLESS-INTERACTING PROTEIN 2coord: 7..89
IPR019139Leucine-rich repeat flightless-interacting protein 1/2PANTHERPTHR19212LEUCINE RICH REPEAT IN FLII INTERACTING PROTEINcoord: 7..89