DnaJ subfamily B

Overview
NameDnaJ subfamily B
Smed IDSMED30000103
Length (bp)1289
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of DnaJ subfamily B (SMED30000103) t-SNE clustered cells

Violin plots show distribution of expression levels for DnaJ subfamily B (SMED30000103) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of DnaJ subfamily B (SMED30000103) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for DnaJ subfamily B (SMED30000103) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30000103

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X2 cellSMED30000103SMESG000073794.1 SmedASXL_009501SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
epidermisSMED30000103SMESG000073794.1 dd_Smed_v4_3588_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
posterior muscle cellSMED30000103SMESG000073794.1 dd_Smed_v4_3588_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
posterior sideSMED30000103SMESG000073794.1 dd_Smed_v4_3588_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30000103SMESG000073794.1 GU591873smed_ncbi_20200123PMID:21356107
Fernández-Taboada et al., 2011
whole organism asexual adult colorimetric in situ hybridization evidence
Note: Hover over icons to view figure legend
Homology
BLAST of DnaJ subfamily B vs. Ensembl Human
Match: DNAJB1 (DnaJ heat shock protein family (Hsp40) member B1 [Source:HGNC Symbol;Acc:HGNC:5270])

HSP 1 Score: 332.413 bits (851), Expect = 2.036e-111
Identity = 178/352 (50.57%), Postives = 236/352 (67.05%), Query Frame = 2
Query:   53 MGKDYYSILGTQKGASDDEIKKAYRKMALKYHPDKNKSPNAEAKFKEIAEAYEVLSDPKKKEIYDKY-XXXXXXXXXXXXXXXXXXXXXFTYTFHGDPREIFKNFFGTDDPFANIFGNHSRRRGADNFMDVDDDFHPGISLFSGFNTGGGSFPHTQM------------KQDPPIYHDLSVSLEDVLSGTLKKIKITRKRPSPAGNSLIDEEKILEIDVKKGWKAGTKITFPREGDKYLTDNIPADIVFVIKDRTHRHFKRDGCDIRIKVKISWKDALCGIPNLQIPTLENQMINLPINTVIKPDTQKRIPGRGLPDNKNPSRRGDIVVEFEIIFPDSLTDNAKKVIKQSLP 1069
            MGKDYY  LG  +GASD+EIK+AYR+ AL+YHPDKNK P AE KFKEIAEAY+VLSDP+K+EI+D+Y  E     G  GGS G      F+YTFHGDP  +F  FFG  +PF   FG    +R  +  MD+DD        FSGF  G G F +               KQDPP+ HDL VSLE++ SG  KK+KI+ KR +P G S+ +E+KIL I+VKKGWK GTKITFP+EGD+  ++NIPADIVFV+KD+ H  FKRDG D+    +IS ++ALCG   + +PTL+ + I +    VI+P  ++++PG GLP  K P +RGD+++EFE+IFP+ +   ++ V++Q LP
Sbjct:    1 MGKDYYQTLGLARGASDEEIKRAYRRQALRYHPDKNKEPGAEEKFKEIAEAYDVLSDPRKREIFDRYGEEGLKGSGPSGGSGGGANGTSFSYTFHGDPHAMFAEFFGGRNPFDTFFG----QRNGEEGMDIDDP-------FSGFPMGMGGFTNVNFGRSRSAQEPARKKQDPPVTHDLRVSLEEIYSGCTKKMKISHKRLNPDGKSIRNEDKILTIEVKKGWKEGTKITFPKEGDQ-TSNNIPADIVFVLKDKPHNIFKRDGSDVIYPARISLREALCGC-TVNVPTLDGRTIPVVFKDVIRPGMRRKVPGEGLPLPKTPEKRGDLIIEFEVIFPERIPQTSRTVLEQVLP 339          
BLAST of DnaJ subfamily B vs. Ensembl Human
Match: DNAJB4 (DnaJ heat shock protein family (Hsp40) member B4 [Source:HGNC Symbol;Acc:HGNC:14886])

HSP 1 Score: 329.717 bits (844), Expect = 1.968e-110
Identity = 181/349 (51.86%), Postives = 241/349 (69.05%), Query Frame = 2
Query:   53 MGKDYYSILGTQKGASDDEIKKAYRKMALKYHPDKNKSPNAEAKFKEIAEAYEVLSDPKKKEIYDKYXXXXXXXXXXXXXXXXXXXXXFTYTFHGDPREIFKNFFGTDDPFANIFGNHSRRRGA---DNFMDVDDDFHPGISLFSGFNTGGGSFPH-------TQMKQDPPIYHDLSVSLEDVLSGTLKKIKITRKRPSPAGNSLIDEEKILEIDVKKGWKAGTKITFPREGDKYLTDNIPADIVFVIKDRTHRHFKRDGCDIRIKVKISWKDALCGIPNLQIPTLENQMINLPINTVIKPDTQKRIPGRGLPDNKNPSRRGDIVVEFEIIFPDSLTDNAKKVIKQSLP 1069
            MGKDYY ILG +KGASD++IKKAYRK ALK+HPDKNKSP AE KFKE+AEAYEVLSDPKK+EIYD++   G +G  GG     G  G F YTFHGDP   F  FFG  +PF   FG   RR G       M++D D       FS F      +P        +++KQDPP+ H+L VSLE++ SG  K++KI+RKR +  G S   E+KIL I++KKGWK GTKITFPREGD+   ++IPADIVF+IKD+ H  FKRDG +I    KIS ++ALCG  ++ +PTL+ + I + +N ++KP  ++RI G GLP  KNP +RGD+++EFE+ FPD+++ ++K+V+++ LP
Sbjct:    1 MGKDYYCILGIEKGASDEDIKKAYRKQALKFHPDKNKSPQAEEKFKEVAEAYEVLSDPKKREIYDQF---GEEGLKGGAGGTDGQGGTFRYTFHGDPHATFAAFFGGSNPFEIFFG---RRMGGGRDSEEMEIDGD------PFSAFGFSMNGYPRDRNSVGPSRLKQDPPVIHELRVSLEEIYSGCTKRMKISRKRLNADGRSYRSEDKILTIEIKKGWKEGTKITFPREGDE-TPNSIPADIVFIIKDKDHPKFKRDGSNIIYTAKISLREALCGC-SINVPTLDGRNIPMSVNDIVKPGMRRRIIGYGLPFPKNPDQRGDLLIEFEVSFPDTISSSSKEVLRKHLP 335          
BLAST of DnaJ subfamily B vs. Ensembl Human
Match: DNAJB5 (DnaJ heat shock protein family (Hsp40) member B5 [Source:HGNC Symbol;Acc:HGNC:14887])

HSP 1 Score: 323.168 bits (827), Expect = 1.265e-107
Identity = 181/352 (51.42%), Postives = 232/352 (65.91%), Query Frame = 2
Query:   53 MGKDYYSILGTQKGASDDEIKKAYRKMALKYHPDKNKSPNAEAKFKEIAEAYEVLSDPKKKEIYDKYXXXXXXXXXXXXXXXXXXXXXFTYTFHGDPREIFKNFFGTDDPFANIFGNHSRRRGADNFMDVDDDFHPGISLFSGFNTGGGS-------------FPHTQMKQDPPIYHDLSVSLEDVLSGTLKKIKITRKRPSPAGNSLIDEEKILEIDVKKGWKAGTKITFPREGDKYLTDNIPADIVFVIKDRTHRHFKRDGCDIRIKVKISWKDALCGIPNLQIPTLENQMINLPINTVIKPDTQKRIPGRGLPDNKNPSRRGDIVVEFEIIFPDSLTDNAKKVIKQSLP 1069
            MGKDYY ILG   GA++DEIKKAYRKMALKYHPDKNK PNAE KFKEIAEAY+VLSDPKK+ +YD+Y   G +G   GG    G  G F YTFHGDP   F +FFG  +PF   F +    R    F   D D       F  F   G +             +P  ++ QDPP+ H+L VSLE++  G+ K++KITR+R +P G ++  E+KIL I +K+GWK GTKITFP+EGD    DNIPADIVFV+KD+ H HF+RDG ++     IS K+ALCG   + IPT++ ++I LP N VIKP T KR+ G GLP  K P++RGD++VEF++ FPD LT   ++++KQ LP
Sbjct:    1 MGKDYYKILGIPSGANEDEIKKAYRKMALKYHPDKNKEPNAEEKFKEIAEAYDVLSDPKKRGLYDQY---GEEGLKTGGGTSGGSSGSFHYTFHGDPHATFASFFGGSNPFDIFFASSRSTRPFSGFDPDDMDVDEDEDPFGAFGRFGFNGLSRGPRRAPEPLYPRRKV-QDPPVVHELRVSLEEIYHGSTKRMKITRRRLNPDGRTVRTEDKILHIVIKRGWKEGTKITFPKEGDA-TPDNIPADIVFVLKDKPHAHFRRDGTNVLYSALISLKEALCGC-TVNIPTIDGRVIPLPCNDVIKPGTVKRLRGEGLPFPKVPTQRGDLIVEFKVRFPDRLTPQTRQILKQHLP 346          
BLAST of DnaJ subfamily B vs. Ensembl Human
Match: DNAJB5 (DnaJ heat shock protein family (Hsp40) member B5 [Source:HGNC Symbol;Acc:HGNC:14887])

HSP 1 Score: 323.168 bits (827), Expect = 1.265e-107
Identity = 181/352 (51.42%), Postives = 232/352 (65.91%), Query Frame = 2
Query:   53 MGKDYYSILGTQKGASDDEIKKAYRKMALKYHPDKNKSPNAEAKFKEIAEAYEVLSDPKKKEIYDKYXXXXXXXXXXXXXXXXXXXXXFTYTFHGDPREIFKNFFGTDDPFANIFGNHSRRRGADNFMDVDDDFHPGISLFSGFNTGGGS-------------FPHTQMKQDPPIYHDLSVSLEDVLSGTLKKIKITRKRPSPAGNSLIDEEKILEIDVKKGWKAGTKITFPREGDKYLTDNIPADIVFVIKDRTHRHFKRDGCDIRIKVKISWKDALCGIPNLQIPTLENQMINLPINTVIKPDTQKRIPGRGLPDNKNPSRRGDIVVEFEIIFPDSLTDNAKKVIKQSLP 1069
            MGKDYY ILG   GA++DEIKKAYRKMALKYHPDKNK PNAE KFKEIAEAY+VLSDPKK+ +YD+Y   G +G   GG    G  G F YTFHGDP   F +FFG  +PF   F +    R    F   D D       F  F   G +             +P  ++ QDPP+ H+L VSLE++  G+ K++KITR+R +P G ++  E+KIL I +K+GWK GTKITFP+EGD    DNIPADIVFV+KD+ H HF+RDG ++     IS K+ALCG   + IPT++ ++I LP N VIKP T KR+ G GLP  K P++RGD++VEF++ FPD LT   ++++KQ LP
Sbjct:    1 MGKDYYKILGIPSGANEDEIKKAYRKMALKYHPDKNKEPNAEEKFKEIAEAYDVLSDPKKRGLYDQY---GEEGLKTGGGTSGGSSGSFHYTFHGDPHATFASFFGGSNPFDIFFASSRSTRPFSGFDPDDMDVDEDEDPFGAFGRFGFNGLSRGPRRAPEPLYPRRKV-QDPPVVHELRVSLEEIYHGSTKRMKITRRRLNPDGRTVRTEDKILHIVIKRGWKEGTKITFPKEGDA-TPDNIPADIVFVLKDKPHAHFRRDGTNVLYSALISLKEALCGC-TVNIPTIDGRVIPLPCNDVIKPGTVKRLRGEGLPFPKVPTQRGDLIVEFKVRFPDRLTPQTRQILKQHLP 346          
BLAST of DnaJ subfamily B vs. Ensembl Human
Match: DNAJB5 (DnaJ heat shock protein family (Hsp40) member B5 [Source:HGNC Symbol;Acc:HGNC:14887])

HSP 1 Score: 323.939 bits (829), Expect = 6.780e-107
Identity = 181/353 (51.27%), Postives = 232/353 (65.72%), Query Frame = 2
Query:   50 AMGKDYYSILGTQKGASDDEIKKAYRKMALKYHPDKNKSPNAEAKFKEIAEAYEVLSDPKKKEIYDKYXXXXXXXXXXXXXXXXXXXXXFTYTFHGDPREIFKNFFGTDDPFANIFGNHSRRRGADNFMDVDDDFHPGISLFSGFNTGGGS-------------FPHTQMKQDPPIYHDLSVSLEDVLSGTLKKIKITRKRPSPAGNSLIDEEKILEIDVKKGWKAGTKITFPREGDKYLTDNIPADIVFVIKDRTHRHFKRDGCDIRIKVKISWKDALCGIPNLQIPTLENQMINLPINTVIKPDTQKRIPGRGLPDNKNPSRRGDIVVEFEIIFPDSLTDNAKKVIKQSLP 1069
             MGKDYY ILG   GA++DEIKKAYRKMALKYHPDKNK PNAE KFKEIAEAY+VLSDPKK+ +YD+Y   G +G   GG    G  G F YTFHGDP   F +FFG  +PF   F +    R    F   D D       F  F   G +             +P  ++ QDPP+ H+L VSLE++  G+ K++KITR+R +P G ++  E+KIL I +K+GWK GTKITFP+EGD    DNIPADIVFV+KD+ H HF+RDG ++     IS K+ALCG   + IPT++ ++I LP N VIKP T KR+ G GLP  K P++RGD++VEF++ FPD LT   ++++KQ LP
Sbjct:   72 VMGKDYYKILGIPSGANEDEIKKAYRKMALKYHPDKNKEPNAEEKFKEIAEAYDVLSDPKKRGLYDQY---GEEGLKTGGGTSGGSSGSFHYTFHGDPHATFASFFGGSNPFDIFFASSRSTRPFSGFDPDDMDVDEDEDPFGAFGRFGFNGLSRGPRRAPEPLYPRRKV-QDPPVVHELRVSLEEIYHGSTKRMKITRRRLNPDGRTVRTEDKILHIVIKRGWKEGTKITFPKEGDA-TPDNIPADIVFVLKDKPHAHFRRDGTNVLYSALISLKEALCGC-TVNIPTIDGRVIPLPCNDVIKPGTVKRLRGEGLPFPKVPTQRGDLIVEFKVRFPDRLTPQTRQILKQHLP 418          
BLAST of DnaJ subfamily B vs. Ensembl Celegans
Match: dnj-13 (DNaJ domain (Prokaryotic heat shock protein) [Source:UniProtKB/TrEMBL;Acc:Q20774])

HSP 1 Score: 285.419 bits (729), Expect = 1.416e-93
Identity = 173/338 (51.18%), Postives = 217/338 (64.20%), Query Frame = 2
Query:   53 MGKDYYSILGTQKGASDDEIKKAYRKMALKYHPDKNKSPNAEAKFKEIAEAYEVLSDPKKKEIYDKYXXXXXXXXXXXXXXXXXXXXXFTYTFHGDPREIFKNFFGTDDPFA----NIFGNHSRRRGADNFMDVDDDFHPGISLFSGFNTGGGSFPHTQMKQDPPIYHDLSVSLEDVLSGTLKKIKITRKRPSPAGNSLIDEEKILEIDVKKGWKAGTKITFPREGDKYLTDNIPADIVFVIKDRTHRHFKRDGCDIRIKVKISWKDALCGIPNLQIPTLENQMINLPINTVIKPDTQKRIPGRGLPDNKNPSRRGDIVVEFEIIFPDSLTDNAKKVI 1054
            MGKDYY +LG  KGA+DDEIKKAYRKMALKYHPDKNK   AE KFKEIAEAY+VLSD KKK+IYD++         GG   G GG GG  Y F GDP  IF +FFG  DPF      +F +     G  N   ++                GG   H   +QDP + HDLSVSLEDVL GT KK+KITRK  +     L  E+K+L + +K GWK+GTKITFP+EGD++  +  PADIVFVIKD+ H  FKR+G DI+   KIS K AL G+ ++ IPTL+     L +N VIKP T +R+ G+GLP+ K+PS RGD+++EF++ FP  L    ++VI
Sbjct:    1 MGKDYYKVLGISKGATDDEIKKAYRKMALKYHPDKNKEAGAENKFKEIAEAYDVLSDDKKKKIYDQF--GEEGLKEGGPGAGGGGGGGMHYEFRGDPMNIFSSFFGGSDPFGAGGPGMF-DLGGGAGGPNMFFMNQGGMDDGMFGGMHQ--GGRRGHA--RQDPAVLHDLSVSLEDVLKGTTKKMKITRKVMTDNAQRL--EDKVLTVTIKPGWKSGTKITFPKEGDQH-PNRTPADIVFVIKDKPHPKFKREGSDIKRVEKISLKSALTGL-DIMIPTLDGADYRLQLNDVIKPGTTRRLTGKGLPNPKSPSHRGDLIIEFDVEFPSQLNPTQREVI 327          
BLAST of DnaJ subfamily B vs. Ensembl Celegans
Match: dnj-13 (DNaJ domain (Prokaryotic heat shock protein) [Source:UniProtKB/TrEMBL;Acc:Q20774])

HSP 1 Score: 285.419 bits (729), Expect = 1.416e-93
Identity = 173/338 (51.18%), Postives = 217/338 (64.20%), Query Frame = 2
Query:   53 MGKDYYSILGTQKGASDDEIKKAYRKMALKYHPDKNKSPNAEAKFKEIAEAYEVLSDPKKKEIYDKYXXXXXXXXXXXXXXXXXXXXXFTYTFHGDPREIFKNFFGTDDPFA----NIFGNHSRRRGADNFMDVDDDFHPGISLFSGFNTGGGSFPHTQMKQDPPIYHDLSVSLEDVLSGTLKKIKITRKRPSPAGNSLIDEEKILEIDVKKGWKAGTKITFPREGDKYLTDNIPADIVFVIKDRTHRHFKRDGCDIRIKVKISWKDALCGIPNLQIPTLENQMINLPINTVIKPDTQKRIPGRGLPDNKNPSRRGDIVVEFEIIFPDSLTDNAKKVI 1054
            MGKDYY +LG  KGA+DDEIKKAYRKMALKYHPDKNK   AE KFKEIAEAY+VLSD KKK+IYD++         GG   G GG GG  Y F GDP  IF +FFG  DPF      +F +     G  N   ++                GG   H   +QDP + HDLSVSLEDVL GT KK+KITRK  +     L  E+K+L + +K GWK+GTKITFP+EGD++  +  PADIVFVIKD+ H  FKR+G DI+   KIS K AL G+ ++ IPTL+     L +N VIKP T +R+ G+GLP+ K+PS RGD+++EF++ FP  L    ++VI
Sbjct:    1 MGKDYYKVLGISKGATDDEIKKAYRKMALKYHPDKNKEAGAENKFKEIAEAYDVLSDDKKKKIYDQF--GEEGLKEGGPGAGGGGGGGMHYEFRGDPMNIFSSFFGGSDPFGAGGPGMF-DLGGGAGGPNMFFMNQGGMDDGMFGGMHQ--GGRRGHA--RQDPAVLHDLSVSLEDVLKGTTKKMKITRKVMTDNAQRL--EDKVLTVTIKPGWKSGTKITFPKEGDQH-PNRTPADIVFVIKDKPHPKFKREGSDIKRVEKISLKSALTGL-DIMIPTLDGADYRLQLNDVIKPGTTRRLTGKGLPNPKSPSHRGDLIIEFDVEFPSQLNPTQREVI 327          
BLAST of DnaJ subfamily B vs. Ensembl Celegans
Match: dnj-19 (DNaJ domain (Prokaryotic heat shock protein) [Source:UniProtKB/TrEMBL;Acc:O16303])

HSP 1 Score: 95.9005 bits (237), Expect = 2.897e-21
Identity = 64/185 (34.59%), Postives = 93/185 (50.27%), Query Frame = 2
Query:  530 PPIYHDLSVSLEDVLSGTLKKIKITRKRPSPAGNSLIDEEKILEIDVKKGWKAGTKITFPREGDKYLTDNIPADIVFVIKDRTHRHFKRDGCDIRIKVKISWKDALCGIPNLQIPTLENQMINLPINT--VIKPDTQKRIPGRGLPDNKNPSRRGDIVVEFEIIFP-DSLTDNAK--KVIKQSLP 1069
            P +   + V   D   G+  K+    K     G    +  KILE+ V  G K   KITF  +GD+   D  P D+V VI+ + H  FKRDG D+ +  K+S  +ALCG  N  I  L+   + L      VIKP   + + G+G+P+ K P  +G++ VEFE+ FP +   D+ K   V+K   P
Sbjct:  202 PGMLQQMQVHC-DACKGSGGKVPAGDKCKGCHGEKYENVSKILEVHVLPGMKHNDKITFKGDGDQSDPDGEPGDVVIVIQQKDHDIFKRDGDDLHMTKKLSLNEALCGY-NFLIKHLDGHPLVLSSKQGDVIKPGVIRGVLGKGMPNKKYPELKGNLFVEFEVEFPKEHFLDDEKAYAVLKSCFP 384          

HSP 2 Score: 60.8474 bits (146), Expect = 8.487e-10
Identity = 32/60 (53.33%), Postives = 43/60 (71.67%), Query Frame = 2
Query:   68 YSILGTQKGASDDEIKKAYRKMALKYHPDKNKSPNAEAKFKEIAEAYEVLSDPKKKEIYD 247
            Y+ L  +  AS  +IKK+Y K+A +YHPDKN  P+   KFKEI+ AYEVLS P+K+ +YD
Sbjct:   15 YTTLNVRPDASQADIKKSYFKLAKEYHPDKN--PDHGDKFKEISFAYEVLSSPEKRRLYD 72          
BLAST of DnaJ subfamily B vs. Ensembl Celegans
Match: dnj-19 (DNaJ domain (Prokaryotic heat shock protein) [Source:UniProtKB/TrEMBL;Acc:O16303])

HSP 1 Score: 95.9005 bits (237), Expect = 2.897e-21
Identity = 64/185 (34.59%), Postives = 93/185 (50.27%), Query Frame = 2
Query:  530 PPIYHDLSVSLEDVLSGTLKKIKITRKRPSPAGNSLIDEEKILEIDVKKGWKAGTKITFPREGDKYLTDNIPADIVFVIKDRTHRHFKRDGCDIRIKVKISWKDALCGIPNLQIPTLENQMINLPINT--VIKPDTQKRIPGRGLPDNKNPSRRGDIVVEFEIIFP-DSLTDNAK--KVIKQSLP 1069
            P +   + V   D   G+  K+    K     G    +  KILE+ V  G K   KITF  +GD+   D  P D+V VI+ + H  FKRDG D+ +  K+S  +ALCG  N  I  L+   + L      VIKP   + + G+G+P+ K P  +G++ VEFE+ FP +   D+ K   V+K   P
Sbjct:  202 PGMLQQMQVHC-DACKGSGGKVPAGDKCKGCHGEKYENVSKILEVHVLPGMKHNDKITFKGDGDQSDPDGEPGDVVIVIQQKDHDIFKRDGDDLHMTKKLSLNEALCGY-NFLIKHLDGHPLVLSSKQGDVIKPGVIRGVLGKGMPNKKYPELKGNLFVEFEVEFPKEHFLDDEKAYAVLKSCFP 384          

HSP 2 Score: 60.8474 bits (146), Expect = 8.487e-10
Identity = 32/60 (53.33%), Postives = 43/60 (71.67%), Query Frame = 2
Query:   68 YSILGTQKGASDDEIKKAYRKMALKYHPDKNKSPNAEAKFKEIAEAYEVLSDPKKKEIYD 247
            Y+ L  +  AS  +IKK+Y K+A +YHPDKN  P+   KFKEI+ AYEVLS P+K+ +YD
Sbjct:   15 YTTLNVRPDASQADIKKSYFKLAKEYHPDKN--PDHGDKFKEISFAYEVLSSPEKRRLYD 72          
BLAST of DnaJ subfamily B vs. Ensembl Celegans
Match: dnj-12 (DNaJ domain (Prokaryotic heat shock protein) [Source:UniProtKB/TrEMBL;Acc:O45502])

HSP 1 Score: 84.3445 bits (207), Expect = 1.292e-17
Identity = 39/62 (62.90%), Postives = 52/62 (83.87%), Query Frame = 2
Query:   65 YYSILGTQKGASDDEIKKAYRKMALKYHPDKNKSPNAEAKFKEIAEAYEVLSDPKKKEIYDK 250
            YY +LG +  ASD+E+KKAYRKMALK+HPDKN  P+   +FK+I++AYEVLSD KK++IYD+
Sbjct:    7 YYDVLGVKPDASDNELKKAYRKMALKFHPDKN--PDGAEQFKQISQAYEVLSDEKKRQIYDQ 66          

HSP 2 Score: 75.8702 bits (185), Expect = 8.416e-15
Identity = 48/151 (31.79%), Postives = 77/151 (50.99%), Query Frame = 2
Query:  626 GNSLIDEEKILEIDVKKGWKAGTKITFPREGDKYLTDNIPADIVFVIKDRTHRHFKRDGCDIRIKVKISWKDALCGIPNLQIPTLENQMI---NLPINTVIKPDTQKRIPGRGLPDNKNPSRRGDIVVEFEIIFPDSLTDNAKKVIKQSLP 1069
            G   + E++I+E+ +  G K G K  F  +GD+ +    P D V V+ +  H  F R G ++ I+  I   +ALCG     I TL+ + I    LP   +   D  K I   G+P  +  S +GD++V+F++ FPD +  +A K +   LP
Sbjct:  199 GKKQVKEDEIIEVGITPGMKDGEKFVFEGKGDEVIGIEKPGDFVVVLDEVEHEKFVRKGDNLIIQHNIDLSEALCGFVRT-ISTLDGRTIFYRVLPGEVIAHADV-KVIHNEGMPMRRASSDKGDLLVQFDVKFPDKINPDAAKKLADLLP 347          
BLAST of DnaJ subfamily B vs. Ensembl Fly
Match: DnaJ-1 (gene:FBgn0263106 transcript:FBtr0077123)

HSP 1 Score: 296.975 bits (759), Expect = 5.312e-98
Identity = 179/358 (50.00%), Postives = 224/358 (62.57%), Query Frame = 2
Query:   53 MGKDYYSILGTQKGASDDEIKKAYRKMALKYHPDKNKSPNAEAKFKEIAEAYEVLSDPKKKEIYDKYXXXXXXXXXXXXXXXXXXXXXFTYTFHGDPREIFKNFFGTDDPFANIFGNHSRRRGADNFMDVDDDFHPGISLFSG----------FNTGG-------GSFPHTQMKQDPPIYHDLSVSLEDVLSGTLKKIKITRKRPSPAGNSLIDEEKILEIDVKKGWKAGTKITFPREGDKYLTDNIPADIVFVIKDRTHRHFKRDGCDIRIKVKISWKDALCGIPNLQIPTLENQMINL-PINTVIKPDTQKRIPGRGLPDNKNPSRRGDIVVEFEIIFPDSLTDNAKKVIKQSLPD 1072
            MGKD+Y ILG ++ ASDDEIKKAYRK+ALKYHPDKNKSP AE +FKEIAEAYEVLSD KK++I+D Y  E    G   G DG G PG +TY FHGDPR  F  FFG+ DPF   F       G DN             +FSG          +N GG          P  + +QDPPI HDL VSLE+V  G +KK+KI+R   +   N    EEK+L I VK GWKAGTKITFP+EGD    +  PADIVF+I+D+ H  FKR+G D++   +IS K ALCG   + +PTL+   I + P + +IKP T +RI G GLP  K PSRRGD++V F+I FPD+L  + +  + + LP+
Sbjct:    1 MGKDFYKILGLERKASDDEIKKAYRKLALKYHPDKNKSPQAEERFKEIAEAYEVLSDKKKRDIFDNY-GEDGLKGGQPGPDGGGQPGAYTYQFHGDPRATFAQFFGSSDPFGAFF------TGGDN-------------MFSGGQGGNTNEIFWNIGGDDMFAFNAQAPSRKRQQDPPIEHDLFVSLEEVDKGCIKKMKISRM--ATGSNGPYKEEKVLRITVKPGWKAGTKITFPQEGDS-APNKTPADIVFIIRDKPHSLFKREGIDLKYTAQISLKQALCGA-LVSVPTLQGSRIQVNPNHEIIKPTTTRRINGLGLPVPKEPSRRGDLIVSFDIKFPDTLAPSLQNQLSELLPN 334          
BLAST of DnaJ subfamily B vs. Ensembl Fly
Match: DnaJ-1 (gene:FBgn0263106 transcript:FBtr0077124)

HSP 1 Score: 296.975 bits (759), Expect = 5.312e-98
Identity = 179/358 (50.00%), Postives = 224/358 (62.57%), Query Frame = 2
Query:   53 MGKDYYSILGTQKGASDDEIKKAYRKMALKYHPDKNKSPNAEAKFKEIAEAYEVLSDPKKKEIYDKYXXXXXXXXXXXXXXXXXXXXXFTYTFHGDPREIFKNFFGTDDPFANIFGNHSRRRGADNFMDVDDDFHPGISLFSG----------FNTGG-------GSFPHTQMKQDPPIYHDLSVSLEDVLSGTLKKIKITRKRPSPAGNSLIDEEKILEIDVKKGWKAGTKITFPREGDKYLTDNIPADIVFVIKDRTHRHFKRDGCDIRIKVKISWKDALCGIPNLQIPTLENQMINL-PINTVIKPDTQKRIPGRGLPDNKNPSRRGDIVVEFEIIFPDSLTDNAKKVIKQSLPD 1072
            MGKD+Y ILG ++ ASDDEIKKAYRK+ALKYHPDKNKSP AE +FKEIAEAYEVLSD KK++I+D Y  E    G   G DG G PG +TY FHGDPR  F  FFG+ DPF   F       G DN             +FSG          +N GG          P  + +QDPPI HDL VSLE+V  G +KK+KI+R   +   N    EEK+L I VK GWKAGTKITFP+EGD    +  PADIVF+I+D+ H  FKR+G D++   +IS K ALCG   + +PTL+   I + P + +IKP T +RI G GLP  K PSRRGD++V F+I FPD+L  + +  + + LP+
Sbjct:    1 MGKDFYKILGLERKASDDEIKKAYRKLALKYHPDKNKSPQAEERFKEIAEAYEVLSDKKKRDIFDNY-GEDGLKGGQPGPDGGGQPGAYTYQFHGDPRATFAQFFGSSDPFGAFF------TGGDN-------------MFSGGQGGNTNEIFWNIGGDDMFAFNAQAPSRKRQQDPPIEHDLFVSLEEVDKGCIKKMKISRM--ATGSNGPYKEEKVLRITVKPGWKAGTKITFPQEGDS-APNKTPADIVFIIRDKPHSLFKREGIDLKYTAQISLKQALCGA-LVSVPTLQGSRIQVNPNHEIIKPTTTRRINGLGLPVPKEPSRRGDLIVSFDIKFPDTLAPSLQNQLSELLPN 334          
BLAST of DnaJ subfamily B vs. Ensembl Fly
Match: CG5001 (gene:FBgn0031322 transcript:FBtr0307057)

HSP 1 Score: 292.738 bits (748), Expect = 3.981e-96
Identity = 169/351 (48.15%), Postives = 222/351 (63.25%), Query Frame = 2
Query:   53 MGKDYYSILGTQKGASDDEIKKAYRKMALKYHPDKNKSPNAEAKFKEIAEAYEVLSDPKKKEIYDKYXXXXXXXXXXXXXXXXXXXXXFTYTFHGDPREIFKNFFGTDDPFANIFGNHSRRRGADNF-MDVDDDFHP----GISLFSGFNTGGGSFP---HT----QMKQDPPIYHDLSVSLEDVLSGTLKKIKITRKRPSPAGNSLIDEEKILEIDVKKGWKAGTKITFPREGDKYLTDNIPADIVFVIKDRTHRHFKRDGCDIRIKVKISWKDALCGIPNLQIPTLENQMINLP-INTVIKPDTQKRIPGRGLPDNKNPSRRGDIVVEFEIIFPDSLTDNAKKVIKQSL 1066
            MGKDYY ILG  K A+DDEIKKAYRK+AL+YHPDKNK+ NAE KFKE+AEAYEVLSD  K+E+YDKY         GG  +G      FTY FHGDPR  F  FFG  +PFA+ F           F +D + DF      GI    G  +G  S     HT    + KQDPP+ HDL V+LE++  G +KK+KI+R+     G+S   EEK L I +K GWK+GTK+TF +EGD+     IPADIVF+I+D+ H  FKR+G D+R   +++ K ALCG+   Q+PT+    + +  +  +IKP+T KRI G GLP  K+ +R+GD++V F+I FP+ LT   K+V+K  L
Sbjct:    1 MGKDYYKILGLPKTATDDEIKKAYRKLALRYHPDKNKAANAEDKFKEVAEAYEVLSDKSKREVYDKY--GEDGLKSGGTRNGGPSSNSFTYQFHGDPRATFAQFFGNSNPFASFFDMGDNLFDKKVFDLDTEPDFFSSPFGGIGSRHGLGSGFRSHSFNVHTPFKKEQKQDPPVEHDLYVTLEEIYHGCVKKMKISRRIVQADGSSR-KEEKFLAISIKPGWKSGTKVTFQKEGDQ-APGKIPADIVFIIRDKPHAMFKREGSDLRYTARLTLKQALCGVV-FQVPTMSGDKLRISTMQEIIKPNTVKRIQGYGLPFPKDTTRKGDLLVAFDIQFPEKLTAAQKEVLKDML 346          
BLAST of DnaJ subfamily B vs. Ensembl Fly
Match: CG5001 (gene:FBgn0031322 transcript:FBtr0335379)

HSP 1 Score: 290.426 bits (742), Expect = 4.341e-95
Identity = 172/361 (47.65%), Postives = 223/361 (61.77%), Query Frame = 2
Query:   53 MGKDYYSILGTQKGASDDEIKKAYRKMALKYHPDKNKSPNAEAKFKEIAEAYEVLSDPKKKEIYDKYXXXXXXXXXXXXXXXXXXXXXFTYTFHGDPREIFKNFFGTDDPFANIFGNHSRRRGADNFMD---VDDDFHPGI--SLFSGFNT----GGGSFP---------HT----QMKQDPPIYHDLSVSLEDVLSGTLKKIKITRKRPSPAGNSLIDEEKILEIDVKKGWKAGTKITFPREGDKYLTDNIPADIVFVIKDRTHRHFKRDGCDIRIKVKISWKDALCGIPNLQIPTLENQMINLP-INTVIKPDTQKRIPGRGLPDNKNPSRRGDIVVEFEIIFPDSLTDNAKKVIKQSL 1066
            MGKDYY ILG  K A+DDEIKKAYRK+AL+YHPDKNK+ NAE KFKE+AEAYEVLSD  K+E+YDKY         GG  +G      FTY FHGDPR  F  FFG  +PFA+ F         DN  D    D D  P    S F G  +    G G  P         HT    + KQDPP+ HDL V+LE++  G +KK+KI+R+     G+S   EEK L I +K GWK+GTK+TF +EGD+     IPADIVF+I+D+ H  FKR+G D+R   +++ K ALCG+   Q+PT+    + +  +  +IKP+T KRI G GLP  K+ +R+GD++V F+I FP+ LT   K+V+K  L
Sbjct:    1 MGKDYYKILGLPKTATDDEIKKAYRKLALRYHPDKNKAANAEDKFKEVAEAYEVLSDKSKREVYDKY--GEDGLKSGGTRNGGPSSNSFTYQFHGDPRATFAQFFGNSNPFASFFDM------GDNLFDKKVFDLDTEPDFFSSPFGGIGSRHGLGSGFRPSFRSHSFNVHTPFKKEQKQDPPVEHDLYVTLEEIYHGCVKKMKISRRIVQADGSSR-KEEKFLAISIKPGWKSGTKVTFQKEGDQ-APGKIPADIVFIIRDKPHAMFKREGSDLRYTARLTLKQALCGVV-FQVPTMSGDKLRISTMQEIIKPNTVKRIQGYGLPFPKDTTRKGDLLVAFDIQFPEKLTAAQKEVLKDML 350          
BLAST of DnaJ subfamily B vs. Ensembl Fly
Match: CG5001 (gene:FBgn0031322 transcript:FBtr0307056)

HSP 1 Score: 290.426 bits (742), Expect = 4.341e-95
Identity = 172/361 (47.65%), Postives = 223/361 (61.77%), Query Frame = 2
Query:   53 MGKDYYSILGTQKGASDDEIKKAYRKMALKYHPDKNKSPNAEAKFKEIAEAYEVLSDPKKKEIYDKYXXXXXXXXXXXXXXXXXXXXXFTYTFHGDPREIFKNFFGTDDPFANIFGNHSRRRGADNFMD---VDDDFHPGI--SLFSGFNT----GGGSFP---------HT----QMKQDPPIYHDLSVSLEDVLSGTLKKIKITRKRPSPAGNSLIDEEKILEIDVKKGWKAGTKITFPREGDKYLTDNIPADIVFVIKDRTHRHFKRDGCDIRIKVKISWKDALCGIPNLQIPTLENQMINLP-INTVIKPDTQKRIPGRGLPDNKNPSRRGDIVVEFEIIFPDSLTDNAKKVIKQSL 1066
            MGKDYY ILG  K A+DDEIKKAYRK+AL+YHPDKNK+ NAE KFKE+AEAYEVLSD  K+E+YDKY         GG  +G      FTY FHGDPR  F  FFG  +PFA+ F         DN  D    D D  P    S F G  +    G G  P         HT    + KQDPP+ HDL V+LE++  G +KK+KI+R+     G+S   EEK L I +K GWK+GTK+TF +EGD+     IPADIVF+I+D+ H  FKR+G D+R   +++ K ALCG+   Q+PT+    + +  +  +IKP+T KRI G GLP  K+ +R+GD++V F+I FP+ LT   K+V+K  L
Sbjct:    1 MGKDYYKILGLPKTATDDEIKKAYRKLALRYHPDKNKAANAEDKFKEVAEAYEVLSDKSKREVYDKY--GEDGLKSGGTRNGGPSSNSFTYQFHGDPRATFAQFFGNSNPFASFFDM------GDNLFDKKVFDLDTEPDFFSSPFGGIGSRHGLGSGFRPSFRSHSFNVHTPFKKEQKQDPPVEHDLYVTLEEIYHGCVKKMKISRRIVQADGSSR-KEEKFLAISIKPGWKSGTKVTFQKEGDQ-APGKIPADIVFIIRDKPHAMFKREGSDLRYTARLTLKQALCGVV-FQVPTMSGDKLRISTMQEIIKPNTVKRIQGYGLPFPKDTTRKGDLLVAFDIQFPEKLTAAQKEVLKDML 350          
BLAST of DnaJ subfamily B vs. Ensembl Zebrafish
Match: dnajb1b (DnaJ heat shock protein family (Hsp40) member B1b [Source:ZFIN;Acc:ZDB-GENE-030131-5455])

HSP 1 Score: 332.798 bits (852), Expect = 1.020e-111
Identity = 187/350 (53.43%), Postives = 238/350 (68.00%), Query Frame = 2
Query:   53 MGKDYYSILGTQKGASDDEIKKAYRKMALKYHPDKNKSPNAEAKFKEIAEAYEVLSDPKKKEIYDKYXXXXXXXXXXXXXXXXXXXXXFTYTFHGDPREIFKNFFGTDDPFANIFGNHSRRRGADNFMDVDDDFHPGISLFSGFNTGG-GSFPHT----------QMKQDPPIYHDLSVSLEDVLSGTLKKIKITRKRPSPAGNSLIDEEKILEIDVKKGWKAGTKITFPREGDKYLTDNIPADIVFVIKDRTHRHFKRDGCDIRIKVKISWKDALCGIPNLQIPTLENQMINLPINTVIKPDTQKRIPGRGLPDNKNPSRRGDIVVEFEIIFPDSLTDNAKKVIKQSLP 1069
            MGKDYYS+LG QKGASDDEIKKAYRK ALKYHPDKNKS  AE KFKEIAEAY+VLSDPKKK+IYD++   G +G  GG   G GG G +TYTF GDP  +F  FFG  +PF +IFG++    G D  M+ DD        F+ F  GG G FP +          + KQDP + HDL VSL++V +G  KK+KI+RKR +P G +   E+KIL ++VKKGWK GTKITFPREGD+    NIPAD+VFV+KD+ H  +KRDG DI    KI+ K+ALCG   + +PTL+ + + +    +++P  ++R+ G GLP  K P RRGD+VVE+E+ FP+ L+ NAK  I   LP
Sbjct:    4 MGKDYYSVLGIQKGASDDEIKKAYRKQALKYHPDKNKSAGAEEKFKEIAEAYDVLSDPKKKDIYDRF---GEEGLKGGAPGGGGGGGNYTYTFQGDPHAMFSEFFGGRNPFEHIFGHNG---GMDENMETDDP-------FASFGMGGIGGFPRSFTTHSHGGRMERKQDPAVIHDLRVSLDEVFTGCTKKMKISRKRLNPDGRTTRSEDKILTVEVKKGWKEGTKITFPREGDE-TPSNIPADVVFVLKDKPHPVYKRDGSDIIYPAKITLKEALCGC-VINVPTLDGRTVKVTSQDIVRPGMKRRLTGEGLPLPKAPDRRGDLVVEYEVRFPEKLSQNAKDTIANVLP 338          
BLAST of DnaJ subfamily B vs. Ensembl Zebrafish
Match: dnajb4 (DnaJ heat shock protein family (Hsp40) member B4 [Source:ZFIN;Acc:ZDB-GENE-040801-192])

HSP 1 Score: 331.643 bits (849), Expect = 3.089e-111
Identity = 188/349 (53.87%), Postives = 239/349 (68.48%), Query Frame = 2
Query:   53 MGKDYYSILGTQKGASDDEIKKAYRKMALKYHPDKNKSPNAEAKFKEIAEAYEVLSDPKKKEIYDKYXXXXXXXXXXXXXXXXXXXXXFTYTFHGDPREIFKNFFGTDDPFANIFGNHSRRRGADNF-MDVDDDFHPGISLFSGFNTGGGSFPHT---------QMKQDPPIYHDLSVSLEDVLSGTLKKIKITRKRPSPAGNSLIDEEKILEIDVKKGWKAGTKITFPREGDKYLTDNIPADIVFVIKDRTHRHFKRDGCDIRIKVKISWKDALCGIPNLQIPTLENQMINLPINTVIKPDTQKRIPGRGLPDNKNPSRRGDIVVEFEIIFPDSLTDNAKKVIKQSLP 1069
            MGKDYY ILG  KGASDD+IKKAYRK ALK+HPDKNK+ NAE KFKE+AEAYEVLSDPKK+EIYD+Y   G +G  GGG    G  G FTYTFHGDP   F  FFG   PF   FG     R  D+  +D +D F      F+ FN  G  FP           + KQDP I+H+L VSLE+V  G+ K++KI+RKR +P G +L  E+KIL I++K+GWK GTKITFPREGD+   + IPADIVFVIKD+ H HF+R+G DI   V++S + +LCG  ++ + T++ +  N+ I  VIKP  +K I G+GLP  KNP +RGD++VEF++ FP+SL  NAK V+K+ LP
Sbjct:    1 MGKDYYKILGITKGASDDDIKKAYRKQALKWHPDKNKAANAEEKFKEVAEAYEVLSDPKKREIYDQY---GEEGLKGGGGASDGPGGNFTYTFHGDPHATFATFFGGASPFEVFFGRKVNGRDEDDMEVDGNDPF----GSFTSFNING--FPRERHVGQGGPPRRKQDPAIHHELRVSLEEVFHGSTKRMKISRKRLNPDGRTLRTEDKILTIEIKRGWKEGTKITFPREGDE-TPNTIPADIVFVIKDKPHGHFRREGSDIVYPVRVSLRQSLCGC-SVTVSTIDGKTCNMKITDVIKPGMRKVIAGQGLPFPKNPEQRGDLIVEFDVNFPESLPTNAKDVLKRHLP 338          
BLAST of DnaJ subfamily B vs. Ensembl Zebrafish
Match: dnajb5 (DnaJ heat shock protein family (Hsp40) member B5 [Source:ZFIN;Acc:ZDB-GENE-070705-308])

HSP 1 Score: 326.635 bits (836), Expect = 4.495e-109
Identity = 184/363 (50.69%), Postives = 239/363 (65.84%), Query Frame = 2
Query:   53 MGKDYYSILGTQKGASDDEIKKAYRKMALKYHPDKNKSPNAEAKFKEIAEAYEVLSDPKKKEIYDKYXXXXXXXXXXXXXXXXXXXXXFTYTFHGDPREIFKNFFGTDDPFANIFGNHSRRRG--------ADNFMDVDDD---------FHPGISLFSGFNTGGGSFPHTQ-------MKQDPPIYHDLSVSLEDVLSGTLKKIKITRKRPSPAGNSLIDEEKILEIDVKKGWKAGTKITFPREGDKYLTDNIPADIVFVIKDRTHRHFKRDGCDIRIKVKISWKDALCGIPNLQIPTLENQMINLPINTVIKPDTQKRIPGRGLPDNKNPSRRGDIVVEFEIIFPDSLTDNAKKVIKQSLP 1069
            MGKDYY ILG   G+++DEIKKAYRKMALK+HPDKNK PNAE KFKEIAEAYEVLSDPKK+ IYD+Y         GG    SG    + YTFHGDP   F +FFG  +PF   FG+ SR+RG         D+ MD+D D          H G +  +GF+ GGG     +         QDPP+ H+L VSLE++  G  K+++ITR+R +P   ++  E+KIL I +K+GWK GTKITFP+EGD+   +NIPADI FV+KD+ H  F+RDG +I    KI  K+ALCG   + IPT++N+ I LP N +IKP T KR+ G GLP  KNPS+RGD++VEF++ FPD +   ++++IKQ LP
Sbjct:    1 MGKDYYKILGIPSGSNEDEIKKAYRKMALKFHPDKNKDPNAEEKFKEIAEAYEVLSDPKKRVIYDQY--GEDGLKTGGTGSSSGQGTTYHYTFHGDPHATFASFFGGSNPFDIFFGS-SRQRGNTNGFPDHGDHDMDIDMDGEDDPFSSFSHFGFNGVNGFHHGGGRRHRNEPLHGGRKKLQDPPVVHELKVSLEEIFHGCTKRMRITRRRLNPDRKTMRTEDKILNIVIKRGWKEGTKITFPKEGDE-TPENIPADIAFVLKDKGHPLFRRDGSNIIYTTKIGLKEALCGC-TVNIPTIDNRAITLPCNDIIKPGTIKRLRGEGLPFPKNPSQRGDLIVEFQVRFPDRIPPQSREIIKQHLP 358          
BLAST of DnaJ subfamily B vs. Ensembl Zebrafish
Match: dnajb5 (DnaJ heat shock protein family (Hsp40) member B5 [Source:ZFIN;Acc:ZDB-GENE-070705-308])

HSP 1 Score: 326.635 bits (836), Expect = 4.495e-109
Identity = 184/363 (50.69%), Postives = 239/363 (65.84%), Query Frame = 2
Query:   53 MGKDYYSILGTQKGASDDEIKKAYRKMALKYHPDKNKSPNAEAKFKEIAEAYEVLSDPKKKEIYDKYXXXXXXXXXXXXXXXXXXXXXFTYTFHGDPREIFKNFFGTDDPFANIFGNHSRRRG--------ADNFMDVDDD---------FHPGISLFSGFNTGGGSFPHTQ-------MKQDPPIYHDLSVSLEDVLSGTLKKIKITRKRPSPAGNSLIDEEKILEIDVKKGWKAGTKITFPREGDKYLTDNIPADIVFVIKDRTHRHFKRDGCDIRIKVKISWKDALCGIPNLQIPTLENQMINLPINTVIKPDTQKRIPGRGLPDNKNPSRRGDIVVEFEIIFPDSLTDNAKKVIKQSLP 1069
            MGKDYY ILG   G+++DEIKKAYRKMALK+HPDKNK PNAE KFKEIAEAYEVLSDPKK+ IYD+Y         GG    SG    + YTFHGDP   F +FFG  +PF   FG+ SR+RG         D+ MD+D D          H G +  +GF+ GGG     +         QDPP+ H+L VSLE++  G  K+++ITR+R +P   ++  E+KIL I +K+GWK GTKITFP+EGD+   +NIPADI FV+KD+ H  F+RDG +I    KI  K+ALCG   + IPT++N+ I LP N +IKP T KR+ G GLP  KNPS+RGD++VEF++ FPD +   ++++IKQ LP
Sbjct:    1 MGKDYYKILGIPSGSNEDEIKKAYRKMALKFHPDKNKDPNAEEKFKEIAEAYEVLSDPKKRVIYDQY--GEDGLKTGGTGSSSGQGTTYHYTFHGDPHATFASFFGGSNPFDIFFGS-SRQRGNTNGFPDHGDHDMDIDMDGEDDPFSSFSHFGFNGVNGFHHGGGRRHRNEPLHGGRKKLQDPPVVHELKVSLEEIFHGCTKRMRITRRRLNPDRKTMRTEDKILNIVIKRGWKEGTKITFPKEGDE-TPENIPADIAFVLKDKGHPLFRRDGSNIIYTTKIGLKEALCGC-TVNIPTIDNRAITLPCNDIIKPGTIKRLRGEGLPFPKNPSQRGDLIVEFQVRFPDRIPPQSREIIKQHLP 358          
BLAST of DnaJ subfamily B vs. Ensembl Zebrafish
Match: dnajb1a (DnaJ heat shock protein family (Hsp40) member B1a [Source:ZFIN;Acc:ZDB-GENE-040801-90])

HSP 1 Score: 313.923 bits (803), Expect = 2.287e-104
Identity = 182/345 (52.75%), Postives = 237/345 (68.70%), Query Frame = 2
Query:   53 MGKDYYSILGTQKGASDDEIKKAYRKMALKYHPDKNKSPNAEAKFKEIAEAYEVLSDPKKKEIYDKYXXXXXXXXXXXXXXXXXXXXXFTYTFHGDPREIFKNFFGTDDPFANIFGNHSRRRGADNFMDVDDDFHPGISLF------SGFNTGGGSFPHTQMKQDPPIYHDLSVSLEDVLSGTLKKIKITRKRPSPAGNSLIDEEKILEIDVKKGWKAGTKITFPREGDKYLTDNIPADIVFVIKDRTHRHFKRDGCDIRIKVKISWKDALCGIPNLQIPTLENQMINLPINTVIKPDTQKRIPGRGLPDNKNPSRRGDIVVEFEIIFPDSLTDNAKKVIKQSLP 1069
            MGKDYY ILG +KGASD+EIKKAYRK AL++HPDKNKS  AE KFKEIAEAY+VLSD KKK+IYD+YGE+GLKG  GGG++G       +YTFHGDP  +F  FFG   PF + F +     G ++ MD+DD F             S  +  GG     + K+DPP+ H+L VSLE+V +G  KK+KI+RKR +P G S+ +E+KIL +D+K+GWK GTKITFP+EGD+  T NIPADIVFV+KD+ H  F+RDG DI    +IS ++ALCG   +  PTL+ + + +    VIKP  +KRI G GLP +K P +RGD+V+EF + FPD L   A++ + Q LP
Sbjct:    1 MGKDYYRILGIEKGASDEEIKKAYRKQALRFHPDKNKSAGAEDKFKEIAEAYDVLSDAKKKDIYDRYGEDGLKGHAGGGTNGP------SYTFHGDPHAMFAEFFGGRSPFDHFFASAG---GPNDGMDIDDPFGAFGMGGMGGFPRSFKSRVGGPHGSREKKKDPPVVHELKVSLEEVFAGCTKKMKISRKRLNPDGCSMRNEDKILTVDIKRGWKEGTKITFPKEGDETPT-NIPADIVFVVKDKIHSVFRRDGSDIIYPARISLREALCGC-TINAPTLDGRTVTVSSRDVIKPGMKKRIVGEGLPLSKCPEKRGDMVLEFSVKFPDKLGPGAREALVQILP 334          
BLAST of DnaJ subfamily B vs. Ensembl Xenopus
Match: dnajb4 (DnaJ heat shock protein family (Hsp40) member B4 [Source:NCBI gene;Acc:100125006])

HSP 1 Score: 335.109 bits (858), Expect = 1.600e-112
Identity = 185/347 (53.31%), Postives = 242/347 (69.74%), Query Frame = 2
Query:   53 MGKDYYSILGTQKGASDDEIKKAYRKMALKYHPDKNKSPNAEAKFKEIAEAYEVLSDPKKKEIYDKYXXXXXXXXXXXXXXXXXXXXXFTYTFHGDPREIFKNFFGTDDPFANIFGNHSRRRGADNFMDVDDDFHPGISLFSGFNTGGGSFPHT--------QMKQDPPIYHDLSVSLEDVLSGTLKKIKITRKRPSPAGNSLIDEEKILEIDVKKGWKAGTKITFPREGDKYLTDNIPADIVFVIKDRTHRHFKRDGCDIRIKVKISWKDALCGIPNLQIPTLENQMINLPINTVIKPDTQKRIPGRGLPDNKNPSRRGDIVVEFEIIFPDSLTDNAKKVIKQSLP 1069
            MGKDYYS+LG +KGAS+D+IKKAYRK ALK+HPDKNKS +AE KFKEIAEAYEVLSDPKK+E+YD++   G +G  GG     G  G F YTFHGDP   F  FFG  +PF   FG        D  M++D D     S F+ FN  G  FP          + KQDPPI HDL VSLE++ +G  K+++I+RKR +P G S+  E+KIL I++KKGWK GTKITFPREGD+     IPADIVFV+KD+ H HFKRDG +I   V++S ++ALCG  ++ +PTL+ + I + IN +IKP  ++RI G GLP  KNP + GD++VEFE+IFPDS+  ++K+++++ LP
Sbjct:    1 MGKDYYSVLGIEKGASEDDIKKAYRKQALKWHPDKNKSAHAEEKFKEIAEAYEVLSDPKKREVYDQF---GEEGLKGGSGAPDGHGGNFHYTFHGDPHATFAAFFGGANPFEIFFGRRMPGGRDDEDMELDGD---PFSSFTSFNMNG--FPREKNQVGNQFRRKQDPPIIHDLRVSLEEIYTGCTKRMRISRKRLNPDGRSVRTEDKILTIEIKKGWKEGTKITFPREGDEAPM-TIPADIVFVVKDKPHTHFKRDGSNIVCPVRVSLREALCGC-SINVPTLDGRSIPMTINDIIKPGMRRRIIGYGLPFPKNPEQNGDLLVEFEVIFPDSIPQSSKEILRRHLP 337          
BLAST of DnaJ subfamily B vs. Ensembl Xenopus
Match: chd9 (chromodomain helicase DNA binding protein 9 [Source:Xenbase;Acc:XB-GENE-1217623])

HSP 1 Score: 317.39 bits (812), Expect = 1.432e-104
Identity = 179/352 (50.85%), Postives = 238/352 (67.61%), Query Frame = 2
Query:   53 MGKDYYSILGTQKGASDDEIKKAYRKMALKYHPDKNKSPNAEAKFKEIAEAYEVLSDPKKKEIYDKYXXXXXXXXXXXXXXXXXXXXXFTYTFHGDPREIFKNFFGTDDPFANIFGNHSRRRGADNF----MDVDDD--------FHPGISLFSGFNTGGGSFPHTQMK-QDPPIYHDLSVSLEDVLSGTLKKIKITRKRPSPAGNSLIDEEKILEIDVKKGWKAGTKITFPREGDKYLTDNIPADIVFVIKDRTHRHFKRDGCDIRIKVKISWKDALCGIPNLQIPTLENQMINLPINTVIKPDTQKRIPGRGLPDNKNPSRRGDIVVEFEIIFPDSLTDNAKKVIKQSLP 1069
            MGKDYY ILG   GA++DEIKKAYRKMALKYHPDKNK  NAE KFKEIAEAY+VLSDPKK+ +YD+Y   G +G   GG         F YTFHGDP   F +FFG  +PF   FG+ SR R ++ F    MD+++D           G S  +GF+       H++ K QDPP+ H+L VSLE++  G  K++KITR+R +P G ++  E+KIL + +KKGWK GTKITFP+EGD   ++NIPADIVF++KD+ H  FKRDG +I    KI+ K+ALCG   + IPT++ ++I LP + VIKP   KR+ G GLP  K P++RGD++VEF++ FPD +    ++++KQ LP
Sbjct:   60 MGKDYYKILGLASGANEDEIKKAYRKMALKYHPDKNKDANAEDKFKEIAEAYDVLSDPKKRAVYDQY---GEEGLKTGGGSTGNTGSSFHYTFHGDPHATFASFFGGSNPFDIFFGS-SRSRMSNGFDHEDMDINEDEDDLFGGFGRFGFSGVNGFHKRHQDQLHSRRKVQDPPVVHELKVSLEEIYHGCTKRMKITRRRLNPDGRTVRTEDKILNVVIKKGWKEGTKITFPKEGDA-TSENIPADIVFLLKDKPHALFKRDGSNIVYTAKITLKEALCGC-TVNIPTIDGRVIPLPCSDVIKPGAVKRLRGEGLPFPKVPNQRGDLIVEFQVRFPDRIPQPTRELLKQHLP 405          
BLAST of DnaJ subfamily B vs. Ensembl Xenopus
Match: dnajb1 (DnaJ heat shock protein family (Hsp40) member B1 [Source:NCBI gene;Acc:493474])

HSP 1 Score: 306.605 bits (784), Expect = 3.634e-101
Identity = 182/351 (51.85%), Postives = 234/351 (66.67%), Query Frame = 2
Query:   53 MGKDYYSILGTQKGASDDEIKKAYRKMALKYHPDKNKSPNAEAKFKEIAEAYEVLSDPKKKEIYDKYXXXXXXXXXXXXXXXXXXXXXFTYTFHGDPREIFKNFFGTDDPFANIFG-NHSRRRGADNFMDVDDDFHPGISLFSGF-----------NTGGGSFPHTQMKQDPPIYHDLSVSLEDVLSGTLKKIKITRKRPSPAGNSLIDEEKILEIDVKKGWKAGTKITFPREGDKYLTDNIPADIVFVIKDRTHRHFKRDGCDIRIKVKISWKDALCGIPNLQIPTLENQMINLPINTVIKPDTQKRIPGRGLPDNKNPSRRGDIVVEFEIIFPDSLTDNAKKVIKQSLP 1069
            MGKDYY ILG  KGA+++EIKKAYRK ALKYHPDKNK P AE +FKEIAEAY+VLSDPKK+E++DKYGEEGLKG  GGG    G  G ++YTFHGDP  +F  FFG  +PF   FG N       D F         G     G             +  G       KQDPPI  +L VSLE+V +G  KK+KI+ KR  P G S+ +E+KIL I VKKGWK GTKITFP+EGD+    NIPADIVFV+KD++H  FKR+G D+    KIS ++ALCG  ++ IPT++N+ I L    +I+P T++RI   GLP  K+P +RGD++VEF+I FP+ LT ++++V+++ LP
Sbjct:    1 MGKDYYKILGIPKGATEEEIKKAYRKQALKYHPDKNKDPGAEDRFKEIAEAYDVLSDPKKREVFDKYGEEGLKGTPGGGGSSGGPNGTYSYTFHGDPHAVFAEFFGGRNPFDGFFGRNDDDMDTDDPFAGFGGMGGFGGMGGMGGMGGMGGMGGFPRSASGRRDTVPRKQDPPITRELPVSLEEVFNGCTKKMKISHKRLGPDGRSVRNEDKILTIQVKKGWKEGTKITFPKEGDE-TPSNIPADIVFVLKDKSHPVFKREGSDVVYTSKISLREALCGC-SVNIPTVDNRTIPLTFTDIIRPGTKRRITNEGLPLPKSPDQRGDLIVEFDIRFPERLTASSREVLERVLP 349          
BLAST of DnaJ subfamily B vs. Ensembl Xenopus
Match: dnajb13 (DnaJ heat shock protein family (Hsp40) member B13 [Source:NCBI gene;Acc:780382])

HSP 1 Score: 247.284 bits (630), Expect = 3.907e-78
Identity = 148/340 (43.53%), Postives = 209/340 (61.47%), Query Frame = 2
Query:   50 AMGKDYYSILGTQKGASDDEIKKAYRKMALKYHPDKNKSPNAEAKFKEIAEAYEVLSDPKKKEIYDKYXXXXXXXXXXXXXXXXXXXXXFTYTFHGDPREIFKNFFGTDDPFANIFGNHSRRRGADNFMDVDDDFHPGISLFSGFNTGGGSFPHTQMK-QDPPIYHDLSVSLEDVLSGTLKKIKITRKRPSPAGNSLIDEEKILEIDVKKGWKAGTKITFPREGDKYLTDNIPADIVFVIKDRTHRHFKRDGCDIRIKVKISWKDALCGIPNLQIPTLENQMINLPINTVIKPDTQKRIPGRGLPDNKNPSRRGDIVVEFEIIFPDSLTDNAKKVIKQSL 1066
            AMG+DYYS+L     A D +IKKAYRK+ALKYHP KNK P+A  +FK+IAEAY+VLSD +KK  YDK+GEEGLKGG+     G        Y FHG+P   F  FFG D+PFA+ F                          S  NTG G      MK QDPPI  DL +SLED+  G  KKIKI+R+  +  G++    +KIL ID + GW+ GTKITF  EGD+   + IPADI+F+++++ H  FKR G D+     I    AL G   +++ TL+ +++N+PIN ++ P  +K +PG G+   K+P+ +GD++++F+I FP+ LT   K++++++L
Sbjct:   35 AMGQDYYSVLEITPSAGDSDIKKAYRKLALKYHPLKNKEPSAPHRFKQIAEAYDVLSDLRKKATYDKFGEEGLKGGVPPEFGGEEAWTS-GYVFHGNPDRTFNEFFGGDNPFADFF----------------------TPTGSEVNTGFGGLRGRGMKTQDPPIERDLYLSLEDLFFGCTKKIKISRRVMNDDGHTSSIRDKILSIDARPGWREGTKITFQNEGDQG-PNIIPADIIFIVREKQHPRFKRQGNDLIYTANIELGKALTGC-TVEVETLDERLLNIPINDIVHPTYRKVVPGEGMRLPKDPTLKGDLIIQFDIHFPEHLTPQKKQLLRKAL 349          
BLAST of DnaJ subfamily B vs. Ensembl Xenopus
Match: dnaja4.2 (DnaJ (Hsp40) homolog, subfamily A, member 4, gene 2 [Source:NCBI gene;Acc:549744])

HSP 1 Score: 144.05 bits (362), Expect = 4.003e-38
Identity = 112/348 (32.18%), Postives = 173/348 (49.71%), Query Frame = 2
Query:   65 YYSILGTQKGASDDEIKKAYRKMALKYHPDKNKSPNAEAKFKEIAEAYEVLSDPKKKEIYDKYXXXXXXXXXXXXXXXXXXXXXFTYTFHGDPREIFKNFFGTDDPFANIFGNHSRRRG---ADNFMDVDDDFHPG----ISL--------FSGFNTGGGSFPHTQMKQDPPIYHDLSVSLEDVLS----------GTLKKIKITRKRPSPAGNSLIDEEKILEIDVKKGWKAGTKITFPREGDKYLTDNIPADIVFVIKDRTHRHFKRDGCDIRIKVKISWKDALCGIPNLQIPTLENQ--MINLPINTVIKPDTQKRIPGRGLPDNKNPSRRGDIVVEFEIIFPDS 1027
            YY +LG +  AS +EI++A+R++ALKYHPDKN  P+A  KFK+I++AYE+L D  K+E+YD+           GG D   G      +    P +IF  FFG     +    + + R+G   A +     +D + G    +SL          G     GS       Q   I   L   +  V+S          G  + I++  +    +G  +I E+KIL + + KG K+G KI F  EGD+      P DI+ V+  ++H  F+R G D+ +K++I   DALCG     I TL+ +  ++      VIKP   K IP  G+P  +N   +G ++++F+I FP+S
Sbjct:   14 YYDLLGVRPSASSEEIRRAFRRLALKYHPDKN--PSAGEKFKQISKAYEILHDSHKRELYDR-----------GGEDALTGNSTGCRSAFDSPLDIFNLFFGG----STRVHHQAERKGKSVAHHLPVSLEDLYNGATRKLSLQKNAICAKCKGSGAKQGSITKCPKCQGCGIEVHLLTHIPGVMSQIQTPCSECNGKGECIRLRDRCQVCSGRKIIREKKILTVHIDKGMKSGQKIIFHEEGDQAPGLQ-PGDIIIVLDQKSHPVFQRKGHDLVMKMEIQLADALCGCRQ-SIKTLDGRTLLVTSQPGEVIKPGDIKCIPKEGMPIYRNLYEKGSLIIQFQIHFPES 342          
BLAST of DnaJ subfamily B vs. Ensembl Mouse
Match: Dnajb1 (DnaJ heat shock protein family (Hsp40) member B1 [Source:MGI Symbol;Acc:MGI:1931874])

HSP 1 Score: 333.569 bits (854), Expect = 4.872e-112
Identity = 178/345 (51.59%), Postives = 239/345 (69.28%), Query Frame = 2
Query:   53 MGKDYYSILGTQKGASDDEIKKAYRKMALKYHPDKNKSPNAEAKFKEIAEAYEVLSDPKKKEIYDKY-XXXXXXXXXXXXXXXXXXXXXFTYTFHGDPREIFKNFFGTDDPFANIFGNHSRRRGADNFMDVDDDFHP---GISLFSGFNTGGG--SFPHTQMKQDPPIYHDLSVSLEDVLSGTLKKIKITRKRPSPAGNSLIDEEKILEIDVKKGWKAGTKITFPREGDKYLTDNIPADIVFVIKDRTHRHFKRDGCDIRIKVKISWKDALCGIPNLQIPTLENQMINLPINTVIKPDTQKRIPGRGLPDNKNPSRRGDIVVEFEIIFPDSLTDNAKKVIKQSLP 1069
            MGKDYY  LG  +GASDDEIK+AYR+ AL+YHPDKNK P AE KFKEIAEAY+VLSDP+K+EI+D+Y  E    G   GGS G      F+YTFHGDP  +F  FFG  +PF   FG    +R  +  MD+DD F     G+  F+  N G    S   T+ KQDPP+ HDL VSLE++ SG  KK+KI+ KR +P G S+ +E+KIL I+VK+GWK GTKITFP+EGD+  ++NIPADIVFV+KD+ H  FKRDG D+    +IS ++ALCG   + +PTL+ + I +    VI+P  ++++PG GLP  K P +RGD+V+EFE+IFP+ +  +++ +++Q LP
Sbjct:    1 MGKDYYQTLGLARGASDDEIKRAYRRQALRYHPDKNKEPGAEEKFKEIAEAYDVLSDPRKREIFDRYGEEGLKGGSPSGGSSGGANGTSFSYTFHGDPHAMFAEFFGGRNPFDTFFG----QRNGEEGMDIDDTFSSFPMGMGGFTNMNFGRSRPSQEPTRKKQDPPVTHDLRVSLEEIYSGCTKKMKISHKRLNPDGKSIRNEDKILTIEVKRGWKEGTKITFPKEGDQ-TSNNIPADIVFVLKDKPHNIFKRDGSDVIYPARISLREALCGC-TVNVPTLDGRTIPVVFKDVIRPGMRRKVPGEGLPLPKTPEKRGDLVIEFEVIFPERIPVSSRTILEQVLP 339          
BLAST of DnaJ subfamily B vs. Ensembl Mouse
Match: Dnajb5 (DnaJ heat shock protein family (Hsp40) member B5 [Source:MGI Symbol;Acc:MGI:1930018])

HSP 1 Score: 323.939 bits (829), Expect = 3.567e-108
Identity = 181/352 (51.42%), Postives = 232/352 (65.91%), Query Frame = 2
Query:   53 MGKDYYSILGTQKGASDDEIKKAYRKMALKYHPDKNKSPNAEAKFKEIAEAYEVLSDPKKKEIYDKYXXXXXXXXXXXXXXXXXXXXXFTYTFHGDPREIFKNFFGTDDPFANIFGNHSRRRGADNFMDVDDDFHPGISLFSGFNTGGGS-------------FPHTQMKQDPPIYHDLSVSLEDVLSGTLKKIKITRKRPSPAGNSLIDEEKILEIDVKKGWKAGTKITFPREGDKYLTDNIPADIVFVIKDRTHRHFKRDGCDIRIKVKISWKDALCGIPNLQIPTLENQMINLPINTVIKPDTQKRIPGRGLPDNKNPSRRGDIVVEFEIIFPDSLTDNAKKVIKQSLP 1069
            MGKDYY ILG   GA++DEIKKAYRKMALKYHPDKNK PNAE KFKEIAEAY+VLSDPKK+ +YD+Y   G +G   GG    G  G F YTFHGDP   F +FFG  +PF   F +    R    F   D D       F  F   G +             +P  ++ QDPP+ H+L VSLE++  G+ K++KITR+R +P G ++  E+KIL I +K+GWK GTKITFP+EGD    DNIPADIVFV+KD+ H HF+RDG ++     IS K+ALCG   + IPT++ ++I LP N VIKP T KR+ G GLP  K P++RGD++VEF++ FPD LT   ++++KQ LP
Sbjct:    1 MGKDYYKILGIPSGANEDEIKKAYRKMALKYHPDKNKEPNAEEKFKEIAEAYDVLSDPKKRSLYDQY---GEEGLKTGGGSSGGSGGSFHYTFHGDPHATFASFFGGSNPFDIFFASSRSTRPFSGFDPDDMDVDEDEDPFGAFGRFGFNGLSRGPRRAPEPLYPRRKV-QDPPVVHELRVSLEEIYHGSTKRMKITRRRLNPDGRTVRTEDKILHIVIKRGWKEGTKITFPKEGDA-TPDNIPADIVFVLKDKPHAHFRRDGTNVLYSALISLKEALCGC-TVNIPTIDGRVIPLPCNDVIKPGTVKRLRGEGLPFPKVPTQRGDLIVEFKVRFPDRLTPQTRQILKQHLP 346          
BLAST of DnaJ subfamily B vs. Ensembl Mouse
Match: Dnajb5 (DnaJ heat shock protein family (Hsp40) member B5 [Source:MGI Symbol;Acc:MGI:1930018])

HSP 1 Score: 323.939 bits (829), Expect = 3.567e-108
Identity = 181/352 (51.42%), Postives = 232/352 (65.91%), Query Frame = 2
Query:   53 MGKDYYSILGTQKGASDDEIKKAYRKMALKYHPDKNKSPNAEAKFKEIAEAYEVLSDPKKKEIYDKYXXXXXXXXXXXXXXXXXXXXXFTYTFHGDPREIFKNFFGTDDPFANIFGNHSRRRGADNFMDVDDDFHPGISLFSGFNTGGGS-------------FPHTQMKQDPPIYHDLSVSLEDVLSGTLKKIKITRKRPSPAGNSLIDEEKILEIDVKKGWKAGTKITFPREGDKYLTDNIPADIVFVIKDRTHRHFKRDGCDIRIKVKISWKDALCGIPNLQIPTLENQMINLPINTVIKPDTQKRIPGRGLPDNKNPSRRGDIVVEFEIIFPDSLTDNAKKVIKQSLP 1069
            MGKDYY ILG   GA++DEIKKAYRKMALKYHPDKNK PNAE KFKEIAEAY+VLSDPKK+ +YD+Y   G +G   GG    G  G F YTFHGDP   F +FFG  +PF   F +    R    F   D D       F  F   G +             +P  ++ QDPP+ H+L VSLE++  G+ K++KITR+R +P G ++  E+KIL I +K+GWK GTKITFP+EGD    DNIPADIVFV+KD+ H HF+RDG ++     IS K+ALCG   + IPT++ ++I LP N VIKP T KR+ G GLP  K P++RGD++VEF++ FPD LT   ++++KQ LP
Sbjct:    1 MGKDYYKILGIPSGANEDEIKKAYRKMALKYHPDKNKEPNAEEKFKEIAEAYDVLSDPKKRSLYDQY---GEEGLKTGGGSSGGSGGSFHYTFHGDPHATFASFFGGSNPFDIFFASSRSTRPFSGFDPDDMDVDEDEDPFGAFGRFGFNGLSRGPRRAPEPLYPRRKV-QDPPVVHELRVSLEEIYHGSTKRMKITRRRLNPDGRTVRTEDKILHIVIKRGWKEGTKITFPKEGDA-TPDNIPADIVFVLKDKPHAHFRRDGTNVLYSALISLKEALCGC-TVNIPTIDGRVIPLPCNDVIKPGTVKRLRGEGLPFPKVPTQRGDLIVEFKVRFPDRLTPQTRQILKQHLP 346          
BLAST of DnaJ subfamily B vs. Ensembl Mouse
Match: Dnajb5 (DnaJ heat shock protein family (Hsp40) member B5 [Source:MGI Symbol;Acc:MGI:1930018])

HSP 1 Score: 323.939 bits (829), Expect = 3.567e-108
Identity = 181/352 (51.42%), Postives = 232/352 (65.91%), Query Frame = 2
Query:   53 MGKDYYSILGTQKGASDDEIKKAYRKMALKYHPDKNKSPNAEAKFKEIAEAYEVLSDPKKKEIYDKYXXXXXXXXXXXXXXXXXXXXXFTYTFHGDPREIFKNFFGTDDPFANIFGNHSRRRGADNFMDVDDDFHPGISLFSGFNTGGGS-------------FPHTQMKQDPPIYHDLSVSLEDVLSGTLKKIKITRKRPSPAGNSLIDEEKILEIDVKKGWKAGTKITFPREGDKYLTDNIPADIVFVIKDRTHRHFKRDGCDIRIKVKISWKDALCGIPNLQIPTLENQMINLPINTVIKPDTQKRIPGRGLPDNKNPSRRGDIVVEFEIIFPDSLTDNAKKVIKQSLP 1069
            MGKDYY ILG   GA++DEIKKAYRKMALKYHPDKNK PNAE KFKEIAEAY+VLSDPKK+ +YD+Y   G +G   GG    G  G F YTFHGDP   F +FFG  +PF   F +    R    F   D D       F  F   G +             +P  ++ QDPP+ H+L VSLE++  G+ K++KITR+R +P G ++  E+KIL I +K+GWK GTKITFP+EGD    DNIPADIVFV+KD+ H HF+RDG ++     IS K+ALCG   + IPT++ ++I LP N VIKP T KR+ G GLP  K P++RGD++VEF++ FPD LT   ++++KQ LP
Sbjct:    1 MGKDYYKILGIPSGANEDEIKKAYRKMALKYHPDKNKEPNAEEKFKEIAEAYDVLSDPKKRSLYDQY---GEEGLKTGGGSSGGSGGSFHYTFHGDPHATFASFFGGSNPFDIFFASSRSTRPFSGFDPDDMDVDEDEDPFGAFGRFGFNGLSRGPRRAPEPLYPRRKV-QDPPVVHELRVSLEEIYHGSTKRMKITRRRLNPDGRTVRTEDKILHIVIKRGWKEGTKITFPKEGDA-TPDNIPADIVFVLKDKPHAHFRRDGTNVLYSALISLKEALCGC-TVNIPTIDGRVIPLPCNDVIKPGTVKRLRGEGLPFPKVPTQRGDLIVEFKVRFPDRLTPQTRQILKQHLP 346          
BLAST of DnaJ subfamily B vs. Ensembl Mouse
Match: Dnajb4 (DnaJ heat shock protein family (Hsp40) member B4 [Source:MGI Symbol;Acc:MGI:1914285])

HSP 1 Score: 323.553 bits (828), Expect = 4.048e-108
Identity = 177/349 (50.72%), Postives = 238/349 (68.19%), Query Frame = 2
Query:   53 MGKDYYSILGTQKGASDDEIKKAYRKMALKYHPDKNKSPNAEAKFKEIAEAYEVLSDPKKKEIYDKYXXXXXXXXXXXXXXXXXXXXXFTYTFHGDPREIFKNFFGTDDPFANIFGNHSRRRGA---DNFMDVDDDFHPGISLFSGFNTGGGSFPH-------TQMKQDPPIYHDLSVSLEDVLSGTLKKIKITRKRPSPAGNSLIDEEKILEIDVKKGWKAGTKITFPREGDKYLTDNIPADIVFVIKDRTHRHFKRDGCDIRIKVKISWKDALCGIPNLQIPTLENQMINLPINTVIKPDTQKRIPGRGLPDNKNPSRRGDIVVEFEIIFPDSLTDNAKKVIKQSLP 1069
            MGKDYY ILG  KGA+D+++KKAYRK ALK+HPDKNKSP AE KFKE+AEAYEVLSDPKK+EIYD++   G +G  GG     G  G F YTFHGDP   F  FFG  +PF   FG   RR G       M++D D       FS F      +P        +++KQDPPI H+L VSLE++ SG  K++KI+RKR +P G S   E+KIL I++KKGWK GTKITFPREGD+   ++IPADIVFVIKD+ H  FKRDG +I    KIS ++ALCG  +L +PT++ + + + +  ++KP  ++R+ G GLP  KNP +RGD+++EF++ FPD ++  +K+++++ LP
Sbjct:    1 MGKDYYHILGIDKGATDEDVKKAYRKQALKFHPDKNKSPQAEEKFKEVAEAYEVLSDPKKREIYDQF---GEEGLKGGAGGTDGQGGTFRYTFHGDPHATFAAFFGGSNPFEIFFG---RRMGGGRDSEEMEIDGD------PFSAFGFSMNGYPRDRNSVGPSRLKQDPPIIHELKVSLEEIYSGCTKRMKISRKRLNPDGRSYRSEDKILTIEIKKGWKEGTKITFPREGDE-TPNSIPADIVFVIKDKEHPKFKRDGSNIVYTAKISLREALCGC-SLNVPTMDGRNLPMSVTDIVKPGMRRRVIGYGLPFPKNPDQRGDLLIEFDVSFPDVISAASKEILRKHLP 335          
BLAST of DnaJ subfamily B vs. UniProt/SwissProt
Match: sp|Q3MI00|DNJB1_BOVIN (DnaJ homolog subfamily B member 1 OS=Bos taurus OX=9913 GN=DNAJB1 PE=2 SV=3)

HSP 1 Score: 334.724 bits (857), Expect = 1.227e-111
Identity = 179/352 (50.85%), Postives = 239/352 (67.90%), Query Frame = 2
Query:   53 MGKDYYSILGTQKGASDDEIKKAYRKMALKYHPDKNKSPNAEAKFKEIAEAYEVLSDPKKKEIYDKY-XXXXXXXXXXXXXXXXXXXXXFTYTFHGDPREIFKNFFGTDDPFANIFGNHSRRRGADNFMDVDDDFHPGISLFSGFNTGGGSFPH------------TQMKQDPPIYHDLSVSLEDVLSGTLKKIKITRKRPSPAGNSLIDEEKILEIDVKKGWKAGTKITFPREGDKYLTDNIPADIVFVIKDRTHRHFKRDGCDIRIKVKISWKDALCGIPNLQIPTLENQMINLPINTVIKPDTQKRIPGRGLPDNKNPSRRGDIVVEFEIIFPDSLTDNAKKVIKQSLP 1069
            MGKDYY  LG  +GASD+EIK+AYR+ AL+YHPDKNK P AE KFKEIAEAY+VLSDP+K+EI+D+Y  E     G  GGS G      F+YTFHGDP  +F  FFG  +PF N FG    +R  +  MD+DD        FSGF  G G F +            T+ KQDPP+ HDL VSLE++ SG  KK+KI+ KR +P G S+ +E+KIL I+VK+GWK GTKITFP+EGD+  ++NIPADIVFV+KD+ H  FKRDG D+    +IS ++ALCG   + +PTL+ + I +    VI+P  ++++PG GLP  K P +RGD+++EFE+IFP+ +   ++ V++Q LP
Sbjct:    1 MGKDYYQTLGLARGASDEEIKRAYRRQALRYHPDKNKEPGAEEKFKEIAEAYDVLSDPRKREIFDRYGEEGLKGSGPSGGSSGGTNGTSFSYTFHGDPHAMFAEFFGGRNPFDNFFG----QRNGEEGMDIDDP-------FSGFPMGMGGFTNMNFGRSRPAQEPTRKKQDPPVTHDLRVSLEEIYSGCTKKMKISHKRLNPDGKSIRNEDKILTIEVKRGWKEGTKITFPKEGDQ-TSNNIPADIVFVLKDKPHNIFKRDGSDVIYPARISLREALCGC-TVNVPTLDGRTIPVVFKDVIRPGMRRKVPGEGLPLPKTPEKRGDLIIEFEVIFPERIPQTSRTVLEQVLP 339          
BLAST of DnaJ subfamily B vs. UniProt/SwissProt
Match: sp|Q9QYJ3|DNJB1_MOUSE (DnaJ homolog subfamily B member 1 OS=Mus musculus OX=10090 GN=Dnajb1 PE=1 SV=3)

HSP 1 Score: 333.569 bits (854), Expect = 3.408e-111
Identity = 178/345 (51.59%), Postives = 239/345 (69.28%), Query Frame = 2
Query:   53 MGKDYYSILGTQKGASDDEIKKAYRKMALKYHPDKNKSPNAEAKFKEIAEAYEVLSDPKKKEIYDKY-XXXXXXXXXXXXXXXXXXXXXFTYTFHGDPREIFKNFFGTDDPFANIFGNHSRRRGADNFMDVDDDFHP---GISLFSGFNTGGG--SFPHTQMKQDPPIYHDLSVSLEDVLSGTLKKIKITRKRPSPAGNSLIDEEKILEIDVKKGWKAGTKITFPREGDKYLTDNIPADIVFVIKDRTHRHFKRDGCDIRIKVKISWKDALCGIPNLQIPTLENQMINLPINTVIKPDTQKRIPGRGLPDNKNPSRRGDIVVEFEIIFPDSLTDNAKKVIKQSLP 1069
            MGKDYY  LG  +GASDDEIK+AYR+ AL+YHPDKNK P AE KFKEIAEAY+VLSDP+K+EI+D+Y  E    G   GGS G      F+YTFHGDP  +F  FFG  +PF   FG    +R  +  MD+DD F     G+  F+  N G    S   T+ KQDPP+ HDL VSLE++ SG  KK+KI+ KR +P G S+ +E+KIL I+VK+GWK GTKITFP+EGD+  ++NIPADIVFV+KD+ H  FKRDG D+    +IS ++ALCG   + +PTL+ + I +    VI+P  ++++PG GLP  K P +RGD+V+EFE+IFP+ +  +++ +++Q LP
Sbjct:    1 MGKDYYQTLGLARGASDDEIKRAYRRQALRYHPDKNKEPGAEEKFKEIAEAYDVLSDPRKREIFDRYGEEGLKGGSPSGGSSGGANGTSFSYTFHGDPHAMFAEFFGGRNPFDTFFG----QRNGEEGMDIDDTFSSFPMGMGGFTNMNFGRSRPSQEPTRKKQDPPVTHDLRVSLEEIYSGCTKKMKISHKRLNPDGKSIRNEDKILTIEVKRGWKEGTKITFPKEGDQ-TSNNIPADIVFVLKDKPHNIFKRDGSDVIYPARISLREALCGC-TVNVPTLDGRTIPVVFKDVIRPGMRRKVPGEGLPLPKTPEKRGDLVIEFEVIFPERIPVSSRTILEQVLP 339          
BLAST of DnaJ subfamily B vs. UniProt/SwissProt
Match: sp|P25685|DNJB1_HUMAN (DnaJ homolog subfamily B member 1 OS=Homo sapiens OX=9606 GN=DNAJB1 PE=1 SV=4)

HSP 1 Score: 332.413 bits (851), Expect = 9.777e-111
Identity = 178/352 (50.57%), Postives = 236/352 (67.05%), Query Frame = 2
Query:   53 MGKDYYSILGTQKGASDDEIKKAYRKMALKYHPDKNKSPNAEAKFKEIAEAYEVLSDPKKKEIYDKY-XXXXXXXXXXXXXXXXXXXXXFTYTFHGDPREIFKNFFGTDDPFANIFGNHSRRRGADNFMDVDDDFHPGISLFSGFNTGGGSFPHTQM------------KQDPPIYHDLSVSLEDVLSGTLKKIKITRKRPSPAGNSLIDEEKILEIDVKKGWKAGTKITFPREGDKYLTDNIPADIVFVIKDRTHRHFKRDGCDIRIKVKISWKDALCGIPNLQIPTLENQMINLPINTVIKPDTQKRIPGRGLPDNKNPSRRGDIVVEFEIIFPDSLTDNAKKVIKQSLP 1069
            MGKDYY  LG  +GASD+EIK+AYR+ AL+YHPDKNK P AE KFKEIAEAY+VLSDP+K+EI+D+Y  E     G  GGS G      F+YTFHGDP  +F  FFG  +PF   FG    +R  +  MD+DD        FSGF  G G F +               KQDPP+ HDL VSLE++ SG  KK+KI+ KR +P G S+ +E+KIL I+VKKGWK GTKITFP+EGD+  ++NIPADIVFV+KD+ H  FKRDG D+    +IS ++ALCG   + +PTL+ + I +    VI+P  ++++PG GLP  K P +RGD+++EFE+IFP+ +   ++ V++Q LP
Sbjct:    1 MGKDYYQTLGLARGASDEEIKRAYRRQALRYHPDKNKEPGAEEKFKEIAEAYDVLSDPRKREIFDRYGEEGLKGSGPSGGSGGGANGTSFSYTFHGDPHAMFAEFFGGRNPFDTFFG----QRNGEEGMDIDDP-------FSGFPMGMGGFTNVNFGRSRSAQEPARKKQDPPVTHDLRVSLEEIYSGCTKKMKISHKRLNPDGKSIRNEDKILTIEVKKGWKEGTKITFPKEGDQ-TSNNIPADIVFVLKDKPHNIFKRDGSDVIYPARISLREALCGC-TVNVPTLDGRTIPVVFKDVIRPGMRRKVPGEGLPLPKTPEKRGDLIIEFEVIFPERIPQTSRTVLEQVLP 339          
BLAST of DnaJ subfamily B vs. UniProt/SwissProt
Match: sp|Q2KIT4|DNJB4_BOVIN (DnaJ homolog subfamily B member 4 OS=Bos taurus OX=9913 GN=DNAJB4 PE=2 SV=1)

HSP 1 Score: 332.413 bits (851), Expect = 1.053e-110
Identity = 181/343 (52.77%), Postives = 242/343 (70.55%), Query Frame = 2
Query:   53 MGKDYYSILGTQKGASDDEIKKAYRKMALKYHPDKNKSPNAEAKFKEIAEAYEVLSDPKKKEIYDKYXXXXXXXXXXXXXXXXXXXXXFTYTFHGDPREIFKNFFGTDDPFANIFGNHSRRRGA---DNFMDVDDDFHPGISL-FSGFNTGGGSFPHTQMKQDPPIYHDLSVSLEDVLSGTLKKIKITRKRPSPAGNSLIDEEKILEIDVKKGWKAGTKITFPREGDKYLTDNIPADIVFVIKDRTHRHFKRDGCDIRIKVKISWKDALCGIPNLQIPTLENQMINLPINTVIKPDTQKRIPGRGLPDNKNPSRRGDIVVEFEIIFPDSLTDNAKKVIKQSLP 1069
            MGKDYY ILG +KGASD++IKKAYRK AL++HPDKNKSP AE +FKE+AEAYEVLSDPKK+EIYD++   G +G  GG     G  G F YTFHGDP   F  FFG  +PF   FG   RR G     + M+VD D         +G+     S   +++KQDPP+ H+L VSLE++ SG  K++KI+RKR +P G S   E+KIL I++KKGWK GTKITFPREGD+  T +IPADIVFVIKD+ H  FKRDG +I    KIS ++ALCG  ++ +PT++ + I + IN ++KP  ++RI G GLP  KNP +RGD+++EFE+ FPD+++ ++K+V+++ LP
Sbjct:    1 MGKDYYCILGIEKGASDEDIKKAYRKQALRFHPDKNKSPQAEERFKEVAEAYEVLSDPKKREIYDQF---GEEGLKGGAGGTDGQGGTFRYTFHGDPHATFAAFFGGSNPFEIFFG---RRMGGGRDSDEMEVDGDPFGAFGFSMNGYPRDRNSVGPSRLKQDPPVIHELRVSLEEIYSGCTKRMKISRKRLNPDGRSYRTEDKILTIEIKKGWKEGTKITFPREGDETPT-SIPADIVFVIKDKDHPKFKRDGSNIIYTAKISLREALCGC-SINVPTMDGRTIPMTINDIVKPGMRRRIIGYGLPFPKNPDQRGDLLIEFEVSFPDTISSSSKEVLRKHLP 335          
BLAST of DnaJ subfamily B vs. UniProt/SwissProt
Match: sp|Q9UDY4|DNJB4_HUMAN (DnaJ homolog subfamily B member 4 OS=Homo sapiens OX=9606 GN=DNAJB4 PE=1 SV=1)

HSP 1 Score: 329.717 bits (844), Expect = 9.453e-110
Identity = 181/349 (51.86%), Postives = 241/349 (69.05%), Query Frame = 2
Query:   53 MGKDYYSILGTQKGASDDEIKKAYRKMALKYHPDKNKSPNAEAKFKEIAEAYEVLSDPKKKEIYDKYXXXXXXXXXXXXXXXXXXXXXFTYTFHGDPREIFKNFFGTDDPFANIFGNHSRRRGA---DNFMDVDDDFHPGISLFSGFNTGGGSFPH-------TQMKQDPPIYHDLSVSLEDVLSGTLKKIKITRKRPSPAGNSLIDEEKILEIDVKKGWKAGTKITFPREGDKYLTDNIPADIVFVIKDRTHRHFKRDGCDIRIKVKISWKDALCGIPNLQIPTLENQMINLPINTVIKPDTQKRIPGRGLPDNKNPSRRGDIVVEFEIIFPDSLTDNAKKVIKQSLP 1069
            MGKDYY ILG +KGASD++IKKAYRK ALK+HPDKNKSP AE KFKE+AEAYEVLSDPKK+EIYD++   G +G  GG     G  G F YTFHGDP   F  FFG  +PF   FG   RR G       M++D D       FS F      +P        +++KQDPP+ H+L VSLE++ SG  K++KI+RKR +  G S   E+KIL I++KKGWK GTKITFPREGD+   ++IPADIVF+IKD+ H  FKRDG +I    KIS ++ALCG  ++ +PTL+ + I + +N ++KP  ++RI G GLP  KNP +RGD+++EFE+ FPD+++ ++K+V+++ LP
Sbjct:    1 MGKDYYCILGIEKGASDEDIKKAYRKQALKFHPDKNKSPQAEEKFKEVAEAYEVLSDPKKREIYDQF---GEEGLKGGAGGTDGQGGTFRYTFHGDPHATFAAFFGGSNPFEIFFG---RRMGGGRDSEEMEIDGD------PFSAFGFSMNGYPRDRNSVGPSRLKQDPPVIHELRVSLEEIYSGCTKRMKISRKRLNADGRSYRSEDKILTIEIKKGWKEGTKITFPREGDE-TPNSIPADIVFIIKDKDHPKFKRDGSNIIYTAKISLREALCGC-SINVPTLDGRNIPMSVNDIVKPGMRRRIIGYGLPFPKNPDQRGDLLIEFEVSFPDTISSSSKEVLRKHLP 335          
BLAST of DnaJ subfamily B vs. TrEMBL
Match: A0A430QIY6 (DnaJ subfamily B member 4 OS=Schistosoma bovis OX=6184 GN=DC041_0002445 PE=4 SV=1)

HSP 1 Score: 387.882 bits (995), Expect = 4.612e-130
Identity = 212/346 (61.27%), Postives = 254/346 (73.41%), Query Frame = 2
Query:   53 MGKDYYSILGTQKGASDDEIKKAYRKMALKYHPDKNKSPNAEAKFKEIAEAYEVLSDPKKKEIYDKYXXXXXXXXXXXXXXXXXXXXXFTYTFHGDPREIFKNFFGTDDPFANIFGNHSRRRGADNFMDVDDDFHPGISLFSGF------NTGGGSFPHTQMKQDPPIYHDLSVSLEDVLSGTLKKIKITRKRPSPAGNSLIDEEKILEIDVKKGWKAGTKITFPREGDKYLTDNIPADIVFVIKDRTHRHFKRDGCDIRIKVKISWKDALCGIPNLQIPTLENQMINLPINTVIKPDTQKRIPGRGLPDNKNPSRRGDIVVEFEIIFPDSLTDNAKKVIKQSLPD 1072
            MGKDYY ILG  KGA+DDEIKKAYRK ALKYHPDKNKSPNAE KFKEIAEAY+VLSDPKKKEIYDKYGEEGLKGG      G G    +TYTFHGDPRE F+ FFGTDDPF+  F +  RR      M+VDD F  G + F GF      +T GG  P    +QDPPIYHDLSVSL+DVL GT KKI+ITR R +P   +   EEK +EI+VKKGWKAGTKITFPREGD+ +  N+PAD+VFV+KDRTH+HFKR+G D+R   KIS K ALCG   + IPT++   IN+ +  +IKP T +RIP +GLP  K PSR GD++VEF+++FPD L+++ K  +   LP+
Sbjct:    1 MGKDYYKILGISKGANDDEIKKAYRKQALKYHPDKNKSPNAEEKFKEIAEAYDVLSDPKKKEIYDKYGEEGLKGGPTSSEGGQG----YTYTFHGDPRETFRMFFGTDDPFSGFFTSGGRRSTVGEPMNVDDFF--GSTPFGGFFETKNVSTTGGRKP----QQDPPIYHDLSVSLQDVLHGTTKKIRITRARLNPDRQTTRQEEKTVEIEVKKGWKAGTKITFPREGDESIKGNVPADVVFVVKDRTHKHFKREGSDVRYVAKISLKQALCG-GTISIPTIDEGQINIQLTEIIKPGTTRRIPHQGLPFLKEPSRLGDMIVEFQVVFPDYLSNSQKSQLASILPN 335          
BLAST of DnaJ subfamily B vs. TrEMBL
Match: A0A094ZUA7 (DnaJ subfamily B member 4 OS=Schistosoma haematobium OX=6185 GN=MS3_06149 PE=4 SV=1)

HSP 1 Score: 387.497 bits (994), Expect = 5.199e-130
Identity = 212/346 (61.27%), Postives = 254/346 (73.41%), Query Frame = 2
Query:   53 MGKDYYSILGTQKGASDDEIKKAYRKMALKYHPDKNKSPNAEAKFKEIAEAYEVLSDPKKKEIYDKYXXXXXXXXXXXXXXXXXXXXXFTYTFHGDPREIFKNFFGTDDPFANIFGNHSRRRGADNFMDVDDDFHPGISLFSGF------NTGGGSFPHTQMKQDPPIYHDLSVSLEDVLSGTLKKIKITRKRPSPAGNSLIDEEKILEIDVKKGWKAGTKITFPREGDKYLTDNIPADIVFVIKDRTHRHFKRDGCDIRIKVKISWKDALCGIPNLQIPTLENQMINLPINTVIKPDTQKRIPGRGLPDNKNPSRRGDIVVEFEIIFPDSLTDNAKKVIKQSLPD 1072
            MGKDYY ILG  KGA+DDEIKKAYRK ALKYHPDKNKSPNAE KFKEIAEAY+VLSDPKKKEIYDKYGEEGLKGG      G G    +TYTFHGDPRE F+ FFGTDDPF+  F +  RR      M+VDD F  G + F GF      +T GG  P    +QDPPIYHDLSVSL+DVL GT KKI+ITR R +P   +   EEK +EI+VKKGWKAGTKITFPREGD+ +  N+PAD+VFV+KDRTH+HFKR+G D+R   KIS K ALCG   + IPT++   IN+ +  +IKP T +RIP +GLP  K PSR GD++VEF+++FPD L+++ K  +   LP+
Sbjct:    1 MGKDYYKILGISKGANDDEIKKAYRKQALKYHPDKNKSPNAEEKFKEIAEAYDVLSDPKKKEIYDKYGEEGLKGGPTSSEGGQG----YTYTFHGDPRETFRMFFGTDDPFSGFFTSGGRRSTVGEPMNVDDFF--GSTPFGGFFETRNVSTTGGRKP----QQDPPIYHDLSVSLQDVLHGTTKKIRITRARLNPDRQTTRQEEKTVEIEVKKGWKAGTKITFPREGDESIKGNVPADVVFVVKDRTHKHFKREGSDVRYVAKISLKQALCG-GTISIPTIDEGQINIQLTEIIKPGTTRRIPHQGLPFLKEPSRLGDMIVEFQVVFPDYLSNSQKSQLASILPN 335          
BLAST of DnaJ subfamily B vs. TrEMBL
Match: G7Y3V9 (DnaJ homolog subfamily B member 4 OS=Clonorchis sinensis OX=79923 GN=CLF_100625 PE=4 SV=1)

HSP 1 Score: 379.407 bits (973), Expect = 1.248e-126
Identity = 207/347 (59.65%), Postives = 254/347 (73.20%), Query Frame = 2
Query:   53 MGKDYYSILGTQKGASDDEIKKAYRKMALKYHPDKNKSPNAEAKFKEIAEAYEVLSDPKKKEIYDKYXXXXXXXXXXXXXXXXXXXXXFTYTFHGDPREIFKNFFGTDDPFANIFGNHSRRR-----GADNFMDVDDDFHPGISLFSGFNTGG--GSFPHTQMKQDPPIYHDLSVSLEDVLSGTLKKIKITRKRPSPAGNSLIDEEKILEIDVKKGWKAGTKITFPREGDKYLTDNIPADIVFVIKDRTHRHFKRDGCDIRIKVKISWKDALCGIPNLQIPTLENQMINLPINTVIKPDTQKRIPGRGLPDNKNPSRRGDIVVEFEIIFPDSLTDNAKKVIKQSLPD 1072
            MGKDYY ILG  K A+DD IKKAY+KMALKYHPDKNKSPNAE KFKEIAEAY+VLSDPKK+EIYDKYGEEGLK G+ GG  G  G   FTYTFHGDPRE+F+ FFG+DD   ++FG  S  R     G    MD+D DF  G S  SGF+  G  G  P  +  QDPPI+HDLSVSL DVL+GT+KK++ITR+R +P   +  +EEK+LEI+VKKGWKAGT+ITFPREGD+    NIPAD+VF +KDRTH+HFKR+G D+R   KI  K ALCG   + IPT+E   +NL +  V++  + +RI G+GLP  K P+RRGDI+VEF ++FP  L+D+ K  +   LPD
Sbjct:    1 MGKDYYQILGITKDATDDAIKKAYKKMALKYHPDKNKSPNAEEKFKEIAEAYDVLSDPKKREIYDKYGEEGLKTGVSGGEGGGPG---FTYTFHGDPREMFRVFFGSDDSLGSLFGMGSGGRTVFTSGMGEQMDIDGDFFGGASPLSGFSMRGMGGGGPTRRRNQDPPIHHDLSVSLLDVLNGTVKKMRITRRRLNPDRRTTREEEKVLEIEVKKGWKAGTRITFPREGDETPGGNIPADVVFTVKDRTHKHFKREGADVRYIAKIGLKKALCG-GVISIPTIEEGQVNLALKDVVQHGSIRRISGQGLPYPKEPNRRGDIIVEFHVVFPTRLSDSQKSQLASILPD 343          
BLAST of DnaJ subfamily B vs. TrEMBL
Match: Q5DF67 (DnaJ homolog, subfamily B, member 4 OS=Schistosoma japonicum OX=6182 GN=EWB00_002040 PE=2 SV=1)

HSP 1 Score: 377.096 bits (967), Expect = 7.354e-126
Identity = 205/340 (60.29%), Postives = 246/340 (72.35%), Query Frame = 2
Query:   53 MGKDYYSILGTQKGASDDEIKKAYRKMALKYHPDKNKSPNAEAKFKEIAEAYEVLSDPKKKEIYDKYXXXXXXXXXXXXXXXXXXXXXFTYTFHGDPREIFKNFFGTDDPFANIFGNHSRRRGADNFMDVDDDFHPGISLFSGFNTGGGSFPHTQMKQDPPIYHDLSVSLEDVLSGTLKKIKITRKRPSPAGNSLIDEEKILEIDVKKGWKAGTKITFPREGDKYLTDNIPADIVFVIKDRTHRHFKRDGCDIRIKVKISWKDALCGIPNLQIPTLENQMINLPINTVIKPDTQKRIPGRGLPDNKNPSRRGDIVVEFEIIFPDSLTDNAKKVIKQSLPD 1072
            MGKDYY ILG  KGASDDE+KKAYRK ALKYHPDKNKSPNAE KFKEIAEAY+VLSDPKK+EIYDKYGE+GLKGG      G G    FTYTFHGDPRE F+ FFGTDDPF+ IF +  R   A   M+VDD F               +    + +QD PIYHDLSVSL+DVL GT KKI+ITR R +P   +   EEK +EI+VKKGWKAGTKITFPREGD+ +  NIPAD+VFV+KDRTH++FKR+G D+R   KIS K ALCG   + IPT++   IN P+  +IKP T +RIP +GLP +K PSR GD++VEF+I+FPD L+ + K  +   LP+
Sbjct:    1 MGKDYYKILGISKGASDDELKKAYRKQALKYHPDKNKSPNAEEKFKEIAEAYDVLSDPKKREIYDKYGEDGLKGGPTSSEGGQG----FTYTFHGDPRETFRMFFGTDDPFSGIFTSGGRHATAGEPMNVDDFFGGTPFGGFFETRTTNAAGSRRPQQDLPIYHDLSVSLQDVLHGTTKKIRITRARLNPDRQTTRQEEKTVEIEVKKGWKAGTKITFPREGDESIRGNIPADVVFVVKDRTHKYFKREGSDVRYVAKISLKQALCG-GTIPIPTIDEGQINFPLTEIIKPGTIRRIPHQGLPFSKEPSRLGDMIVEFQIVFPDHLSSSQKSQLASILPN 335          
BLAST of DnaJ subfamily B vs. TrEMBL
Match: A0A5J4NKF0 (DnaJ subfamily B member 4 OS=Paragonimus westermani OX=34504 GN=DEA37_0010488 PE=4 SV=1)

HSP 1 Score: 375.941 bits (964), Expect = 2.531e-125
Identity = 207/345 (60.00%), Postives = 248/345 (71.88%), Query Frame = 2
Query:   53 MGKDYYSILGTQKGASDDEIKKAYRKMALKYHPDKNKSPNAEAKFKEIAEAYEVLSDPKKKEIYDKYXXXXXXXXXXXXXXXXXXXXXFTYTFHGDPREIFKNFFGTDDPFANIFG-----NHSRRRGADNFMDVDDDFHPGISLFSGFNTGGGSFPHTQMKQDPPIYHDLSVSLEDVLSGTLKKIKITRKRPSPAGNSLIDEEKILEIDVKKGWKAGTKITFPREGDKYLTDNIPADIVFVIKDRTHRHFKRDGCDIRIKVKISWKDALCGIPNLQIPTLENQMINLPINTVIKPDTQKRIPGRGLPDNKNPSRRGDIVVEFEIIFPDSLTDNAKKVIKQSLPD 1072
            MGKDYY+ILG  K A DDEIKKAYRKMALKYHPDKNKSPNAE KFKE+AEAY+VLSDPKK+EIYDKYGEEGLK G      G  G   F+YTFHGDPRE F+ FFGTDDPF+ IF       H    G    MDVD DF  G S FSGF+ GG      +  QDPPI HD+ VSL+DVL GT+KK++ITR+R +    S  +EEK+LEI++KKGWKAGT+ITFPREGD+    NIPAD+VF +KDR+H+HFKR+GCD+R   KIS K ALCG   + IPT+E    NL +  +I   T +RI G GLP  K P+RRGDI+VEF ++FP SL+++ K  +   LPD
Sbjct:    1 MGKDYYNILGINKKADDDEIKKAYRKMALKYHPDKNKSPNAEEKFKEVAEAYDVLSDPKKREIYDKYGEEGLKAGASTSEGGGPG---FSYTFHGDPRETFRMFFGTDDPFSTIFSMGGGQRHVYTSGMGEQMDVDGDFF-GASPFSGFSMGG----QRRRNQDPPINHDVLVSLQDVLHGTVKKMRITRRRLNADRRSTREEEKVLEIEIKKGWKAGTRITFPREGDETPGGNIPADVVFTVKDRSHKHFKREGCDVRYIAKISLKKALCG-GIVAIPTIEEGTRNLALKDIIPHGTTRRICGEGLPYPKEPNRRGDIIVEFHVVFPYSLSNSQKAQLADILPD 336          
BLAST of DnaJ subfamily B vs. Ensembl Cavefish
Match: dnajb4 (DnaJ heat shock protein family (Hsp40) member B4 [Source:NCBI gene;Acc:103027306])

HSP 1 Score: 326.635 bits (836), Expect = 2.203e-109
Identity = 185/351 (52.71%), Postives = 240/351 (68.38%), Query Frame = 2
Query:   53 MGKDYYSILGTQKGASDDEIKKAYRKMALKYHPDKNKSPNAEAKFKEIAEAYEVLSDPKKKEIYDKYXXXXXXXXXXXXXXXXXXXXXFTYTFHGDPREIFKNFFGTDDPFANIFGNHSRRRGADNFMDVD--DDFHPGISLFSGFNTGG----------GSFPHTQMKQDPPIYHDLSVSLEDVLSGTLKKIKITRKRPSPAGNSLIDEEKILEIDVKKGWKAGTKITFPREGDKYLTDNIPADIVFVIKDRTHRHFKRDGCDIRIKVKISWKDALCGIPNLQIPTLENQMINLPINTVIKPDTQKRIPGRGLPDNKNPSRRGDIVVEFEIIFPDSLTDNAKKVIKQSLP 1069
            MGKDYY ILG  KGA++++IKKAYRK ALK+HPDKNK+PNA  KFKEIAEAYEVLSDPKK+EIYD++   G +G  GGG    G    FTYTFHGDP   F  FFG  +PF   FG     R  D+ M+VD  D F      F+ FN  G          G  P ++ KQDP I+H+L VSLE+V  G  K++KI+RKR +P G ++  E+KIL I++K+GWK GTKITFPREGD+   + IPADIVFVIKD+ H HF+R+G DI   V++S + +LCG  ++ + T++ +  N+ I  VIKP  +K I G+GLP  KNP +RGD++VEF++ FPD+L  NAK V+K+ LP
Sbjct:    1 MGKDYYKILGISKGAAEEDIKKAYRKQALKWHPDKNKAPNASEKFKEIAEAYEVLSDPKKREIYDQH---GEEGLKGGGGPTDGQGSNFTYTFHGDPHATFATFFGGANPFEMFFGRKVNGRDDDD-MEVDGSDPF----GSFTSFNINGFPRGERPVGLGGQPRSR-KQDPAIHHELRVSLEEVFHGCTKRMKISRKRLNPDGRTMRTEDKILTIEIKRGWKEGTKITFPREGDE-APNTIPADIVFVIKDKPHAHFRREGSDIVYPVRVSLRQSLCGC-SVTVSTIDGKTCNIKITDVIKPGMRKTIAGQGLPFPKNPDQRGDLIVEFDVNFPDTLPTNAKDVLKRHLP 340          
BLAST of DnaJ subfamily B vs. Ensembl Cavefish
Match: dnajb1b (dnaJ homolog subfamily B member 1 [Source:NCBI gene;Acc:103047132])

HSP 1 Score: 323.168 bits (827), Expect = 5.546e-108
Identity = 181/347 (52.16%), Postives = 236/347 (68.01%), Query Frame = 2
Query:   53 MGKDYYSILGTQKGASDDEIKKAYRKMALKYHPDKNKSPNAEAKFKEIAEAYEVLSDPKKKEIYDKYXXXXXXXXXXXXXXXXXXXXXFTYTFHGDPREIFKNFFGTDDPFANIFGNHSRRRGADNFMDVDDDF-------HPGISLFSGFNTG-GGSFPHTQMKQDPPIYHDLSVSLEDVLSGTLKKIKITRKRPSPAGNSLIDEEKILEIDVKKGWKAGTKITFPREGDKYLTDNIPADIVFVIKDRTHRHFKRDGCDIRIKVKISWKDALCGIPNLQIPTLENQMINLPINTVIKPDTQKRIPGRGLPDNKNPSRRGDIVVEFEIIFPDSLTDNAKKVIKQSLP 1069
            MGKDYYS+LG +KGASDDEIKKAYRK ALKYHPDKNKSP AE KFKEIAEAY+VLSD KKK+IYD++         G G  G  GPGGFTYTF GDP  +F  FFG  +PF   FG+     G +  M+ D+ F         G+     FN   GG     + +QDPP+ H+L VSLE+V SG  KK+KI+R+R +P G S   E+KIL ++VKKGWK GTK+TFP+EGD+  T NIPAD+VFV+KD+ H  FKRDG DI    K++ K+ALCG  +++ PTL+ + + + +  +++P  ++R+ G GLP  K P RRGD++VEFE+ FP+ L+ +AK  I + LP
Sbjct:    4 MGKDYYSVLGIKKGASDDEIKKAYRKQALKYHPDKNKSPGAEEKFKEIAEAYDVLSDSKKKDIYDRF--GEEGLKGGAGGGGPNGPGGFTYTFQGDPHAMFSEFFGGRNPFEQFFGHGY---GPEEDMETDNPFMNFGMGGMGGMGGGRPFNMRPGGPGGKLEKRQDPPVTHELKVSLEEVFSGCTKKMKISRRRLNPDGRSTRSEDKILTVEVKKGWKEGTKVTFPKEGDETPT-NIPADVVFVVKDKPHPVFKRDGSDIIYPAKVTLKEALCGC-SVKAPTLDGRSVTVTVQDIVRPGMKRRVTGEGLPFPKTPDRRGDLIVEFEVKFPERLSQDAKDTIARVLP 343          
BLAST of DnaJ subfamily B vs. Ensembl Cavefish
Match: dnajb1a (dnaJ homolog subfamily B member 1-like [Source:NCBI gene;Acc:103024650])

HSP 1 Score: 317.39 bits (812), Expect = 1.083e-105
Identity = 188/354 (53.11%), Postives = 236/354 (66.67%), Query Frame = 2
Query:   53 MGKDYYSILGTQKGASDDEIKKAYRKMALKYHPDKNKSPNAEAKFKEIAEAYEVLSDPKKKEIYDKYXXXXXXXXXXXXXXXXXXXXXFTYTFHGDPREIFKNFFGTDDPFANIFGNHSRRRGADNFMDVDDDFHPGISLF---------------SGFNTGGGSFPHTQMKQDPPIYHDLSVSLEDVLSGTLKKIKITRKRPSPAGNSLIDEEKILEIDVKKGWKAGTKITFPREGDKYLTDNIPADIVFVIKDRTHRHFKRDGCDIRIKVKISWKDALCGIPNLQIPTLENQMINLPINTVIKPDTQKRIPGRGLPDNKNPSRRGDIVVEFEIIFPDSLTDNAKKVIKQSLP 1069
            MGKDYY ILG QKGAS++EIKKAYRK AL++HPDKNK+P AE KFKEIAEAY+VLSD KKKEIYD+YGEEGLKG  GGG   +G     +YTFHGDP  +F  FFG   PF   F +     G D+ MDV+D F                      S  +  GG     + K+DPP+ H+L VSLE+V SG  KK+KI+RKR +  G S+ +E+KIL +D+K+GWK GTKITFPREGD+  T NIPADIVFV+KD++H  F+RDG DI    +IS +DALCG   +  PTL+ + I +    VIKP  +KRI G GLP +K P +RGD+V+EF + FP+ LT N  + + Q LP
Sbjct:    2 MGKDYYKILGIQKGASEEEIKKAYRKQALRFHPDKNKAPGAEDKFKEIAEAYDVLSDSKKKEIYDRYGEEGLKGHSGGGGSANGP----SYTFHGDPHAMFAEFFGGRSPFDQFFAH-----GGDDDMDVEDPFAAFGMGGMGGMGGMGGMGGFPRSFKSRVGGGHGCREKKKDPPVIHELKVSLEEVYSGCTKKMKISRKRLNTDGCSMRNEDKILTVDIKRGWKEGTKITFPREGDETPT-NIPADIVFVVKDKSHPVFRRDGSDIIYTARISLRDALCGC-TINAPTLDGRSITVTSRDVIKPGMKKRIVGEGLPLSKCPDKRGDMVLEFLVKFPEKLTQNTCEALMQILP 344          
BLAST of DnaJ subfamily B vs. Ensembl Cavefish
Match: dnajb4 (DnaJ heat shock protein family (Hsp40) member B4 [Source:NCBI gene;Acc:103027306])

HSP 1 Score: 295.049 bits (754), Expect = 1.006e-97
Identity = 169/339 (49.85%), Postives = 216/339 (63.72%), Query Frame = 2
Query:   53 MGKDYYSILGTQKGASDDEIKKAYRKMALKYHPDKNKSPNAEAKFKEIAEAYEVLSDPKKKEIYDKYXXXXXXXXXXXXXXXXXXXXXFTYTFHGDPREIFKNFFGTDDPFANIFGNHSRRRGADNFMDVDDDFHPGISLFSGFNTGGGSFPHTQMKQDPPIYHDLSVSLEDVLSGTLKKIKITRKRPSPAGNSLIDEEKILEIDVKKGWKAGTKITFPREGDKYLTDNIPADIVFVIKDRTHRHFKRDGCDIRIKVKISWKDALCGIPNLQIPTLENQMINLPINTVIKPDTQKRIPGRGLPDNKNPSRRGDIVVEFEIIFPDSLTDNAKKVIKQSLP 1069
            MGKDYY ILG  KGA++++IKKAYRK ALK+HPDKNK+PNA  KFKEIAEAYEVLSDPKK+EIYD++GEEGLKGG G           FTYTFHGDP   F  FFG  +PF   FG                                                 L VSLE+V  G  K++KI+RKR +P G ++  E+KIL I++K+GWK GTKITFPREGD+   + IPADIVFVIKD+ H HF+R+G DI   V++S + +LCG  ++ + T++ +  N+ I  VIKP  +K I G+GLP  KNP +RGD++VEF++ FPD+L  NAK V+K+ LP
Sbjct:    1 MGKDYYKILGISKGAAEEDIKKAYRKQALKWHPDKNKAPNASEKFKEIAEAYEVLSDPKKREIYDQHGEEGLKGGGGPTDGQGSN---FTYTFHGDPHATFATFFGGANPFEMFFGR-----------------------------------------------KLRVSLEEVFHGCTKRMKISRKRLNPDGRTMRTEDKILTIEIKRGWKEGTKITFPREGDE-APNTIPADIVFVIKDKPHAHFRREGSDIVYPVRVSLRQSLCGC-SVTVSTIDGKTCNIKITDVIKPGMRKTIAGQGLPFPKNPDQRGDLIVEFDVNFPDTLPTNAKDVLKRHLP 287          
BLAST of DnaJ subfamily B vs. Ensembl Cavefish
Match: zgc:122979 (zgc:122979 [Source:ZFIN;Acc:ZDB-GENE-051127-45])

HSP 1 Score: 237.654 bits (605), Expect = 1.650e-73
Identity = 134/343 (39.07%), Postives = 208/343 (60.64%), Query Frame = 2
Query:   62 DYYSILGTQKGASDDEIKKAYRKMALKYHPDKNKSPNAEAKFKEIAEAYEVLSDPKKKEIYDKYXXXXXXXXXXXXXXXXXXXXXFTYTFHGDPR-------EIFKNF-FGTDDPFANIFGNHSRRRGADNFMDVDDDFHPGISLFSGFNTGGGSFPHTQMKQDPPIYHDLSVSLEDVLSGTLKKIKITRKRPSPAGNSLIDEEKILEIDVKKGWKAGTKITFPREGDKYLTDNIPADIVFVIKDRTHRHFKRDGCDIRIKVKISWKDALCGIPNLQIPTLENQMINLPINTVIKPDTQKRIPGRGLPDNKNPSRRGDIVVEFEIIFPDSLTDNAKKVIKQSL 1066
            D+Y++LG    ++++EI++AY+++AL+YHPDKN   +AE KFK+IA+AYEVL+DP+K+ +YD+ G         G           T + H  P+        +F NF F +DD   N F          N M       P +    G +    S P T++       HDL VSLED+L+G  K++K+TR R +    +L  EE++ +++VKKGWK GTKITFP EG + L  + P+D+ F++K++ H HF+R+G +I     I+ ++ALCG   + +PTL+ QM  +P + VIKP + +R+ G GLP  KNP++RGD++VEF ++FPD +  ++K++IK SL
Sbjct:  128 DHYAVLGVTNDSNEEEIRRAYKRLALRYHPDKNPEADAEEKFKQIAQAYEVLTDPQKRSVYDQQGLTKGGVSSTGSK---------TDSAHSSPKAQDSHAWRVFFNFEFDSDDDLFNPF--------LKNPM-------PHLGRQHG-SKASSSHPMTEV-------HDLQVSLEDILTGVTKRVKVTRLRQT--DKTLQPEERVFDVEVKKGWKEGTKITFPGEGHQVL-GHPPSDLAFIVKEKKHAHFRREGSNIVYTATITLREALCGC-TISVPTLDGQMKPIPSSDVIKPGSLRRLIGEGLPRAKNPAQRGDLMVEFNVVFPDRIPPSSKEIIKHSL 434          
BLAST of DnaJ subfamily B vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005773.1 (pep scaffold:Pmarinus_7.0:GL480846:50332:51737:1 gene:ENSPMAG00000005230.1 transcript:ENSPMAT00000005773.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 213.001 bits (541), Expect = 1.232e-66
Identity = 116/266 (43.61%), Postives = 163/266 (61.28%), Query Frame = 2
Query:  317 FTYTFHGDPREIFKNFFGTDDPFANIFGNHSRRRGADNF---------------MDVDDDFHPGISLFSGFNTGGGSFPHTQMKQDPPIYHDLSVSLEDVLSGTLKKIKITRKRPSPAGNSLIDEEKILEIDVKKGWKAGTKITFPREGDKYLTDNIPADIVFVIKDRTHRHFKRDGCDIRIKVKISWKDALCGIPNLQIPTLENQMINLPINTVIKPDTQKRIPGRGLPDNKNPSRRGDIVVEFEIIFPDSLTDNAKKVIKQSLP 1069
            FTY+FHGDP   F+ FFG  DPF   FG+     G                   +D DD F        G   GGG   H +  QDPP+ H+L VSLED+  G  K+++I+R+R +P G S   EEKIL +++KKGWK GTKITFPREGD+    NIPAD+VFV+KD+ H  F+RDG DI     +S ++ALCG  ++++PTL+ + ++L +  V++P   +R+ G GLP  + PSRRGD+VV+F + FPD +   ++ V++Q LP
Sbjct:   11 FTYSFHGDPHATFRAFFGGADPFEMFFGSGRGGGGPGGLGGLGMNGGGGGEAMEIDSDDPFAAFGLGGGGGGGGGGPSHHRRRTQDPPVVHELQVSLEDIYRGCTKRMRISRRRLNPDGRSTRTEEKILTLEIKKGWKEGTKITFPREGDEG-GRNIPADVVFVVKDKAHPLFRRDGSDIVYTASVSLREALCGC-SVKVPTLDGRKLSLSMTEVVRPGLTRRVAGEGLPFPRAPSRRGDLVVDFSVRFPDRIPPASRDVLRQHLP 274          
BLAST of DnaJ subfamily B vs. Ensembl Sea Lamprey
Match: DNAJA4 (DnaJ heat shock protein family (Hsp40) member A4 [Source:HGNC Symbol;Acc:HGNC:14885])

HSP 1 Score: 129.413 bits (324), Expect = 9.885e-34
Identity = 107/346 (30.92%), Postives = 164/346 (47.40%), Query Frame = 2
Query:   65 YYSILGTQKGASDDEIKKAYRKMALKYHPDKNKSPNAEAKFKEIAEAYEVLSDPKKKEIYDKYXXXXXXXXXXXXXXXXXXXXXFTYTFHGDPREIFKNFFGTDDPFANIFGNHSRRRGADNFMDVD---DDFHPGIS--------LFSGFNTGGGSFPHTQMKQDPPIYHDLSVSLEDVLSGTLKKIKITR-------KRPSPA-------GNSLIDEEKILEIDVKKGWKAGTKITFPREGDKYLTDNIPADIVFVIKDRTHRHFKRDGCDIRIKVKISWKDALCGIPNLQIPTLENQMINLPINT--VIKPDTQKRIPGRGLPDNKNPSRRGDIVVEFEIIFP 1021
            YY  LG    A+ +E+KKAYRK+ALKYHPDKN  PN   KFK+I++AYEVL DPKK+E+YD            GG     G    +      P +IF  FF            H  RRG +    +    ++ + G +        +      G G       +  P     + + ++ +  G +++I+          +R +P        G  ++ E+KILE+ + KG K G KITF  EGD+   D  P  I+ V+  + H  F R   D+ +K++I   +ALCG     I TL+N+ I +  +   VIK    K I   G+P  ++P  +G ++++F + FP
Sbjct:    7 YYDTLGVNPNATHEELKKAYRKLALKYHPDKN--PNEGEKFKQISQAYEVLLDPKKRELYD-----------MGGEQALKGGSSNSGNGFSSPMDIFDLFFNGGTRM------HRERRGKNAVHQLSVGLEEMYNGSTRKLALQKNVLCAKCEGRGGRKGAVERCVPCRGTGMYLQIQQIGLGMVQQIQSVCPECHGHGERINPRHRCRYCNGRKIVREKKILEVHISKGMKDGQKITFYGEGDQD-PDLEPGHIIIVLDQKEHPVFHRREDDLVMKMEIELVEALCGFQR-SIKTLDNRTILITSHQGEVIKEGDVKCILNEGMPLYRDPFEKGRLIIQFSVKFP 331          
BLAST of DnaJ subfamily B vs. Ensembl Sea Lamprey
Match: dnaja1 (DnaJ heat shock protein family (Hsp40) member A1 [Source:ZFIN;Acc:ZDB-GENE-030131-2642])

HSP 1 Score: 84.7297 bits (208), Expect = 1.852e-18
Identity = 61/181 (33.70%), Postives = 84/181 (46.41%), Query Frame = 2
Query:   65 YYSILGTQKGASDDEIKKAYRKMALKYHPDKNKSPNAEAKFKEIAEAYEVLSDPKKKEIYDKYXXXXXXXXXXXXXXXXXXXXXFTYTFHGDPREIFKNFFGTDDPFANIFGNHSRRRGADNFMDVDDDFHPGISLFSGFNTGGGSFPHTQMKQDPPIYHDLSVSLEDVLSGTLKKIKITR 607
            YY +LG +  ++ DE+KKAYRK+ALKYHPDKN  PN   KFK+I++AYEVLSD KK+E+YD+           GG       G         P +IF  FFG                                        GGGS       ++  + H +SVSLED+ +G  +K+ + +
Sbjct:    7 YYDLLGVKPNSTADELKKAYRKLALKYHPDKN--PNEGEKFKQISQAYEVLSDAKKRELYDR-----------GGEQAIKEGGAGGSGGFSSPMDIFNMFFG----------------------------------------GGGSMQRETKGKN--VVHQISVSLEDLYNGATRKLSMQK 132          

HSP 2 Score: 65.4698 bits (158), Expect = 4.424e-12
Identity = 40/122 (32.79%), Postives = 70/122 (57.38%), Query Frame = 2
Query:  653 ILEIDVKKGWKAGTKITFPREGDKYLTDNIPADIVFVIKDRTHRHFKRDGCDIRIKVKISWKDALCGIPNLQIPTLENQMINLPIN--TVIKPDTQKRIPGRGLPDNKNPSRRGDIVVEFEI 1012
            +L I+  KG     KI+F  EGD+    + P D++ V+  + H  F+R G D+ ++++IS  +ALCG     I TL+N+ I +  +   VIK D  K +   G+P ++NP  +G +++ F++
Sbjct:  214 LLAINSAKGMTDNQKISFYGEGDQEPGLD-PGDVIIVLDQKEHDVFRRKGQDLLMEMEISLTEALCGFRR-PIKTLDNRTIVITSHPGEVIKYDAIKCVLNEGMPFHRNPFEKGRLIIHFKV 333          
BLAST of DnaJ subfamily B vs. Ensembl Sea Lamprey
Match: dnajc5aa (DnaJ (Hsp40) homolog, subfamily C, member 5aa [Source:ZFIN;Acc:ZDB-GENE-031113-20])

HSP 1 Score: 80.8777 bits (198), Expect = 2.857e-18
Identity = 42/67 (62.69%), Postives = 51/67 (76.12%), Query Frame = 2
Query:   56 GKDYYSILGTQKGASDDEIKKAYRKMALKYHPDKNK-SPNAEAKFKEIAEAYEVLSDPKKKEIYDKY 253
            G+  Y +LG QKGA+ DEIKK+YRK+ALKYHPDKN  +P A  KFKEI  A  +LSD KK+ IYD+Y
Sbjct:   14 GEALYIVLGLQKGATADEIKKSYRKLALKYHPDKNPDNPEAVEKFKEINNANGILSDLKKRNIYDQY 80          
BLAST of DnaJ subfamily B vs. Ensembl Sea Lamprey
Match: dnaja3b (DnaJ heat shock protein family (Hsp40) member A3b [Source:ZFIN;Acc:ZDB-GENE-040115-3])

HSP 1 Score: 80.4925 bits (197), Expect = 9.262e-17
Identity = 83/284 (29.23%), Postives = 127/284 (44.72%), Query Frame = 2
Query:   50 AMGKDYYSILGTQKGASDDEIKKAYRKMALKYHPDKNK-SPNAEAKFKEIAEAYEVLSDPKKKEIYDKYXXXXXXXXXXXXXXXXXXXXXFTYTFHG---DPREIFKNFFGTDDP-----FANIFGNHSRRRGADNFMDVDDDFHPGISLF----SGFNTGGGSFPHTQMKQDPPIYHDLSVSLEDVLSGTLKKIKITRKRPSPAGNSLIDEEKILEIDVKKGWKAGTKITFPREGDKYLTDNIPA---DIVFVIKDRTHRHFKRDGCDIRIKVKISWKDALCG 853
            A  KDYY ILG  K  +  +IKK+Y ++A KYHPD NK  P A+ KF E+AEAYEVLSD  K++ YD YG  G   G G G+   G      Y   G   DP E+F+  FG         F+++F           F       +  I+LF         G G+ P T++++    ++     +E + +G    ++ T +R S  G  + +   +     +   K    +  P   +   T  +P    +I    + +    F+R+G D+   + IS   AL G
Sbjct:    9 AAKKDYYQILGVAKDVAQKDIKKSYYQLAKKYHPDTNKDDPKAKEKFAELAEAYEVLSDDAKRKQYDTYGSAGFDAGFGSGAGTGGQQ----YWRAGSTVDPEELFRKIFGEFSRSNFGDFSSMFDQPQEFFMELTFTQAAKGVNKEIALFLNDTCQRCEGRGNEPGTKLQR---CHYCNGTGMETINTGPF-VMRSTCRRCSGKGTIMTNPCTLCHGSGETKQKKTVVVPVPAGVEDGQTVRMPVGKKEIFITFRVQKSATFRREGADVHSDLHISVAQALLG 284          
BLAST of DnaJ subfamily B vs. Ensembl Yeast
Match: YDJ1 (Type I HSP40 co-chaperone; involved in regulation of HSP90 and HSP70 functions; acts as an adaptor that helps Rsp5p recognize cytosolic misfolded proteins for ubiquitination after heat shock; critical for determining cell size at Start as a function of growth rate; involved in protein translocation across membranes; member of the DnaJ family; chimeric protein in which human p58IPK J domain replaces yeast Ydj1p J domain can complement yeast ydj1 mutant [Source:SGD;Acc:S000005008])

HSP 1 Score: 134.42 bits (337), Expect = 1.043e-35
Identity = 125/377 (33.16%), Postives = 175/377 (46.42%), Query Frame = 2
Query:   65 YYSILGTQKGASDDEIKKAYRKMALKYHPDKNKSPNAEAKFKEIAEAYEVLSDPKKKEIYDKYXXXXXXXXXXXXXXXXXXXXXFTYTFHGDPREIFKNFFGTDDPFANIFGNHSRRRGADNFMDVDDDFHPGI-SLFSG-------------------------------FNTGGGSFPHTQMKQDPPIYHDLSVSLEDVLSGTLKKIKITRKRPSPAGNSLIDEEKILEIDVKKGWKAGTKITFPREGDKYLTDNIPADIVFVIKDRTHRHFKRDGCDIRIKVKISWKDALCGIPNLQIPTLENQMINLPI--NTVIKPDTQKRIPGRGLPDNKNPSRRGDIVVEFEIIFPD---SLTDNAKKVIKQSLPDFSPS 1084
            +Y ILG    A+D EIKKAYRK ALKYHPDKN S  A  KFKE + AYE+LSDP+K++IYD++GE+GL G  G G    GG G           +IF  FFG         G   R RG     D+  +    +  L+ G                                N  G  F   QM    P+         DV  GT   I    +  S  G  + +E KILE+ V+ G K G +I F  E D+   D IP D+VF++ +R H+ FKRDG D+  + +I    A+ G     +  +    + + I    VI P  +K I G+G+P  K     G+++++F I FP+   +  +N KK+ +   P   P+
Sbjct:    7 FYDILGVPVTATDVEIKKAYRKCALKYHPDKNPSEEAAEKFKEASAAYEILSDPEKRDIYDQFGEDGLSGAGGAGGFPGGGFGFGD--------DIFSQFFGA--------GGAQRPRGPQRGKDIKHEISASLEELYKGRTAKLALNKQILCKECEGRGGKKGAVKKCTSCNGQGIKFVTRQMG---PMIQRFQTEC-DVCHGTGDIIDPKDRCKSCNGKKVENERKILEVHVEPGMKDGQRIVFKGEADQ-APDVIPGDVVFIVSERPHKSFKRDGDDLVYEAEIDLLTAIAG-GEFALEHVSGDWLKVGIVPGEVIAPGMRKVIEGKGMPIPKYGG-YGNLIIKFTIKFPENHFTSEENLKKLEEILPPRIVPA 360          
BLAST of DnaJ subfamily B vs. Ensembl Yeast
Match: SIS1 (Type II HSP40 co-chaperone that interacts with the HSP70 protein Ssa1p; shuttles between cytosol and nucleus; mediates delivery of misfolded proteins into the nucleus for degradation; involved in proteasomal degradation of misfolded cytosolic proteins; protein abundance increases in response to DNA replication stress; polyQ aggregates sequester Sis1p and interfere with clearance of misfolded proteins; similar to bacterial DnaJ proteins and mammalian DnaJB1 [Source:SGD;Acc:S000004952])

HSP 1 Score: 115.546 bits (288), Expect = 2.613e-29
Identity = 63/174 (36.21%), Postives = 103/174 (59.20%), Query Frame = 2
Query:  545 DLSVSLEDVLSGTLKKIKITRKRPSPAGNSLIDEEKILEIDVKKGWKAGTKITFPREGDKYLTDNIPADIVFVIKDRTHRHFKRDGCDIRIKVKISWKDALCGIPNLQIPTLENQMINLPINTVIKPDTQKRIPGRGLPDNKNPSRRGDIVVEFEIIFPDSLTDNAKKVIKQSL 1066
            +L VSLED+  G  K  KI RK P  A      E+  ++I +K GWKAGTKIT+  +GD          + FVI++++H +FKRDG D+   + +S+K++L G     I T++ + + L     ++P      PG+G+P  KNPS+RG+++V++++ +P SL D  K+ I ++ 
Sbjct:  185 NLPVSLEDLFVGKKKSFKIGRKGPHGA-----SEKTQIDIQLKPGWKAGTKITYKNQGDYNPQTGRRKTLQFVIQEKSHPNFKRDGDDLIYTLPLSFKESLLGFSKT-IQTIDGRTLPLSRVQPVQPSQTSTYPGQGMPTPKNPSQRGNLIVKYKVDYPISLNDAQKRAIDENF 352          

HSP 2 Score: 74.3294 bits (181), Expect = 3.754e-15
Identity = 36/63 (57.14%), Postives = 48/63 (76.19%), Query Frame = 2
Query:   68 YSILGTQKGASDDEIKKAYRKMALKYHPDKNKSPNAEA-KFKEIAEAYEVLSDPKKKEIYDKY 253
            Y +LG    A++ E+KK YRK ALKYHPDK   P  +  KFKEI+EA+E+L+DP+K+EIYD+Y
Sbjct:    8 YDLLGVSPSANEQELKKGYRKAALKYHPDK---PTGDTEKFKEISEAFEILNDPQKREIYDQY 67          
BLAST of DnaJ subfamily B vs. Ensembl Yeast
Match: SCJ1 (One of several homologs of bacterial chaperone DnaJ; located in the ER lumen where it cooperates with Kar2p to mediate maturation of proteins [Source:SGD;Acc:S000004827])

HSP 1 Score: 77.7962 bits (190), Expect = 3.618e-16
Identity = 38/67 (56.72%), Postives = 51/67 (76.12%), Query Frame = 2
Query:   56 GKDYYSILGTQKGASDDEIKKAYRKMALKYHPDKNK-SPNAEAKFKEIAEAYEVLSDPKKKEIYDKY 253
             +DYY+IL   K A++ EIK AYR+++ KYHPDKN  S  A  KF E+ EAY+VLSDP+KK+IYD++
Sbjct:   21 AQDYYAILEIDKDATEKEIKSAYRQLSKKYHPDKNAGSEEAHQKFIEVGEAYDVLSDPEKKKIYDQF 87          
BLAST of DnaJ subfamily B vs. Ensembl Yeast
Match: HLJ1 (Co-chaperone for Hsp40p; anchored in the ER membrane; with its homolog Ydj1p promotes ER-associated protein degradation (ERAD) of integral membrane substrates; similar to E. coli DnaJ [Source:SGD;Acc:S000004771])

HSP 1 Score: 72.4034 bits (176), Expect = 3.621e-15
Identity = 34/63 (53.97%), Postives = 45/63 (71.43%), Query Frame = 2
Query:   62 DYYSILGTQKGASDDEIKKAYRKMALKYHPDKNKSPNAEAKFKEIAEAYEVLSDPKKKEIYDK 250
            ++Y IL   + A+D EIKKAYRK+A+K HPDKN  P A   FK I  A+EVLS+ +K+ IYD+
Sbjct:   21 EFYEILKVDRKATDSEIKKAYRKLAIKLHPDKNSHPKAGEAFKVINRAFEVLSNEEKRSIYDR 83          
BLAST of DnaJ subfamily B vs. Ensembl Yeast
Match: JJJ1 (Co-chaperone that stimulates the ATPase activity of Ssa1p; required for a late step of ribosome biogenesis; associated with the cytosolic large ribosomal subunit; contains a J-domain; mutation causes defects in fluid-phase endocytosis [Source:SGD;Acc:S000005171])

HSP 1 Score: 70.0922 bits (170), Expect = 1.935e-13
Identity = 38/69 (55.07%), Postives = 46/69 (66.67%), Query Frame = 2
Query:   53 MGKDYYSILGTQKGASDDEIKKAYRKMALKYHPDKNKSPNAEA--KFKEIAEAYEVLSDPKKKEIYDKY 253
            M   YY +LG +  ASD E+KKAYRK AL+YHPDKN     EA  KF  I  AYEVLSDP+++  YD +
Sbjct:    1 MKTCYYELLGVETHASDLELKKAYRKKALQYHPDKNPDNVEEATQKFAVIRAAYEVLSDPQERAWYDSH 69          
BLAST of DnaJ subfamily B vs. Ensembl Nematostella
Match: EDO49360 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RG53])

HSP 1 Score: 281.182 bits (718), Expect = 2.867e-92
Identity = 176/352 (50.00%), Postives = 226/352 (64.20%), Query Frame = 2
Query:   53 MGKDYYSILGTQKGASDDEIKKAYRKMALKYHPDKNKSPNAEAKFKEIAEAYEVLSDPKKKEIYDKYXXXXXXXX---------XXXXXXXXXXXXXFTYTFHGDPREIFKNFFGTDDPFANIFGNHSRRRGADNFMDVDDDFHPGISLFSGFNTGGGSFPHT---QMKQDPPIYHDLSVSLEDVLSGTLKKIKITRKRPSPAGNSLIDEEKILEIDVKKGWKAGTKITFPREGDKYLTDNIPADIVFVIKDRTHRHFKRDG-CDIRIKVKISWKDALCGIPNLQIPTLENQMINLPINTVIKPDTQKRIPGRGLPDNKNPSRRGDIVVEFEIIFPDSLTDNAKKVIKQSLP 1069
            MGKDYY++L   K AS D+IKKAYRK ALKYHPDKNKSP AE KFKEI+EAYEVLSDPKKKEIYD+YGEEGLKG             G++   G   FTYT  GD RE F   FG +DPFA++ G                    G+  FS FN G GS       Q  QDPP+  DL VSLE++  GT KK+KI+RK P P G+  + EEKIL ++VK GWK GTKITFP+EGD+     IPAD+VF IKD+ H+HF RDG  ++  K KIS +DAL G   + +PTL  + + +    VI+P + KRI G GLP  K+ SR+GD+++++++  P+++T   K+V+  +LP
Sbjct:    1 MGKDYYAVLNVDKAASADDIKKAYRKQALKYHPDKNKSPGAEEKFKEISEAYEVLSDPKKKEIYDQYGEEGLKGTPPPQNGGGHGFSGANFGPGFTTFTYT-SGDARETFSRVFGDEDPFADLIG--------------------GLGGFSFFN-GMGSHQRKGRKQKVQDPPLERDLLVSLEELYKGTTKKMKISRKVPDPNGSQRL-EEKILTVNVKPGWKEGTKITFPKEGDRK-PGVIPADVVFKIKDKPHKHFTRDGDNNLVYKAKISLRDALGGT-TISVPTLSGRTVQVHNADVIQPGSSKRIVGEGLPMPKDNSRKGDLIIKYDVYLPNNITPAQKQVLMNTLP 327          
BLAST of DnaJ subfamily B vs. Ensembl Nematostella
Match: EDO46721 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RPE1])

HSP 1 Score: 278.485 bits (711), Expect = 7.698e-91
Identity = 174/350 (49.71%), Postives = 226/350 (64.57%), Query Frame = 2
Query:   53 MGKDYYSILGTQKGASDDEIKKAYRKMALKYHPDKNKSPNAEAKFKEIAEAYEVLSDPKKKEIYDKYXXXXXXXXX----XXXXXXXXXXXXFTY-TFHGDPREIFKNFFGTDDPFANIFGNHSRRRGADNFMDVDDDFHPGISLFSGFNTGG--GSFPHTQMKQDPPIYHDLSVSLEDVLSGTLKKIKITRKRPSPAGNSLIDEEKILEIDVKKGWKAGTKITFPREGDKYLTDNIPADIVFVIKDRTHRHFKRDG-CDIRIKVKISWKDALCGIPN---LQIPTLENQMINLPINTVIKPDTQKRIPGRGLPDNKNPSRRGDIVVEFEIIFPDSLTDNAKKVIKQSLP 1069
            MGK+YY ILG +K ASD E+KKAY+K A KYHPDKNK P AE KFKEIAEAYEVLSDP+K+EI+D+YGEEGLKGG+     G +DG   P GFTY  FHGDPR  F   FG +DPF +      R      F   +    P  S     +     G F   Q  QDPP+  +L VSLE +L+GT KK+KI ++  +  G+    EEKIL ++VKKGWKAGT+ITFP+EGD+     IPADIVF IKD+ H HF RD   +I   VKIS +DAL G  +   + +PTL+++++N+P+N ++KP ++KRI G GLP  K P +R D++V FE++FP  L       ++  LP
Sbjct:    1 MGKNYYDILGVKKDASDQELKKAYKKQAFKYHPDKNKDPGAEEKFKEIAEAYEVLSDPQKREIFDQYGEEGLKGGVPPPGAGDADGFQMPEGFTYFQFHGDPRATFSRVFGDEDPFKDFMDTAFRGNMPFGFSQSNVTSGPSYSRQRSSSYEDIPGFFSQCQRMQDPPVEKELFVSLEKLLTGTTKKLKIIKRVLNSIGHGTRSEEKILTVNVKKGWKAGTRITFPKEGDQK-PGRIPADIVFTIKDKKHEHFTRDNDNNILYTVKISLRDALTGYSSNITVPVPTLDHRVVNVPLNDIVKPGSKKRIKGEGLPLPKIPGQRMDMLVTFEVVFPSRLAPANVDALRNILP 349          
BLAST of DnaJ subfamily B vs. Ensembl Nematostella
Match: EDO38685 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SC61])

HSP 1 Score: 266.544 bits (680), Expect = 8.662e-87
Identity = 149/338 (44.08%), Postives = 223/338 (65.98%), Query Frame = 2
Query:   53 MGKDYYSILGTQKGASDDEIKKAYRKMALKYHPDKNKSPNAEAKFKEIAEAYEVLSDPKKKEIYDKYXXXXXXXXXXXXXXXXXXXXXFTYTFHGDPREIFKNFFGTDDPFANIFGNHSRRRGADNFMDVDDDFHPGISLFSGFNTGGGSFPHTQMKQDPPIYHDLSVSLEDVLSGTLKKIKITRKRPSPAGNSLIDEEKILEIDVKKGWKAGTKITFPREGDKYLTDNIPADIVFVIKDRTHRHFKRDGCDIRIKVKISWKDALCGIPNLQIPTLENQMINLPINTVIKPDTQKRIPGRGLPDNKNPSRRGDIVVEFEIIFPDSLTDNAKKVIKQSL 1066
            MG DYY ILG  + A+D +IKK YRK++LKYHPDKN+ P+AE KF++ AEAY+VLSDPKK+ IY+++GEEGLK G+      +       YTFHGD   +F+ FFG ++PF+ +F                D + P I    GF   GG     + KQDPPI  +L ++LE+V  G +KK+KI+R+  +  G++    +KIL I+VK+GW+A TKITFP+EGD+   +NIPADIVF++KD+ H  FKRD  ++     +    AL G   + +PTL+ ++I++P+N ++KP+ QK +P  G+P +KNP +RGD++++F I FP+ L+   K+++K++L
Sbjct:    1 MGLDYYDILGLTRSATDADIKKEYRKLSLKYHPDKNQEPSAEVKFRQAAEAYDVLSDPKKRAIYNQFGEEGLKSGVPEKDAWTQ-----GYTFHGDANRVFREFFGGNNPFSELF----------------DSYDPDI----GF---GGIHGRGRRKQDPPIERELYLTLEEVFKGCVKKMKISRRVMNEDGHTSNIRDKILTINVKRGWRASTKITFPKEGDQG-PNNIPADIVFIVKDKPHPIFKRDNDNLIYIATVPLGKALTGC-VVDVPTLDGRLISIPVNDIVKPEYQKVVPEEGMPISKNPDKRGDLIIQFNIEFPNHLSPEQKRLLKEAL 308          
BLAST of DnaJ subfamily B vs. Ensembl Nematostella
Match: EDO38741 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SC40])

HSP 1 Score: 219.55 bits (558), Expect = 2.178e-68
Identity = 152/340 (44.71%), Postives = 214/340 (62.94%), Query Frame = 2
Query:   53 MGKDYYSILGTQKGASDDEIKKAYRKMALKYHPDKNKSPNAEAKFKEIAEAYEVLSDPKKKEIYDKYXXXXXXXXXXXXXXXXXXXXXFTYTFHGDPREIFKNFFGTDDPFANIFGNHSRRRGADNFMDVDDDFHPGISLFSGFNTGGGSFPHTQMKQDPPIYHDLSVSLEDVLSGTLKKIKITRKRPSPAGNSLIDEEKILEIDVKKGWKAGTKITFPREGDKYLTDNIPADIVFVIKDRTHRHFKRDGCDIRIKV-KISWKDALCGIPNLQIPTLENQMINLPINTVIKPDTQKRIPGRGLPDNKNPSRRGDIVVEFEIIFPDSLTDNAKKVIKQSLP 1069
            MG++YY+ILG  + ASDD+IKKAYR+ AL +HPDKNK+  AE KFKEI+EAY+VL+DP++++I+D YGEEGLKG       G  G  GF+++   DP +IF   F  ++PF       S   G   F     DF PG             F      Q+P +   L VSLE++  G+++K++I  +  S   N  I E+KIL+I+VK GWKAGTKITFPREGD      I +DI+F+I D+ H+ FKRD  +  I V K++ KDAL G   +Q+PT++ +++++ +N VI+P  QKRI G GLP +KNP  R D++V FE+ FP +LT   ++ +  SLP
Sbjct:    1 MGRNYYAILGVPRNASDDDIKKAYRRQALIFHPDKNKNSGAEEKFKEISEAYKVLTDPRQRDIFDMYGEEGLKGTSDSPFGGPCGGFGFSFS--EDPMKIFAEVFRDEEPFKETGNFSSYSTGQKGFGFEGMDFGPGPD----------PFKKEGPIQEPAVEKILPVSLEELYIGSVRKLRINHQVLS-MNNEYIREDKILQIEVKPGWKAGTKITFPREGD-MKPGIIASDIIFIIADKPHQFFKRDSENNLIYVSKLTLKDALVGC-VIQVPTIDGRVLSIQVNEVIRPGMQKRIQGEGLPLSKNPIERADLIVTFEVEFPTNLTGEQREYLA-SLP 324          
BLAST of DnaJ subfamily B vs. Ensembl Nematostella
Match: EDO31903 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SWL1])

HSP 1 Score: 196.438 bits (498), Expect = 2.874e-59
Identity = 131/362 (36.19%), Postives = 201/362 (55.52%), Query Frame = 2
Query:   53 MGKDYYSILGTQKGASDDEIKKAYRKMALKYHPDKNKSPNAEAKFKEIAEAYEVLSDPKKKEIYDK---------YXXXXXXXXXXXXXXXXXXXXXFTYTFHGDPREIFKNFFGTDDPFANIFG--------NHSRRRGADNFMDVDDDFHPGISLFSGFNTGGGSFPHTQMK-QDPPIYHDLSVSLEDVLSGTLKKIKITRKRPSPAGNSLIDEEKILEIDVKKGWKAGTKITFPREGDKYLTDNIPADIVFVIKDRTHRHFKRD-GCDIRIKVKISWKDALCGIPNLQIPTLENQMINLPINTVIKPDTQKRIPGRGLPDNKNPSRRGDIVVEFEIIFPDSLTDNAKKVIKQSLPDFSP 1081
            M  +YY +LG ++ A+ D+I++AYR++ALKYHPDKN     E  FKE++EAYEVL DP+++E +DK            +         + G      F+ T     R   ++F   D+ F+++ G        +  + R +  + D  ++F   +     F T     P  + K QDPPI  DL + LE++L G+ K++K++RK     G S   EEK L +++K GWK GT+I FPREGD+    + P+DIVF IKD+ HRHF RD   ++  K  +S + AL G+ N+ +P+L  ++I+L    +I+P   + I G GLP   NPS R D++VEF++ FP+ L+       +Q L DF P
Sbjct:    1 MESNYYEVLGVERNATTDDIRRAYRRLALKYHPDKN--AGTEENFKEVSEAYEVLCDPQQRERFDKKFAPDTFRYSYSKRATSFDYEVNCGGFRNSHFSCTTEEAKRMFSRSF--CDEDFSDLIGGFGDFGLFSREKSRKSSRYDDFFNEFKDEMD----FET-----PFKKFKVQDPPIERDLLIGLEELLRGSTKRMKLSRK-IFQDGLSSKTEEKTLIVNIKPGWKQGTRIVFPREGDRRPGKD-PSDIVFKIKDKPHRHFTRDKDNNLIYKATVSLRTALGGM-NIHVPSLCGEVIDLENKGIIQPGMVRTIKGEGLPIPGNPSVRADMIVEFDVHFPNFLSREQ----RQGLLDFLP 342          
BLAST of DnaJ subfamily B vs. Ensembl Medaka
Match: dnajb4 (DnaJ heat shock protein family (Hsp40) member B4 [Source:NCBI gene;Acc:101170125])

HSP 1 Score: 327.02 bits (837), Expect = 1.342e-109
Identity = 179/346 (51.73%), Postives = 233/346 (67.34%), Query Frame = 2
Query:   53 MGKDYYSILGTQKGASDDEIKKAYRKMALKYHPDKNKSPNAEAKFKEIAEAYEVLSDPKKKEIYDKYXXXXXXXXXXXXXXXXXXXXXFTYTFHGDPREIFKNFFGTDDPFANIFGNHSRRRGADNFMDVDDDFHPGISLFSGFNTGG-------GSFPHTQMKQDPPIYHDLSVSLEDVLSGTLKKIKITRKRPSPAGNSLIDEEKILEIDVKKGWKAGTKITFPREGDKYLTDNIPADIVFVIKDRTHRHFKRDGCDIRIKVKISWKDALCGIPNLQIPTLENQMINLPINTVIKPDTQKRIPGRGLPDNKNPSRRGDIVVEFEIIFPDSLTDNAKKVIKQSLP 1069
            MGKDYY  LG  KGA+D++IKKAYRK ALK+HPDKNKS NA+ KFKE+AEAYEVLSDPKK++IYD+Y         G    G G    FTYTFHGDP   F  FFG  +PF   FG  +  R  D  MDVD +   G   F+ FN  G       G     + KQDPPI H+L V+LE+V  G  K++KI+RKR +P G ++  E+KIL I++K+GWK GTKITFPREGD+   + IPADIVFVIKD+ H HF+R+G +I   V++S + +LCG  ++ + T++ +  N+ I  VIKP  +K + G+GLP  KNP +RGD+VVEF++ FPD+L  NAK V+K+ LP
Sbjct:    2 MGKDYYKTLGISKGATDEDIKKAYRKQALKWHPDKNKSANADEKFKEVAEAYEVLSDPKKRDIYDQY--GEEGLKGGSAPAGDGQGTNFTYTFHGDPHATFATFFGGSNPFEMFFGRKANGR-DDEDMDVDGNDPFGS--FTSFNMNGFPRDGHVGLGGQQRRKQDPPIVHELRVTLEEVFHGCTKRMKISRKRLNPDGRTMRTEDKILTIEIKRGWKEGTKITFPREGDES-PNTIPADIVFVIKDKPHPHFRREGSNIVYPVRVSLRQSLCGC-SVTVSTIDGKTCNMKITDVIKPGLRKTVTGQGLPLPKNPEQRGDLVVEFDVNFPDALPGNAKDVLKRHLP 340          
BLAST of DnaJ subfamily B vs. Ensembl Medaka
Match: dnajb5 (DnaJ heat shock protein family (Hsp40) member B5 [Source:NCBI gene;Acc:101161491])

HSP 1 Score: 318.931 bits (816), Expect = 4.715e-106
Identity = 184/372 (49.46%), Postives = 237/372 (63.71%), Query Frame = 2
Query:   53 MGKDYYSILGTQKGASDDEIKKAYRKMALKYHPDKNKSPNAEAKFKEIAEAYEVLSDPKKKEIYDKYXXXXXXXXXXXXXXXXXXXXXFTYTFHGDPREIFKNFFGTDDPFANIFG---NHSRRRG------------ADNFMDVDDDF-HPG--ISLFSGFNTGGGSFP---------------HTQMKQDPPIYHDLSVSLEDVLSGTLKKIKITRKRPSPAGNSLIDEEKILEIDVKKGWKAGTKITFPREGDKYLTDNIPADIVFVIKDRTHRHFKRDGCDIRIKVKISWKDALCGIPNLQIPTLENQMINLPINTVIKPDTQKRIPGRGLPDNKNPSRRGDIVVEFEIIFPDSLTDNAKKVIKQSLP 1069
            MGKDYY ILG  KG++++EIKKAYR+MAL++HPDKN   NAE KFKEIAEAYEVLSDPKK+ +YD+   E      G  S G+ G   + YTFHGDP   F +FFG  +PF   FG   +HSR  G             D  MD D+ F H G       G N G   FP               + +  QDPP+ H+L VSLE++  G  K++KITR+R +P G S+  E+KIL I +KKGWK GTKITFP+EGD+   +NIPADI FV+KD+ H HF+RDG +I    KIS K+ALCG   + IPTLEN++I+LP   +IKP   KR+ G GLP  KNPS+RGD++VEF + FPD +   ++++I+Q LP
Sbjct:    1 MGKDYYKILGIPKGSNEEEIKKAYRRMALRFHPDKNTDANAEEKFKEIAEAYEVLSDPKKRVVYDQL-GEEGLKTGGSSSSGAPGSSTYHYTFHGDPHATFASFFGGSNPFDMFFGSNRSHSRSNGFPFHGDHSNDPDQDTEMDEDEPFTHFGRQFGFPGGMNNG---FPGEARRRRGAPSDRPGNNRKHQDPPVVHELKVSLEEIFHGCTKRMKITRRRLNPDGRSMRTEDKILNIVIKKGWKEGTKITFPKEGDE-TPENIPADIAFVLKDKGHTHFRRDGSNIIYNCKISLKEALCGC-TVSIPTLENRVISLPCLDIIKPGMVKRLRGEGLPFPKNPSQRGDLIVEFSVRFPDRIPPQSREIIRQHLP 366          
BLAST of DnaJ subfamily B vs. Ensembl Medaka
Match: dnajb5 (DnaJ heat shock protein family (Hsp40) member B5 [Source:NCBI gene;Acc:101161491])

HSP 1 Score: 317.775 bits (813), Expect = 7.209e-106
Identity = 179/357 (50.14%), Postives = 234/357 (65.55%), Query Frame = 2
Query:   53 MGKDYYSILGTQKGASDDEIKKAYRKMALKYHPDKNKSPNAEAKFKEIAEAYEVLSDPKKKEIYDKYXXXXXXXXXXXXXXXXXXXXXFTYTFHGDPREIFKNFFGTDDPFANIFGNHSRRRGADNFMDVDDDF-HPG--ISLFSGFNTGGGSFP---------------HTQMKQDPPIYHDLSVSLEDVLSGTLKKIKITRKRPSPAGNSLIDEEKILEIDVKKGWKAGTKITFPREGDKYLTDNIPADIVFVIKDRTHRHFKRDGCDIRIKVKISWKDALCGIPNLQIPTLENQMINLPINTVIKPDTQKRIPGRGLPDNKNPSRRGDIVVEFEIIFPDSLTDNAKKVIKQSLP 1069
            MGKDYY ILG  KG++++EIKKAYR+MAL++HPDKN   NAE KFKEIAEAYEVLSDPKK+ +YD+   E      G  S G+ G   + YTFHGDP   F +FFG  +PF   FG++      +  MD D+ F H G       G N G   FP               + +  QDPP+ H+L VSLE++  G  K++KITR+R +P G S+  E+KIL I +KKGWK GTKITFP+EGD+   +NIPADI FV+KD+ H HF+RDG +I    KIS K+ALCG   + IPTLEN++I+LP   +IKP   KR+ G GLP  KNPS+RGD++VEF + FPD +   ++++I+Q LP
Sbjct:    1 MGKDYYKILGIPKGSNEEEIKKAYRRMALRFHPDKNTDANAEEKFKEIAEAYEVLSDPKKRVVYDQL-GEEGLKTGGSSSSGAPGSSTYHYTFHGDPHATFASFFGGSNPFDMFFGSNR-----NTEMDEDEPFTHFGRQFGFPGGMNNG---FPGEARRRRGAPSDRPGNNRKHQDPPVVHELKVSLEEIFHGCTKRMKITRRRLNPDGRSMRTEDKILNIVIKKGWKEGTKITFPKEGDE-TPENIPADIAFVLKDKGHTHFRRDGSNIIYNCKISLKEALCGC-TVSIPTLENRVISLPCLDIIKPGMVKRLRGEGLPFPKNPSQRGDLIVEFSVRFPDRIPPQSREIIRQHLP 346          
BLAST of DnaJ subfamily B vs. Ensembl Medaka
Match: ENSORLT00000030433.1 (DnaJ heat shock protein family (Hsp40) member B1 [Source:NCBI gene;Acc:101155664])

HSP 1 Score: 317.775 bits (813), Expect = 7.445e-106
Identity = 190/354 (53.67%), Postives = 239/354 (67.51%), Query Frame = 2
Query:   53 MGKDYYSILGTQKGASDDEIKKAYRKMALKYHPDKNKSPNAEAKFKEIAEAYEVLSDPKKKEIYDKYXXXXXXXXXXXXXXXXXXXXXFTYTFHGDPREIFKNFFGTDDPFANIFGNHSRRRGADNFMDVDDDFHPGISLFSGFNTGGGSFP------------HTQM---KQDPPIYHDLSVSLEDVLSGTLKKIKITRKRPSPAGNSLIDEEKILEIDVKKGWKAGTKITFPREGDKYLTDNIPADIVFVIKDRTHRHFKRDGCDIRIKVKISWKDALCGIPNLQIPTLENQMINLPINTVIKPDTQKRIPGRGLPDNKNPSRRGDIVVEFEIIFPDSLTDNAKKVIKQSLP 1069
            MGKDYY ILG +KGASD++IKKAYRK AL+YHPDKNKSP AE KFKEIAEAY+VLSDPKKK++YD+Y   G +G  GGG  GSGGPG F YTF GDP  IF  FFG  +PF   FG   R  G D  MD DD F    + F    +G G F             HT +   +QDPP+ HDL V+LE+VL+G  KK+KI+RKR +P G S+  EEKILE+ +KKGWK GTKITFP+EGD+    NIPAD+VFV+KD+ H  FKRDG DI    ++S +DALCG   +  PTL+ + + +    V++P  ++RI G GLP  K P RRGD++VE+E+ FP+ L+ N +  I + LP
Sbjct:    1 MGKDYYEILGIKKGASDEDIKKAYRKQALRYHPDKNKSPGAEDKFKEIAEAYDVLSDPKKKDVYDRY---GEEGLKGGGPPGSGGPGTFHYTFQGDPHAIFAEFFGGRNPFEQFFGG--RNGGMDEDMDTDDPF----ARFGMGGSGMGGFQRPFGSGMGGMGGHTSVVKKQQDPPVVHDLRVTLEEVLNGCTKKMKISRKRLNPDGQSVRTEEKILEVQIKKGWKEGTKITFPKEGDE-TPRNIPADVVFVLKDKPHPVFKRDGSDIVYTARVSLRDALCGC-TVSAPTLDGRTVTVTSTEVVQPGMKRRISGEGLPYPKRPDRRGDLIVEYEVKFPERLSQNTRDTIARVLP 343          
BLAST of DnaJ subfamily B vs. Ensembl Medaka
Match: dnajb1a (dnaJ homolog subfamily B member 1-like [Source:NCBI gene;Acc:101163253])

HSP 1 Score: 316.62 bits (810), Expect = 1.306e-105
Identity = 175/345 (50.72%), Postives = 234/345 (67.83%), Query Frame = 2
Query:   53 MGKDYYSILGTQKGASDDEIKKAYRKMALKYHPDKNKSPNAEAKFKEIAEAYEVLSDPKKKEIYDKYXXXXXXXXXXXXXXXXXXXXXFTYTFHGDPREIFKNFFGTDDPFANIFGNHSRRRGADNFMDVDDDFHP-GISLFSGFNTGGGSFP----HTQ-MKQDPPIYHDLSVSLEDVLSGTLKKIKITRKRPSPAGNSLIDEEKILEIDVKKGWKAGTKITFPREGDKYLTDNIPADIVFVIKDRTHRHFKRDGCDIRIKVKISWKDALCGIPNLQIPTLENQMINLPINTVIKPDTQKRIPGRGLPDNKNPSRRGDIVVEFEIIFPDSLTDNAKKVIKQSLP 1069
            MGKDYY++LG  K  S+DEIKKAYRK AL++HPDKNKSP AE KFKEIAEAY+VLSD KK+EIYD+Y   G +G  G  +        F+YTF+GDP  IF  FFG   PF + F  +      +  MD++D F   G+    GF+     FP    HTQ  K+DPP+ H+L++SLE+V SG  KK+KI+RKR SP G ++  E+KIL +D+K+GWK GTKITFPREGD+  T NIPAD+VFV+KD+ H  FKR+G DI    KI+ K+ALCG   ++ PTL+ + I +    V+KP  +KRI G GLP +K P++RGD++++F + FPD L  + +  ++Q LP
Sbjct:    1 MGKDYYNVLGIAKDVSEDEIKKAYRKQALRFHPDKNKSPGAEDKFKEIAEAYDVLSDAKKREIYDRY---GEEGLKGPDNAAGHSGPNFSYTFNGDPHAIFAEFFGGRSPFEHFFSQN-----GEEDMDINDPFSAFGVGGIGGFHR-SYKFPQGNLHTQGKKKDPPVLHELNLSLEEVFSGCTKKMKISRKRLSPDGCTMRTEDKILTVDIKRGWKEGTKITFPREGDQTPT-NIPADVVFVVKDKPHPVFKREGSDIVYPAKITLKEALCGC-TIKAPTLDGRTITVTSKDVVKPGMKKRIVGEGLPLSKCPTKRGDMILDFSVRFPDKLGQSTRDALEQILP 334          
BLAST of DnaJ subfamily B vs. Planmine SMEST
Match: SMESG000073794.1 (SMESG000073794.1)

HSP 1 Score: 648.277 bits (1671), Expect = 0.000e+0
Identity = 343/345 (99.42%), Postives = 343/345 (99.42%), Query Frame = 2
Query:   53 MGKDYYSILGTQKGASDDEIKKAYRKMALKYHPDKNKSPNAEAKFKEIAEAYEVLSDPKKKEIYDKYXXXXXXXXXXXXXXXXXXXXXFTYTFHGDPREIFKNFFGTDDPFANIFGNHSRRRGADNFMDVDDDFHPGISLFSGFNTGGGSFPHTQMKQDPPIYHDLSVSLEDVLSGTLKKIKITRKRPSPAGNSLIDEEKILEIDVKKGWKAGTKITFPREGDKYLTDNIPADIVFVIKDRTHRHFKRDGCDIRIKVKISWKDALCGIPNLQIPTLENQMINLPINTVIKPDTQKRIPGRGLPDNKNPSRRGDIVVEFEIIFPDSLTDNAKKVIKQSLPDFSPSY 1087
            MGKDYYSILGTQKGASDDEIKKAYRKMALKYHPDKNKSPNAEAKFKEIAEAYEVLSDPKKKEIYDKYGEEGLKGGMGGGSDGSGGPGGFTYTFHGDPREIFKNFFGTDDPFANIFGNHSRRRGADNFMDVDDDFHPGISLFSGFNTGGGSFPH QMKQDPPIYHDLSVSLEDVLSGTLKKIKITRKRPSPAGNSLIDEEKILEIDVKKGWKAGTKITFPREGDKYLTDNIPADIVFVIKDRTHRHFKRDGCDIRIKVKIS KDALCGIPNLQIPTLENQMINLPINTVIKPDTQKRIPGRGLPDNKNPSRRGDIVVEFEIIFPDSLTDNAKKVIKQSLPDFSPSY
Sbjct:    1 MGKDYYSILGTQKGASDDEIKKAYRKMALKYHPDKNKSPNAEAKFKEIAEAYEVLSDPKKKEIYDKYGEEGLKGGMGGGSDGSGGPGGFTYTFHGDPREIFKNFFGTDDPFANIFGNHSRRRGADNFMDVDDDFHPGISLFSGFNTGGGSFPHAQMKQDPPIYHDLSVSLEDVLSGTLKKIKITRKRPSPAGNSLIDEEKILEIDVKKGWKAGTKITFPREGDKYLTDNIPADIVFVIKDRTHRHFKRDGCDIRIKVKISLKDALCGIPNLQIPTLENQMINLPINTVIKPDTQKRIPGRGLPDNKNPSRRGDIVVEFEIIFPDSLTDNAKKVIKQSLPDFSPSY 345          
BLAST of DnaJ subfamily B vs. Planmine SMEST
Match: SMESG000076708.1 (SMESG000076708.1)

HSP 1 Score: 241.506 bits (615), Expect = 1.324e-76
Identity = 148/339 (43.66%), Postives = 209/339 (61.65%), Query Frame = 2
Query:   53 MGKDYYSILGTQKGASDDEIKKAYRKMALKYHPDKNKS-PNAEAKFKEIAEAYEVLSDPKKKEIYDKYXXXXXXXXXXXXXXXXXXXXXFTYTFHGDPREIFKNFFGTDDPFANIFGNHSRRRGADNFMDVDDDFHPGISLFSGFNTGGGSFPHTQMKQDPPIYHDLSVSLEDVLSGTLKKIKITRKRPSPAGNSLIDEEKILEIDVKKGWKAGTKITFPREGDKYLTDNIPADIVFVIKDRTHRHFKRDGCDIRIKVKISWKDALCGIPNLQIPTLENQMINLPINTVIKPDTQKRIPGRGLPDNKNPSRRGDIVVEFEIIFPDSLTDNAKKVIKQSL 1066
            MG+DYYSIL  Q+ A D +IKKAYR  ALK HP KN S P+A  KF  I+EAYEVLSDP K+ +YD++GEEGLK G+  GS  +G      YT+HG+P + F NFFG D+PF   +              +D D H            GG +  +QM QDP I  DL+++LE++  G +KK+KI+R+  +  G++    +KIL ++V+ GWK GTKITFP+EGD+   + IPAD+VF++KDR H  F+RD  ++     IS  DAL G   + I TL+++++++PI  +I P   K +PG G+P    P  +GD+ ++F+I FP  LT   K+ IK  L
Sbjct:    1 MGQDYYSILCIQRNAKDGDIKKAYRMFALKLHPLKNISDPSAFEKFSLISEAYEVLSDPSKRAVYDQFGEEGLKNGIPHGSIEAGAWTK-GYTYHGNPDKTFINFFGADNPFQEFYDR------------MDGDMHLSF---------GGLYGRSQMLQDPSIERDLNLTLEEIYHGCIKKLKISRRVMNEDGHTSSIRDKILSVNVQCGWKEGTKITFPKEGDQG-PNIIPADVVFILKDRAHSRFRRDEANLIYSSSISLADALIGC-TIDIVTLDDRLLHIPITDIIYPGYVKIVPGEGMPHPSKPDMKGDLHIQFKIEFPKKLTPEQKEHIKAIL 315          
BLAST of DnaJ subfamily B vs. Planmine SMEST
Match: SMESG000005055.1 (SMESG000005055.1)

HSP 1 Score: 193.356 bits (490), Expect = 5.345e-58
Identity = 123/339 (36.28%), Postives = 192/339 (56.64%), Query Frame = 2
Query:   53 MGKDYYSILGTQKGASDDEIKKAYRKMALKYHPDKN-KSPNAEAKFKEIAEAYEVLSDPKKKEIYDKYXXXXXXXXXXXXXXXXXXXXXFTYTFHGDPREIFKNFFGTDDPFANIFGNHSRRRGADNFMDVDDDFHPGISLFSGFNTGGGSFPHTQMKQDPPIYHDLSVSLEDVLSGTLKKIKITRKRPSPAGNSLIDEEKILEIDVKKGWKAGTKITFPREGDKYLTDNIPADIVFVIKDRTHRHFKRDGCDIRIKVKISWKDALCGIPNLQIPTLENQMINLPINTVIKPDTQKRIPGRGLPDNKNPSRRGDIVVEFEIIFPDSLTDNAKKVIKQSL 1066
            M KDYY IL   + A+  EI KAYRK+ +KYHP KN +S  +  +F  ++EAY+VLSD +K+ IYD++GE GLK G+      +G      YT+HG+P + F  F+ +++PF   F +            +D D H            GG +      +D  I  +L ++LE+V  G +KK+KITR+  +    +    +KIL + VKKGW  GTKI FP EGD+   +N+PADI+FV+KDR H  F R+  ++  K KI    AL G   + I  L+++++++P+  ++ P     + G G+P  +    +GD++++FEI+FP  LT   K +I++  
Sbjct:    1 MSKDYYEILNIPRHATIIEINKAYRKLGVKYHPKKNPESDCSYDQFFLVSEAYDVLSDDRKRGIYDQFGEYGLKHGVPRSDTFNGAWTE-GYTYHGNPEKTFFEFYSSNNPFREYFDH------------IDGDLHMSF---------GGLYGRGVKTKDDSIERNLMITLEEVFHGCVKKMKITRRVLNADIRTTSVHDKILTVFVKKGWLEGTKIVFPEEGDQ-GPNNVPADIIFVLKDRPHPRFYREKFNLIYKTKIDLAKALLGCI-VDIVMLDDRVLHIPVTNIVDPTYTMTVKGEGMPLTEVGDEKGDLIIKFEIVFPRYLTAEQKILIEEGF 315          
BLAST of DnaJ subfamily B vs. Planmine SMEST
Match: SMESG000077692.1 (SMESG000077692.1)

HSP 1 Score: 119.398 bits (298), Expect = 7.439e-30
Identity = 101/347 (29.11%), Postives = 177/347 (51.01%), Query Frame = 2
Query:   56 GKDYYSILGTQKGASDDEIKKAYRKMALKYHPDKNK-SPNAEAKFKEIAEAYEVLSDPKKKEIYDKYXXXXXXXXXXXXXXXXXXXXXFTYTFHGDPREIFKNFFGTDDPFANIFGNHSRR---RGADNFMDVDDDFHPGISLFSGFNTGGGSFPHTQMKQDPPIYHDLSVSLEDVLSG----TLKKIKITRKRPSPAGNSLIDEEKILEIDVKKGWKAGTKITFPREGDKYLTDNIPADIVFVIKDRTHRHFKRDGCDIRIKVKISWKDALCGIPNLQIPTLENQMINLPINTVIKPDTQKRIPGRGLPDNKNPSRRGDIVVEFEIIFPDS--LTDNAKKVIKQSL 1066
            G+D+Y IL   + A+ ++IKKAYR +A + HPDKNK  PNAE++F+++  AYE LSDP+K++I+D  GEEGLK   GG                G   + F +FFG  D F ++ G+  ++   RG D  MD+   F     L++G       +   +         +    ++ + +G    T+ + ++  + P+      + EEK+LE++++ G + G    F  EG+ ++ D  P D+ F I+  +H  F+R G D+   V IS  DAL G  +++I  L+   + +    V  P    +    G+P+ +N   +G + +  ++ FP     ++  K+++K+ L
Sbjct:   19 GRDFYKILNVPRSANSNQIKKAYRNLAKQLHPDKNKDDPNAESQFQDLNAAYEALSDPEKRKIFDARGEEGLKDSHGG----------------GSSMDPFSSFFG--DVFFDMGGSRRQKDIPRGGDVVMDL---FVSLEELYNGNFVEVVRYKSVKKSAHGTRRCNCRHEMKTIQTGPGRFTMTQEQVCDECPNV---RFVPEEKLLEVEIEPGMRDGQLYPFVAEGEPHI-DGEPGDLKFRIRQSSHPRFERRGDDLYTNVTISLLDALQGF-SMEIKHLDGHKVKVIREKVTWPGATIKKSMEGMPNYENNHVKGSLYITIDVAFPKDKVYSEEEKEILKKLL 339          
BLAST of DnaJ subfamily B vs. Planmine SMEST
Match: SMESG000005351.1 (SMESG000005351.1)

HSP 1 Score: 92.8189 bits (229), Expect = 1.768e-21
Identity = 68/178 (38.20%), Postives = 92/178 (51.69%), Query Frame = 2
Query:   65 YYSILGTQKGASDDEIKKAYRKMALKYHPDKN--KSPNAEAKFKEIAEAYEVLSDPKKKEIYDKYXXXXXXXXXXXXXXXXXXXXXFTYTFHGDPREIFKNFFGTDDPFANIFGNHSRRRGADNFMDVDDDFHPGISLFSGFNTG--GGSFPHTQMKQDPPIYHDLSVSLEDVLSGTL 586
            YY IL     +   EIKK YRK+AL++HPDKN      AE KFKEI+EAYEVLSD +K+++YD YG++G                  +++F  +P ++F+ FFG  DPFA+IFG              DDDF  G+   SG + G   GS    + K  P     +S  + DV  G  
Sbjct:    6 YYDILNVSPNSDASEIKKQYRKLALRWHPDKNPDNKIEAEKKFKEISEAYEVLSDAEKRKMYDMYGKDGPASRPSYSGFSDYHSFP-SFSFR-NPNDVFREFFGGSDPFASIFG--------------DDDFFFGV---SGSDRGMRNGSKKSRRSKNQPSSSAFMSFGMPDVFGGGF 164          
The following BLAST results are available for this feature:
BLAST of DnaJ subfamily B vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
DNAJB12.036e-11150.57DnaJ heat shock protein family (Hsp40) member B1 [... [more]
DNAJB41.968e-11051.86DnaJ heat shock protein family (Hsp40) member B4 [... [more]
DNAJB51.265e-10751.42DnaJ heat shock protein family (Hsp40) member B5 [... [more]
DNAJB51.265e-10751.42DnaJ heat shock protein family (Hsp40) member B5 [... [more]
DNAJB56.780e-10751.27DnaJ heat shock protein family (Hsp40) member B5 [... [more]
back to top
BLAST of DnaJ subfamily B vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dnj-131.416e-9351.18DNaJ domain (Prokaryotic heat shock protein) [Sou... [more]
dnj-131.416e-9351.18DNaJ domain (Prokaryotic heat shock protein) [Sou... [more]
dnj-192.897e-2134.59DNaJ domain (Prokaryotic heat shock protein) [Sou... [more]
dnj-192.897e-2134.59DNaJ domain (Prokaryotic heat shock protein) [Sou... [more]
dnj-121.292e-1762.90DNaJ domain (Prokaryotic heat shock protein) [Sou... [more]
back to top
BLAST of DnaJ subfamily B vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
DnaJ-15.312e-9850.00gene:FBgn0263106 transcript:FBtr0077123[more]
DnaJ-15.312e-9850.00gene:FBgn0263106 transcript:FBtr0077124[more]
CG50013.981e-9648.15gene:FBgn0031322 transcript:FBtr0307057[more]
CG50014.341e-9547.65gene:FBgn0031322 transcript:FBtr0335379[more]
CG50014.341e-9547.65gene:FBgn0031322 transcript:FBtr0307056[more]
back to top
BLAST of DnaJ subfamily B vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dnajb1b1.020e-11153.43DnaJ heat shock protein family (Hsp40) member B1b ... [more]
dnajb43.089e-11153.87DnaJ heat shock protein family (Hsp40) member B4 [... [more]
dnajb54.495e-10950.69DnaJ heat shock protein family (Hsp40) member B5 [... [more]
dnajb54.495e-10950.69DnaJ heat shock protein family (Hsp40) member B5 [... [more]
dnajb1a2.287e-10452.75DnaJ heat shock protein family (Hsp40) member B1a ... [more]
back to top
BLAST of DnaJ subfamily B vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dnajb41.600e-11253.31DnaJ heat shock protein family (Hsp40) member B4 [... [more]
chd91.432e-10450.85chromodomain helicase DNA binding protein 9 [Sourc... [more]
dnajb13.634e-10151.85DnaJ heat shock protein family (Hsp40) member B1 [... [more]
dnajb133.907e-7843.53DnaJ heat shock protein family (Hsp40) member B13 ... [more]
dnaja4.24.003e-3832.18DnaJ (Hsp40) homolog, subfamily A, member 4, gene ... [more]
back to top
BLAST of DnaJ subfamily B vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Dnajb14.872e-11251.59DnaJ heat shock protein family (Hsp40) member B1 [... [more]
Dnajb53.567e-10851.42DnaJ heat shock protein family (Hsp40) member B5 [... [more]
Dnajb53.567e-10851.42DnaJ heat shock protein family (Hsp40) member B5 [... [more]
Dnajb53.567e-10851.42DnaJ heat shock protein family (Hsp40) member B5 [... [more]
Dnajb44.048e-10850.72DnaJ heat shock protein family (Hsp40) member B4 [... [more]
back to top
BLAST of DnaJ subfamily B vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q3MI00|DNJB1_BOVIN1.227e-11150.85DnaJ homolog subfamily B member 1 OS=Bos taurus OX... [more]
sp|Q9QYJ3|DNJB1_MOUSE3.408e-11151.59DnaJ homolog subfamily B member 1 OS=Mus musculus ... [more]
sp|P25685|DNJB1_HUMAN9.777e-11150.57DnaJ homolog subfamily B member 1 OS=Homo sapiens ... [more]
sp|Q2KIT4|DNJB4_BOVIN1.053e-11052.77DnaJ homolog subfamily B member 4 OS=Bos taurus OX... [more]
sp|Q9UDY4|DNJB4_HUMAN9.453e-11051.86DnaJ homolog subfamily B member 4 OS=Homo sapiens ... [more]
back to top
BLAST of DnaJ subfamily B vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A430QIY64.612e-13061.27DnaJ subfamily B member 4 OS=Schistosoma bovis OX=... [more]
A0A094ZUA75.199e-13061.27DnaJ subfamily B member 4 OS=Schistosoma haematobi... [more]
G7Y3V91.248e-12659.65DnaJ homolog subfamily B member 4 OS=Clonorchis si... [more]
Q5DF677.354e-12660.29DnaJ homolog, subfamily B, member 4 OS=Schistosoma... [more]
A0A5J4NKF02.531e-12560.00DnaJ subfamily B member 4 OS=Paragonimus westerman... [more]
back to top
BLAST of DnaJ subfamily B vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dnajb42.203e-10952.71DnaJ heat shock protein family (Hsp40) member B4 [... [more]
dnajb1b5.546e-10852.16dnaJ homolog subfamily B member 1 [Source:NCBI gen... [more]
dnajb1a1.083e-10553.11dnaJ homolog subfamily B member 1-like [Source:NCB... [more]
dnajb41.006e-9749.85DnaJ heat shock protein family (Hsp40) member B4 [... [more]
zgc:1229791.650e-7339.07zgc:122979 [Source:ZFIN;Acc:ZDB-GENE-051127-45][more]
back to top
BLAST of DnaJ subfamily B vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000005773.11.232e-6643.61pep scaffold:Pmarinus_7.0:GL480846:50332:51737:1 g... [more]
DNAJA49.885e-3430.92DnaJ heat shock protein family (Hsp40) member A4 [... [more]
dnaja11.852e-1833.70DnaJ heat shock protein family (Hsp40) member A1 [... [more]
dnajc5aa2.857e-1862.69DnaJ (Hsp40) homolog, subfamily C, member 5aa [Sou... [more]
dnaja3b9.262e-1729.23DnaJ heat shock protein family (Hsp40) member A3b ... [more]
back to top
BLAST of DnaJ subfamily B vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
YDJ11.043e-3533.16Type I HSP40 co-chaperone; involved in regulation ... [more]
SIS12.613e-2936.21Type II HSP40 co-chaperone that interacts with the... [more]
SCJ13.618e-1656.72One of several homologs of bacterial chaperone Dna... [more]
HLJ13.621e-1553.97Co-chaperone for Hsp40p; anchored in the ER membra... [more]
JJJ11.935e-1355.07Co-chaperone that stimulates the ATPase activity o... [more]
back to top
BLAST of DnaJ subfamily B vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO493602.867e-9250.00Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO467217.698e-9149.71Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO386858.662e-8744.08Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO387412.178e-6844.71Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO319032.874e-5936.19Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of DnaJ subfamily B vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dnajb41.342e-10951.73DnaJ heat shock protein family (Hsp40) member B4 [... [more]
dnajb54.715e-10649.46DnaJ heat shock protein family (Hsp40) member B5 [... [more]
dnajb57.209e-10650.14DnaJ heat shock protein family (Hsp40) member B5 [... [more]
ENSORLT00000030433.17.445e-10653.67DnaJ heat shock protein family (Hsp40) member B1 [... [more]
dnajb1a1.306e-10550.72dnaJ homolog subfamily B member 1-like [Source:NCB... [more]
back to top
BLAST of DnaJ subfamily B vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000073794.10.000e+099.42SMESG000073794.1[more]
SMESG000076708.11.324e-7643.66SMESG000076708.1[more]
SMESG000005055.15.345e-5836.28SMESG000005055.1[more]
SMESG000077692.17.439e-3029.11SMESG000077692.1[more]
SMESG000005351.11.768e-2138.20SMESG000005351.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30000103 ID=SMED30000103|Name=DnaJ subfamily B|organism=Schmidtea mediterranea sexual|type=transcript|length=1289bp
CAAATTTTTATTTAATTTAGTACTACTTTAAAGTTAATTTTTACGTTTTG
CTATGGGTAAAGACTATTATTCAATATTAGGCACTCAGAAAGGAGCTTCT
GATGACGAAATTAAGAAAGCCTATAGAAAAATGGCTTTAAAATATCATCC
TGATAAAAATAAGTCGCCAAATGCAGAGGCAAAATTTAAAGAAATTGCTG
AAGCATATGAGGTTTTGAGCGATCCTAAAAAAAAAGAAATTTATGACAAA
TATGGTGAAGAAGGATTAAAAGGTGGAATGGGTGGAGGTAGTGATGGAAG
TGGAGGTCCTGGTGGATTCACATATACTTTCCACGGTGATCCTAGAGAAA
TATTCAAAAATTTCTTTGGGACGGATGATCCTTTCGCAAATATATTTGGT
AATCATTCTCGTCGACGTGGAGCTGACAATTTTATGGATGTAGATGATGA
TTTCCATCCTGGAATTTCATTGTTTTCAGGATTCAATACGGGTGGAGGGT
CTTTCCCTCACACTCAGATGAAACAAGATCCTCCTATCTATCACGATTTA
TCAGTTTCTTTAGAAGATGTATTATCAGGGACTTTAAAGAAAATAAAGAT
CACTAGAAAACGTCCATCTCCAGCTGGAAATTCGTTAATTGATGAAGAGA
AAATATTGGAAATCGACGTGAAGAAAGGCTGGAAAGCGGGCACTAAAATA
ACTTTTCCGCGTGAAGGAGATAAATATTTAACTGATAATATTCCTGCAGA
TATTGTTTTCGTCATTAAAGATAGAACTCATCGTCATTTCAAAAGAGATG
GTTGTGATATTCGTATTAAAGTTAAAATAAGTTGGAAAGATGCATTGTGT
GGTATTCCAAATCTTCAAATACCGACACTGGAAAATCAAATGATCAATTT
ACCGATTAACACTGTTATTAAACCTGATACACAAAAGCGTATACCAGGCC
GGGGACTTCCAGATAATAAAAATCCGTCTCGGCGGGGTGATATCGTCGTT
GAATTTGAAATCATTTTTCCTGATTCTCTTACTGACAATGCCAAAAAAGT
CATCAAGCAATCATTGCCTGATTTTTCTCCAAGCTATTGATTTGTGTACA
AACATGTGTTGAATATATATTAAGATTGTAATTTACCTGCTTTTTAGTTA
CTGCATGTTATAATGTCTAAAACCGGTGGAAATCTATGATTTTTAATGAA
ATTGAAGTTTTGTAAGGGTTTAAGAAACGACATTTCCTTATCTGCATTAC
TTGTTTTTTGTATTCTAGTCATTAATTCAAATTTTAAGT
back to top

protein sequence of SMED30000103-orf-1

>SMED30000103-orf-1 ID=SMED30000103-orf-1|Name=SMED30000103-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=346bp
MGKDYYSILGTQKGASDDEIKKAYRKMALKYHPDKNKSPNAEAKFKEIAE
AYEVLSDPKKKEIYDKYGEEGLKGGMGGGSDGSGGPGGFTYTFHGDPREI
FKNFFGTDDPFANIFGNHSRRRGADNFMDVDDDFHPGISLFSGFNTGGGS
FPHTQMKQDPPIYHDLSVSLEDVLSGTLKKIKITRKRPSPAGNSLIDEEK
ILEIDVKKGWKAGTKITFPREGDKYLTDNIPADIVFVIKDRTHRHFKRDG
CDIRIKVKISWKDALCGIPNLQIPTLENQMINLPINTVIKPDTQKRIPGR
GLPDNKNPSRRGDIVVEFEIIFPDSLTDNAKKVIKQSLPDFSPSY*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000101muscle cell
PLANA:0000142posterior region of the whole animal
PLANA:0000429neoblast
PLANA:0002111X2 cell
Vocabulary: INTERPRO
TermDefinition
IPR036869J_dom_sf
IPR001623DnaJ_domain
IPR002939DnaJ_C
IPR018253DnaJ_domain_CS
IPR008971HSP40/DnaJ_pept-bd
Vocabulary: molecular function
TermDefinition
GO:0051082unfolded protein binding
Vocabulary: biological process
TermDefinition
GO:0006457protein folding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001623DnaJ domainPRINTSPR00625JDOMAINcoord: 6..24
score: 55.92
coord: 24..39
score: 59.03
coord: 40..60
score: 62.42
coord: 60..79
score: 39.23
IPR001623DnaJ domainSMARTSM00271dnaj_3coord: 3..60
e-value: 9.6E-31
score: 118.1
IPR001623DnaJ domainPFAMPF00226DnaJcoord: 4..65
e-value: 9.4E-28
score: 96.1
IPR001623DnaJ domainPROSITEPS50076DNAJ_2coord: 4..68
score: 24.754
IPR001623DnaJ domainCDDcd06257DnaJcoord: 4..57
e-value: 2.12105E-25
score: 94.9197
NoneNo IPR availableGENE3DG3DSA:2.60.260.20coord: 158..241
e-value: 2.0E-26
score: 94.0
NoneNo IPR availableGENE3DG3DSA:2.60.260.20coord: 243..324
e-value: 7.5E-23
score: 82.6
NoneNo IPR availablePANTHERPTHR24078DNAJ HOMOLOG SUBFAMILY C MEMBERcoord: 1..339
NoneNo IPR availablePANTHERPTHR24078:SF525DNAJ HOMOLOG SUBFAMILY B MEMBER 5coord: 1..339
NoneNo IPR availableCDDcd10747DnaJ_Ccoord: 160..326
e-value: 8.85743E-46
score: 151.424
IPR002939Chaperone DnaJ, C-terminalPFAMPF01556DnaJ_Ccoord: 162..323
e-value: 2.1E-39
score: 134.9
IPR036869Chaperone J-domain superfamilyGENE3DG3DSA:1.10.287.110coord: 1..131
e-value: 2.4E-37
score: 129.8
IPR036869Chaperone J-domain superfamilySUPERFAMILYSSF46565Chaperone J-domaincoord: 3..88
IPR018253DnaJ domain, conserved sitePROSITEPS00636DNAJ_1coord: 45..64
IPR008971HSP40/DnaJ peptide-bindingSUPERFAMILYSSF49493HSP40/DnaJ peptide-binding domaincoord: 161..243
IPR008971HSP40/DnaJ peptide-bindingSUPERFAMILYSSF49493HSP40/DnaJ peptide-binding domaincoord: 245..333