Neuropeptide FF receptor 2

Overview
NameNeuropeptide FF receptor 2
Smed IDSMED30000095
Length (bp)1579
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Neuropeptide FF receptor 2 (SMED30000095) t-SNE clustered cells

Violin plots show distribution of expression levels for Neuropeptide FF receptor 2 (SMED30000095) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Neuropeptide FF receptor 2 (SMED30000095) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Neuropeptide FF receptor 2 (SMED30000095) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30000095

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30000095SMESG000062880.1 SmedASXL_000486SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
headSMED30000095SMESG000062880.1 dd_Smed_v6_22952_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Neuropeptide FF receptor 2 vs. Ensembl Human
Match: NPFFR2 (neuropeptide FF receptor 2 [Source:HGNC Symbol;Acc:HGNC:4525])

HSP 1 Score: 125.176 bits (313), Expect = 1.470e-30
Identity = 98/357 (27.45%), Postives = 180/357 (50.42%), Query Frame = 2
Query:  314 YMILKPQTSKFQIVXXXXXXXXXXXGSTGNICVILCVTLFRN--MRTISHVFLLNLACSDLLVFLICEPFTIASLINPDWIFGESLCRLNGVFQGTSVGVSILTLTSVCIERYIVIVGKGFNQNRFNFRHLICWVVGIWITSFLITSPLLQAYEVKEKNLTFIK--------PTRYCMETWSGKNNRKKVFTTXXXXXXXXXXXXXXXXXYSKVGNHLRRSTNTLINIENKPSAKRLKTQDTNNVISTHSMSKLNSIKGINNTRQRISKLLMILTLLFAIFWLPYHVTSFIIDFIFGSNIDNNLESFSDVGWLNVYVYPMTQILAYVNNAINPLCTLIISKKFRTTLN---QMRKCQ 1345
            Y + +PQ +   I+   +   L ++G+T     ++C  + RN  M T++++F+LNLA SDLLV + C P T+   I   W FG ++C+++G+ QG SV  S+ TL ++ ++R+  +V     + +   +     ++ IW+ +  I SP      V+E+    ++        P  +C E W  +  R K++TT++F   YL PL  ++I+Y ++G  L R+          P   R K Q+  +V+S                +Q+I K+L+I+ LLF + WLP      + D+   +++  N     ++  +N+Y+YP    LA+ N+++NP+     ++ FR       Q++ CQ
Sbjct:   40 YYLHQPQVAAIFIISYFLIFFLCMMGNT-----VVCFIVMRNKHMHTVTNLFILNLAISDLLVGIFCMPITLLDNIIAGWPFGNTMCKISGLVQGISVAASVFTLVAIAVDRFQCVVYPF--KPKLTIKTAFVIIMIIWVLAITIMSPSAVMLHVQEEKYYRVRLNSQNKTSPVYWCREDWPNQEMR-KIYTTVLFANIYLAPLSLIVIMYGRIGISLFRAA--------VPHTGR-KNQEQWHVVS--------------RKKQKIIKMLLIVALLFILSWLPLWTLMMLSDY---ADLSPN-----ELQIINIYIYPFAHWLAFGNSSVNPIIYGFFNENFRRGFQEAFQLQLCQ 357          
BLAST of Neuropeptide FF receptor 2 vs. Ensembl Human
Match: NPFFR2 (neuropeptide FF receptor 2 [Source:HGNC Symbol;Acc:HGNC:4525])

HSP 1 Score: 124.79 bits (312), Expect = 1.507e-30
Identity = 98/357 (27.45%), Postives = 180/357 (50.42%), Query Frame = 2
Query:  314 YMILKPQTSKFQIVXXXXXXXXXXXGSTGNICVILCVTLFRN--MRTISHVFLLNLACSDLLVFLICEPFTIASLINPDWIFGESLCRLNGVFQGTSVGVSILTLTSVCIERYIVIVGKGFNQNRFNFRHLICWVVGIWITSFLITSPLLQAYEVKEKNLTFIK--------PTRYCMETWSGKNNRKKVFTTXXXXXXXXXXXXXXXXXYSKVGNHLRRSTNTLINIENKPSAKRLKTQDTNNVISTHSMSKLNSIKGINNTRQRISKLLMILTLLFAIFWLPYHVTSFIIDFIFGSNIDNNLESFSDVGWLNVYVYPMTQILAYVNNAINPLCTLIISKKFRTTLN---QMRKCQ 1345
            Y + +PQ +   I+   +   L ++G+T     ++C  + RN  M T++++F+LNLA SDLLV + C P T+   I   W FG ++C+++G+ QG SV  S+ TL ++ ++R+  +V     + +   +     ++ IW+ +  I SP      V+E+    ++        P  +C E W  +  R K++TT++F   YL PL  ++I+Y ++G  L R+          P   R K Q+  +V+S                +Q+I K+L+I+ LLF + WLP      + D+   +++  N     ++  +N+Y+YP    LA+ N+++NP+     ++ FR       Q++ CQ
Sbjct:   37 YYLHQPQVAAIFIISYFLIFFLCMMGNT-----VVCFIVMRNKHMHTVTNLFILNLAISDLLVGIFCMPITLLDNIIAGWPFGNTMCKISGLVQGISVAASVFTLVAIAVDRFQCVVYPF--KPKLTIKTAFVIIMIIWVLAITIMSPSAVMLHVQEEKYYRVRLNSQNKTSPVYWCREDWPNQEMR-KIYTTVLFANIYLAPLSLIVIMYGRIGISLFRAA--------VPHTGR-KNQEQWHVVS--------------RKKQKIIKMLLIVALLFILSWLPLWTLMMLSDY---ADLSPN-----ELQIINIYIYPFAHWLAFGNSSVNPIIYGFFNENFRRGFQEAFQLQLCQ 354          
BLAST of Neuropeptide FF receptor 2 vs. Ensembl Human
Match: NPFFR2 (neuropeptide FF receptor 2 [Source:HGNC Symbol;Acc:HGNC:4525])

HSP 1 Score: 122.094 bits (305), Expect = 4.094e-29
Identity = 98/357 (27.45%), Postives = 180/357 (50.42%), Query Frame = 2
Query:  314 YMILKPQTSKFQIVXXXXXXXXXXXGSTGNICVILCVTLFRN--MRTISHVFLLNLACSDLLVFLICEPFTIASLINPDWIFGESLCRLNGVFQGTSVGVSILTLTSVCIERYIVIVGKGFNQNRFNFRHLICWVVGIWITSFLITSPLLQAYEVKEKNLTFIK--------PTRYCMETWSGKNNRKKVFTTXXXXXXXXXXXXXXXXXYSKVGNHLRRSTNTLINIENKPSAKRLKTQDTNNVISTHSMSKLNSIKGINNTRQRISKLLMILTLLFAIFWLPYHVTSFIIDFIFGSNIDNNLESFSDVGWLNVYVYPMTQILAYVNNAINPLCTLIISKKFRTTLN---QMRKCQ 1345
            Y + +PQ +   I+   +   L ++G+T     ++C  + RN  M T++++F+LNLA SDLLV + C P T+   I   W FG ++C+++G+ QG SV  S+ TL ++ ++R+  +V     + +   +     ++ IW+ +  I SP      V+E+    ++        P  +C E W  +  R K++TT++F   YL PL  ++I+Y ++G  L R+          P   R K Q+  +V+S                +Q+I K+L+I+ LLF + WLP      + D+   +++  N     ++  +N+Y+YP    LA+ N+++NP+     ++ FR       Q++ CQ
Sbjct:  139 YYLHQPQVAAIFIISYFLIFFLCMMGNT-----VVCFIVMRNKHMHTVTNLFILNLAISDLLVGIFCMPITLLDNIIAGWPFGNTMCKISGLVQGISVAASVFTLVAIAVDRFQCVVYPF--KPKLTIKTAFVIIMIIWVLAITIMSPSAVMLHVQEEKYYRVRLNSQNKTSPVYWCREDWPNQEMR-KIYTTVLFANIYLAPLSLIVIMYGRIGISLFRAA--------VPHTGR-KNQEQWHVVS--------------RKKQKIIKMLLIVALLFILSWLPLWTLMMLSDY---ADLSPN-----ELQIINIYIYPFAHWLAFGNSSVNPIIYGFFNENFRRGFQEAFQLQLCQ 456          
BLAST of Neuropeptide FF receptor 2 vs. Ensembl Human
Match: QRFPR (pyroglutamylated RFamide peptide receptor [Source:HGNC Symbol;Acc:HGNC:15565])

HSP 1 Score: 102.449 bits (254), Expect = 9.360e-23
Identity = 86/308 (27.92%), Postives = 158/308 (51.30%), Query Frame = 2
Query:  398 GNICVILCVTLFRNMRTISHVFLLNLACSDLLVFLICEPFTIASLINPDWIFGESLCRLNGVFQGTSVGVSILTLTSVCIERYIVIVGKGFNQNRFNFRHLICWVVGIWITSFLITSPL--LQAYEVKEKNLTFIKPTRYCMETWSGKNNRKKVFTTXXXXXXXXXXXXXXXXXYSKVGNHLRRSTNTLINIENKPSAKRLKTQDTNNVISTHSMSKLNSIKGINNTRQRISKLLMILTLLFAIFWLPYHVTSFIIDFIFGSNIDNNLESFSDVGWLNVYVYPMTQILAYVNNAINPLCTLIISKKFR 1315
            GN  V   VT  + MRT++++F+ +LA SDLL+   C P T+   I+ +W+ G  +C++    Q T+V   ILT+T + +ER+  +V     + ++  R     +  +W+ + ++ SP+  +Q  E+K  +  + K    C+E W+   + +K++TT I ++ +LLPL+ MLILYSK+G  L                KR+        I    MSK      I   ++R   +++ +  LFA+ W P+HV   +I++   SN +   + + DV      ++ + QI+ + N+  NP+    +++ F+
Sbjct:   62 GNALVFYVVTRSKAMRTVTNIFICSLALSDLLITFFCIPVTMLQNISDNWLGGAFICKMVPFVQSTAVVTEILTMTCIAVERHQGLVHPFKMKWQYTNRRAFTMLGVVWLVAVIVGSPMWHVQQLEIK-YDFLYEKEHICCLEEWTSPVH-QKIYTTFILVILFLLPLMVMLILYSKIGYELW-------------IKKRVGDGSVLRTIHGKEMSK------IARKKKRAVIMMVTVVALFAVCWAPFHVVHMMIEY---SNFE---KEYDDVTI--KMIFAIVQIIGFSNSICNPIVYAFMNENFK 340          
BLAST of Neuropeptide FF receptor 2 vs. Ensembl Human
Match: HCRTR1 (hypocretin receptor 1 [Source:HGNC Symbol;Acc:HGNC:4848])

HSP 1 Score: 92.8189 bits (229), Expect = 1.383e-19
Identity = 88/329 (26.75%), Postives = 153/329 (46.50%), Query Frame = 2
Query:  398 GNICVILCVTLFRNMRTISHVFLLNLACSDLLVFLICEPFTIASLINPDWIFGESLCRLNGVFQGTSVGVSILTLTSVCIERYIVIVGKGFNQNRFNFRHLICWVVGIWITSFLITSPLLQAYEVKEKNLTFIKPTRY---CMETWSGKNNRKKVFTTXXXXXXXXXXXXXXXXXYSKV-----GNHLRRSTNTLINIENKPSAKRLK-TQDTNNVISTHSMSKLNSIKGINNTRQRISKLLMILTLLFAIFWLPYHVTSFIIDFIFG-----SNIDNNLESFSDVGWLNVYVYPMTQILAYVNNAINPLCTLIISKKFRTTLNQMRKC 1342
            GN  V L V    +MRT+++ F++NL+ +D+LV  IC P ++   I   W+FG +LC++    Q  SV V++LTL+ + ++R+  I      ++    R     ++GIW  S  I  P     E           TR    C E W+  +   K++ +  FI+ YL PL  M + Y ++     G  +  +T+ L+    +PS +     Q  +      + + L  +K +   R++ +K+LM++ L+FA+ +LP  V + ++  +FG     S+ +     F+   W           L Y N+A NP+    +S KFR        C
Sbjct:   63 GNTLVCLAVWRNHHMRTVTNYFIVNLSLADVLVTAICLPASLLVDITESWLFGHALCKVIPYLQAVSVSVAVLTLSFIALDRWYAICHPLLFKS--TARRARGSILGIWAVSLAIMVPQAAVMECSSVLPELANRTRLFSVCDERWA-DDLYPKIYHSCFFIVTYLAPLGLMAMAYFQIFRKLWGRQIPGTTSALVRNWKRPSDQLGDLEQGLSGEPQPRARAFLAEVKQM-RARRKTAKMLMVVLLVFALCYLPISVLN-VLKRVFGMFRQASDREAVYACFTFSHW-----------LVYANSAANPIIYNFLSGKFREQFKAAFSC 375          
BLAST of Neuropeptide FF receptor 2 vs. Ensembl Celegans
Match: npr-6 (NeuroPeptide Receptor family [Source:UniProtKB/TrEMBL;Acc:Q20275])

HSP 1 Score: 100.138 bits (248), Expect = 1.582e-22
Identity = 93/327 (28.44%), Postives = 156/327 (47.71%), Query Frame = 2
Query:  389 GSTGNICVILCVTLFRNMRTISHVFLLNLACSDLLVFLICEPFTIASLINPDWIFGESLCRLNGVFQGTSVGVSILTLTSVCIERYIVIVGKGFNQN---RFNFRHLICWVVGIWITSFLITSPLLQAYEVKEKNLTFIKPTRY--CMETWSGKNNRKKVFTTXXXXXXXXXXXXXXXXXYSKVGNHL-RRSTNTLINIENKPSAKRLKTQDTNNVISTHSMSKLNSIKGINNTRQRISKLLMILTLLFAIFWLPYHVTSFIIDFIFGSNIDNNLESFSDVGWLNVYVYPMTQILAYVNNAINPLCTLIISKKFRTTLNQMRKCQFA 1351
             S+GN  V+  V   + M+TI+++F+ NLA SD++V       T        WIFG  LC    +FQGTS+ +S  TLT++ I+RYIVIV    N N   R + R  + ++V IW+ S L+ +P    Y +  K     +P  +  C E WS    R  +F  ++ IL ++LP + + I Y K+   L  R + T    E K   KR                           ++R+ ++L+++ ++FAI W P+++ + + D      +DN +  +    +L+V++  MT        A NP+    +++ FR    ++  C FA
Sbjct:   51 ASSGNFLVVYVVMTNKRMQTITNIFITNLAVSDIMVNFTSLWLTPTYTSIGHWIFGGGLCHGLPLFQGTSIFISTWTLTAIAIDRYIVIVHNSSNININDRMSMRSCLSFIVLIWLCSLLLVTP----YAINMKLNYIHEPCDFLICSEDWSNAEFR-SIFGIVVMILQFILPFVLIAISYIKIWLFLNSRQSMT----ERKSDIKR---------------------------KKRLLRMLIVMVVIFAICWFPFNLLNCLRDL----KLDNFMRGYFSFVFLSVHLMSMTA------TAWNPILYAFMNETFREEFAKVVPCLFA 331          
BLAST of Neuropeptide FF receptor 2 vs. Ensembl Celegans
Match: npr-4 (NeuroPeptide Receptor family [Source:UniProtKB/TrEMBL;Acc:A0A078BTK0])

HSP 1 Score: 86.6557 bits (213), Expect = 3.658e-18
Identity = 81/315 (25.71%), Postives = 150/315 (47.62%), Query Frame = 2
Query:  401 NICVILCVTLFRNMRTISHVFLLNLACSDLLVFLICEPFTIASLINPDWIFGESLCRLNGVFQGTSVGVSILTLTSVCIERYIVIVGKGFNQNRFNFRHLICWVVGIWITSFL------ITSPLLQAYEVKE-KNLTFIKPTRYCMETWSGKNNRKKVFTTXXXXXXXXXXXXXXXXXYSKVGNHLRRSTNTLINIENKPSAKRLKTQDTNNVISTHSMSKLNSIKGINNTRQRISKLLMILTLLFAIFWLPYHVTSFIIDFIFGSNIDNNLESFSDVGWLNVYVYPM-TQILAYVNNAINPLCTLIISKKFRTT 1321
            N CVIL +T  ++++T+ ++F+L+L+CSD++V       T  +    +WIFGE+LCR+     G S+  S  TLT++ I+RYI+I        RF  R  I     + + + +      ITSP++   ++ E +N       +YC E W    +++K++   +  L  ++PL  ++I Y+ +           + I      K  K Q T+N     S  +  ++K     RQR +++L+ + + FA  W+ + VT          NI  + E   ++     Y++ + T  +A  +   NPL   +++ + R  
Sbjct:   45 NSCVILAITRNKSLQTVPNLFILSLSCSDIVVCCTSATITPITAFKKEWIFGEALCRIAPFIAGISLCFSTFTLTAISIDRYILI--------RFPMRKPITHYQAVGVIAIICAFAATITSPIMFKQKLGEFENFC----GQYCTENWGANESQRKIYGAALMFLQLVIPLTIIIISYTAIS----------LKIGQSMILKGAKKQKTDNWEMELSDQQRIAVK----RRQRTNRMLIGMVVAFACSWI-WSVT---------FNILRDYEYLPELIKTQEYIFGIATHCIAMTSTVWNPLLYAVLNLQLRAA 323          
BLAST of Neuropeptide FF receptor 2 vs. Ensembl Celegans
Match: npr-4 (NeuroPeptide Receptor family [Source:UniProtKB/TrEMBL;Acc:A0A078BTK0])

HSP 1 Score: 86.6557 bits (213), Expect = 4.457e-18
Identity = 81/315 (25.71%), Postives = 150/315 (47.62%), Query Frame = 2
Query:  401 NICVILCVTLFRNMRTISHVFLLNLACSDLLVFLICEPFTIASLINPDWIFGESLCRLNGVFQGTSVGVSILTLTSVCIERYIVIVGKGFNQNRFNFRHLICWVVGIWITSFL------ITSPLLQAYEVKE-KNLTFIKPTRYCMETWSGKNNRKKVFTTXXXXXXXXXXXXXXXXXYSKVGNHLRRSTNTLINIENKPSAKRLKTQDTNNVISTHSMSKLNSIKGINNTRQRISKLLMILTLLFAIFWLPYHVTSFIIDFIFGSNIDNNLESFSDVGWLNVYVYPM-TQILAYVNNAINPLCTLIISKKFRTT 1321
            N CVIL +T  ++++T+ ++F+L+L+CSD++V       T  +    +WIFGE+LCR+     G S+  S  TLT++ I+RYI+I        RF  R  I     + + + +      ITSP++   ++ E +N       +YC E W    +++K++   +  L  ++PL  ++I Y+ +           + I      K  K Q T+N     S  +  ++K     RQR +++L+ + + FA  W+ + VT          NI  + E   ++     Y++ + T  +A  +   NPL   +++ + R  
Sbjct:   67 NSCVILAITRNKSLQTVPNLFILSLSCSDIVVCCTSATITPITAFKKEWIFGEALCRIAPFIAGISLCFSTFTLTAISIDRYILI--------RFPMRKPITHYQAVGVIAIICAFAATITSPIMFKQKLGEFENFC----GQYCTENWGANESQRKIYGAALMFLQLVIPLTIIIISYTAIS----------LKIGQSMILKGAKKQKTDNWEMELSDQQRIAVK----RRQRTNRMLIGMVVAFACSWI-WSVT---------FNILRDYEYLPELIKTQEYIFGIATHCIAMTSTVWNPLLYAVLNLQLRAA 345          
BLAST of Neuropeptide FF receptor 2 vs. Ensembl Celegans
Match: npr-4 (NeuroPeptide Receptor family [Source:UniProtKB/TrEMBL;Acc:A0A078BTK0])

HSP 1 Score: 87.0409 bits (214), Expect = 5.081e-18
Identity = 81/315 (25.71%), Postives = 150/315 (47.62%), Query Frame = 2
Query:  401 NICVILCVTLFRNMRTISHVFLLNLACSDLLVFLICEPFTIASLINPDWIFGESLCRLNGVFQGTSVGVSILTLTSVCIERYIVIVGKGFNQNRFNFRHLICWVVGIWITSFL------ITSPLLQAYEVKE-KNLTFIKPTRYCMETWSGKNNRKKVFTTXXXXXXXXXXXXXXXXXYSKVGNHLRRSTNTLINIENKPSAKRLKTQDTNNVISTHSMSKLNSIKGINNTRQRISKLLMILTLLFAIFWLPYHVTSFIIDFIFGSNIDNNLESFSDVGWLNVYVYPM-TQILAYVNNAINPLCTLIISKKFRTT 1321
            N CVIL +T  ++++T+ ++F+L+L+CSD++V       T  +    +WIFGE+LCR+     G S+  S  TLT++ I+RYI+I        RF  R  I     + + + +      ITSP++   ++ E +N       +YC E W    +++K++   +  L  ++PL  ++I Y+ +           + I      K  K Q T+N     S  +  ++K     RQR +++L+ + + FA  W+ + VT          NI  + E   ++     Y++ + T  +A  +   NPL   +++ + R  
Sbjct:   45 NSCVILAITRNKSLQTVPNLFILSLSCSDIVVCCTSATITPITAFKKEWIFGEALCRIAPFIAGISLCFSTFTLTAISIDRYILI--------RFPMRKPITHYQAVGVIAIICAFAATITSPIMFKQKLGEFENFC----GQYCTENWGANESQRKIYGAALMFLQLVIPLTIIIISYTAIS----------LKIGQSMILKGAKKQKTDNWEMELSDQQRIAVK----RRQRTNRMLIGMVVAFACSWI-WSVT---------FNILRDYEYLPELIKTQEYIFGIATHCIAMTSTVWNPLLYAVLNLQLRAA 323          
BLAST of Neuropeptide FF receptor 2 vs. Ensembl Celegans
Match: npr-4 (NeuroPeptide Receptor family [Source:UniProtKB/TrEMBL;Acc:A0A078BTK0])

HSP 1 Score: 87.0409 bits (214), Expect = 6.021e-18
Identity = 81/315 (25.71%), Postives = 150/315 (47.62%), Query Frame = 2
Query:  401 NICVILCVTLFRNMRTISHVFLLNLACSDLLVFLICEPFTIASLINPDWIFGESLCRLNGVFQGTSVGVSILTLTSVCIERYIVIVGKGFNQNRFNFRHLICWVVGIWITSFL------ITSPLLQAYEVKE-KNLTFIKPTRYCMETWSGKNNRKKVFTTXXXXXXXXXXXXXXXXXYSKVGNHLRRSTNTLINIENKPSAKRLKTQDTNNVISTHSMSKLNSIKGINNTRQRISKLLMILTLLFAIFWLPYHVTSFIIDFIFGSNIDNNLESFSDVGWLNVYVYPM-TQILAYVNNAINPLCTLIISKKFRTT 1321
            N CVIL +T  ++++T+ ++F+L+L+CSD++V       T  +    +WIFGE+LCR+     G S+  S  TLT++ I+RYI+I        RF  R  I     + + + +      ITSP++   ++ E +N       +YC E W    +++K++   +  L  ++PL  ++I Y+ +           + I      K  K Q T+N     S  +  ++K     RQR +++L+ + + FA  W+ + VT          NI  + E   ++     Y++ + T  +A  +   NPL   +++ + R  
Sbjct:   67 NSCVILAITRNKSLQTVPNLFILSLSCSDIVVCCTSATITPITAFKKEWIFGEALCRIAPFIAGISLCFSTFTLTAISIDRYILI--------RFPMRKPITHYQAVGVIAIICAFAATITSPIMFKQKLGEFENFC----GQYCTENWGANESQRKIYGAALMFLQLVIPLTIIIISYTAIS----------LKIGQSMILKGAKKQKTDNWEMELSDQQRIAVK----RRQRTNRMLIGMVVAFACSWI-WSVT---------FNILRDYEYLPELIKTQEYIFGIATHCIAMTSTVWNPLLYAVLNLQLRAA 345          
BLAST of Neuropeptide FF receptor 2 vs. Ensembl Fly
Match: TkR99D (gene:FBgn0004622 transcript:FBtr0301656)

HSP 1 Score: 85.5001 bits (210), Expect = 2.134e-17
Identity = 83/325 (25.54%), Postives = 151/325 (46.46%), Query Frame = 2
Query:  389 GSTGNICVILCVTLFRNMRTISHVFLLNLACSDLLVFLICEPFTIASLINPDWIFGESLCRLNGVFQGTSVGVSILTLTSVCIERYIVIVGKGFNQNRFNFRHLICWVVGIWITSFLITSPLLQAYEVKEKNLTFIKPTRYCMETW-SGKNNR---KKVFTTXXXXXXXXXXXXXXXXXYSKVGNHLRRSTNTLINIENKPSAKRLKTQDTNNVISTHSMSKLNSIKGINNTRQRISKLLMILTLLFAIFWLPYHVTSFIIDFIFGSNIDNNLESFSDVGWLNVYVYPMTQILAYVNNAINPLCTLIISKKFRTTLNQM-RKCQF 1348
             + GN+ V+  V   + MRT+++ F++NL+ +D +V  +   F    +++ DW FGE  C+L+      S+  S+ TL ++ I+RY+ I+     Q R + R  +     IW+ S LI+ P++  Y  +E  +  +     C   W  G  N    + ++  +I IL Y LP++ M + YS+VG          I +    +      +   NV                 +++R+ K+++++ L+FAI WLP+H + FII   + +  +     F    +L +Y       LA  N+  NP+    ++ +FR     + R C F
Sbjct:  115 ATGGNLIVVWIVMTTKRMRTVTNYFIVNLSIADAMVSSLNVTFNYYYMLDSDWPFGEFYCKLSQFIAMLSICASVFTLMAISIDRYVAIIRP--LQPRMSKRCNLAIAAVIWLASTLISCPMMIIYRTEEVPVRGLSNRTVCYPEWPDGPTNHSTMESLYNILIIILTYFLPIVSMTVTYSRVG----------IELWGSKTIGECTPRQVENV----------------RSKRRVVKMMIVVVLIFAICWLPFH-SYFIITSCYPAITE---APFIQELYLAIY------WLAMSNSMYNPIIYCWMNSRFRYGFKMVFRWCLF 401          
BLAST of Neuropeptide FF receptor 2 vs. Ensembl Fly
Match: TkR99D (gene:FBgn0004622 transcript:FBtr0085507)

HSP 1 Score: 85.5001 bits (210), Expect = 2.659e-17
Identity = 83/325 (25.54%), Postives = 151/325 (46.46%), Query Frame = 2
Query:  389 GSTGNICVILCVTLFRNMRTISHVFLLNLACSDLLVFLICEPFTIASLINPDWIFGESLCRLNGVFQGTSVGVSILTLTSVCIERYIVIVGKGFNQNRFNFRHLICWVVGIWITSFLITSPLLQAYEVKEKNLTFIKPTRYCMETW-SGKNNR---KKVFTTXXXXXXXXXXXXXXXXXYSKVGNHLRRSTNTLINIENKPSAKRLKTQDTNNVISTHSMSKLNSIKGINNTRQRISKLLMILTLLFAIFWLPYHVTSFIIDFIFGSNIDNNLESFSDVGWLNVYVYPMTQILAYVNNAINPLCTLIISKKFRTTLNQM-RKCQF 1348
             + GN+ V+  V   + MRT+++ F++NL+ +D +V  +   F    +++ DW FGE  C+L+      S+  S+ TL ++ I+RY+ I+     Q R + R  +     IW+ S LI+ P++  Y  +E  +  +     C   W  G  N    + ++  +I IL Y LP++ M + YS+VG          I +    +      +   NV                 +++R+ K+++++ L+FAI WLP+H + FII   + +  +     F    +L +Y       LA  N+  NP+    ++ +FR     + R C F
Sbjct:  115 ATGGNLIVVWIVMTTKRMRTVTNYFIVNLSIADAMVSSLNVTFNYYYMLDSDWPFGEFYCKLSQFIAMLSICASVFTLMAISIDRYVAIIRP--LQPRMSKRCNLAIAAVIWLASTLISCPMMIIYRTEEVPVRGLSNRTVCYPEWPDGPTNHSTMESLYNILIIILTYFLPIVSMTVTYSRVG----------IELWGSKTIGECTPRQVENV----------------RSKRRVVKMMIVVVLIFAICWLPFH-SYFIITSCYPAITE---APFIQELYLAIY------WLAMSNSMYNPIIYCWMNSRFRYGFKMVFRWCLF 401          
BLAST of Neuropeptide FF receptor 2 vs. Ensembl Fly
Match: TkR99D (gene:FBgn0004622 transcript:FBtr0330298)

HSP 1 Score: 85.5001 bits (210), Expect = 2.854e-17
Identity = 83/325 (25.54%), Postives = 151/325 (46.46%), Query Frame = 2
Query:  389 GSTGNICVILCVTLFRNMRTISHVFLLNLACSDLLVFLICEPFTIASLINPDWIFGESLCRLNGVFQGTSVGVSILTLTSVCIERYIVIVGKGFNQNRFNFRHLICWVVGIWITSFLITSPLLQAYEVKEKNLTFIKPTRYCMETW-SGKNNR---KKVFTTXXXXXXXXXXXXXXXXXYSKVGNHLRRSTNTLINIENKPSAKRLKTQDTNNVISTHSMSKLNSIKGINNTRQRISKLLMILTLLFAIFWLPYHVTSFIIDFIFGSNIDNNLESFSDVGWLNVYVYPMTQILAYVNNAINPLCTLIISKKFRTTLNQM-RKCQF 1348
             + GN+ V+  V   + MRT+++ F++NL+ +D +V  +   F    +++ DW FGE  C+L+      S+  S+ TL ++ I+RY+ I+     Q R + R  +     IW+ S LI+ P++  Y  +E  +  +     C   W  G  N    + ++  +I IL Y LP++ M + YS+VG          I +    +      +   NV                 +++R+ K+++++ L+FAI WLP+H + FII   + +  +     F    +L +Y       LA  N+  NP+    ++ +FR     + R C F
Sbjct:  115 ATGGNLIVVWIVMTTKRMRTVTNYFIVNLSIADAMVSSLNVTFNYYYMLDSDWPFGEFYCKLSQFIAMLSICASVFTLMAISIDRYVAIIRPL--QPRMSKRCNLAIAAVIWLASTLISCPMMIIYRTEEVPVRGLSNRTVCYPEWPDGPTNHSTMESLYNILIIILTYFLPIVSMTVTYSRVG----------IELWGSKTIGECTPRQVENV----------------RSKRRVVKMMIVVVLIFAICWLPFH-SYFIITSCYPAITE---APFIQELYLAIY------WLAMSNSMYNPIIYCWMNSRFRYGFKMVFRWCLF 401          
BLAST of Neuropeptide FF receptor 2 vs. Ensembl Fly
Match: CCHa1-R (gene:FBgn0050106 transcript:FBtr0086893)

HSP 1 Score: 82.0333 bits (201), Expect = 2.702e-16
Identity = 84/337 (24.93%), Postives = 139/337 (41.25%), Query Frame = 2
Query:  389 GSTGNICVILCVTLFRNMRTISHVFLLNLACSDLLVFLICEPFTIASLINPDWIFGESLCRLNGVFQGTSVGVSILTLTSVCIERYIVIVG-----KGFNQNRFNFRHLICWVVGIWITSFLITSPLLQAYEVK-----EKNLTFIKPTRYCMETWSGKNNRKKVFTTXXXXXXXXXXXXXXXXXYSKVGNHLRRSTNTLINIENKPSAKRLKTQDTNNVISTHSMSKLNSIKGINNTRQRISKLLMILTLLFAIFWLPYHVTSFIIDFIFGSNIDNNLESFSDVGWLNVYVYPMTQILAYVNNAINPLCTLIISKKFRTTLNQMRKCQFASSSNSK 1369
            G  GN  +I+     R MR + + ++L+LA +DLLV +   P          W +G  LC L+   +  S+GVS+ TLT++  +RY  IV            R   R  +   V IW+ + L   P L    +K     EK++    P     E W    N  K    + F+++Y +PL+ + + Y  +  HL  S +    I+      R                           R++++  ++   ++F I +LPYHV  F + F F     ++  +F  V  L +  Y M+    + N+  NP+    +S  FR   N+   C+ AS    K
Sbjct:   95 GVLGNGTLIVVFLSVRQMRNVPNTYILSLALADLLVIITTVPLASTVYTVEYWPYGSFLCSLSEFMKDVSIGVSVFTLTALSGDRYFAIVDPLRKFHAHGGGRRATRMTLATAVSIWLLAILCGLPALIGSNLKHLGINEKSIVICYPYP---EEWG--INYAKSMVLLHFLVYYAIPLVVIAVFYVLIALHLMYSASVPGEIQGAVRQVR--------------------------ARRKVAVTVLAFVVIFGICFLPYHV--FFLWFYFWPTAQDDYNAFWHV--LRIVAYCMS----FANSCANPVALYFVSGAFRKHFNRYLFCRGASGRRKK 392          
BLAST of Neuropeptide FF receptor 2 vs. Ensembl Fly
Match: SIFaR (gene:FBgn0038880 transcript:FBtr0084098)

HSP 1 Score: 81.2629 bits (199), Expect = 7.694e-16
Identity = 84/317 (26.50%), Postives = 139/317 (43.85%), Query Frame = 2
Query:  389 GSTGNICVILCVTLFRNMRTISHVFLLNLACSDLLVFLICEPFTIASLINPDWIFGESLCRLNGVFQGTSVGVSILTLTSVCIERYIVIVGKGFNQNRFNFRHLICWVVGIWITSFLITSP------LLQAYEVKEKNL--TFIKPTRYCMETWSGKNNRKKVFTTXXXXXXXXXXXXXXXXXYSKVGNHLRRSTNTLINIENKPSAKRLKTQDTNNVISTHSMSKLNSIKGINNTRQRISKLLMILTLLFAIFWLPYHVTSFIIDFIFGSNIDNNLESFSDVGWLNVYVYPMTQILAYVNNAINPLCTLIISKKFR 1315
            G  GN  VI  V     MRT+++ F++NLA +D+LV + C P T+   I   W+ G  +C+     QG SV  S+ +L +V ++R+I I    +   +   R     ++GIW+ + + T P      L+ A EV    L   + +P   C E W    +    F     +  YLLP+  + + Y  +   ++ ST ++          R++ +    VI                      K+L+ + +LF + WLP +V        FGS+I    E F     +   V P+ Q L   N+ INP+    ++KK+R
Sbjct:  222 GLIGNSFVIAVVLRAPRMRTVTNYFIVNLAIADILVIVFCLPATLIGNIFVPWMLGWLMCKFVPYIQGVSVAASVYSLIAVSLDRFIAI---WWPLKQMTKRRARIMIIGIWVIALVTTIPWLLFFDLVPAEEVFSDALVSAYSQPQFLCQEVWPPGTDGNLYFLLANLVACYLLPMSLITLCYVLI--WIKVSTRSIPGESKDAQMDRMQQKSKVKVI----------------------KMLVAVVILFVLSWLPLYV--IFARIKFGSDISQ--EEFE----ILKKVMPVAQWLGSSNSCINPIL-YSVNKKYR 502          
BLAST of Neuropeptide FF receptor 2 vs. Ensembl Zebrafish
Match: CU915819.2 (neuropeptide FF receptor 2a [Source:NCBI gene;Acc:560955])

HSP 1 Score: 117.857 bits (294), Expect = 2.552e-28
Identity = 95/323 (29.41%), Postives = 162/323 (50.15%), Query Frame = 2
Query:  398 GNICVILCVTLFRNMRTISHVFLLNLACSDLLVFLICEPFTIASLINPDWIFGESLCRLNGVFQGTSVGVSILTLTSVCIERYIVIVGKGFNQNRFNFRHLICWVVGIWITSFLITSP---LLQAYEVKEKNLTFIK------PTRYCMETWSGKNNRKKVFTTXXXXXXXXXXXXXXXXXYSKVGNHLRRSTNTLINIENKPSAKRLKTQDTNNVISTHSMSKLNSIKGINNTRQRISKLLMILTLLFAIFWLPYHVTSFIIDFIFGSNIDNNLESFSDVGWLNVYVYPMTQILAYVNNAINPLCTLIISKKFRTTLNQMRK 1339
            GN  V   V   +NMRT++++F+LNLA SDLLV + C P T+   I   W FG  +C+++G+ QG SV  S+ TL ++ ++R+  IV   F Q +         +V IW+ +  I  P   +LQ    KE+N+   +      P  +C E W  +  R K++TT++F   YL PL  ++I+Y+++G  L ++          P+  +    +       HS+SK          +QR+ K+L+I+ LLF + WLP      + D++  +     +        +N+Y+YP    LA+ N+++NP+     ++ FR     + K
Sbjct:   63 GNGVVCFIVLRSKNMRTVTNLFILNLAISDLLVGIFCMPTTLLDNIITGWPFGSMVCKMSGMVQGISVSASVFTLVAIAVDRFRCIV-YPFKQ-KLTISTATFIIVIIWVLAVSIMCPSGVMLQV--TKEQNIRVFRGNNRSSPFYWCRENWPNQEMR-KIYTTVLFANIYLAPLSLIVIMYARIGITLFKTA--------MPAGGKHGHDN------RHSVSK---------KKQRVIKMLLIVALLFILSWLPLWTLMMLTDYVKLTEHQYRV--------INIYIYPFAHWLAFFNSSVNPIIYGFFNENFRRGFQAIFK 349          
BLAST of Neuropeptide FF receptor 2 vs. Ensembl Zebrafish
Match: AL929374.1 (neuropeptide FF receptor 2a [Source:NCBI gene;Acc:560955])

HSP 1 Score: 117.857 bits (294), Expect = 2.552e-28
Identity = 95/323 (29.41%), Postives = 162/323 (50.15%), Query Frame = 2
Query:  398 GNICVILCVTLFRNMRTISHVFLLNLACSDLLVFLICEPFTIASLINPDWIFGESLCRLNGVFQGTSVGVSILTLTSVCIERYIVIVGKGFNQNRFNFRHLICWVVGIWITSFLITSP---LLQAYEVKEKNLTFIK------PTRYCMETWSGKNNRKKVFTTXXXXXXXXXXXXXXXXXYSKVGNHLRRSTNTLINIENKPSAKRLKTQDTNNVISTHSMSKLNSIKGINNTRQRISKLLMILTLLFAIFWLPYHVTSFIIDFIFGSNIDNNLESFSDVGWLNVYVYPMTQILAYVNNAINPLCTLIISKKFRTTLNQMRK 1339
            GN  V   V   +NMRT++++F+LNLA SDLLV + C P T+   I   W FG  +C+++G+ QG SV  S+ TL ++ ++R+  IV   F Q +         +V IW+ +  I  P   +LQ    KE+N+   +      P  +C E W  +  R K++TT++F   YL PL  ++I+Y+++G  L ++          P+  +    +       HS+SK          +QR+ K+L+I+ LLF + WLP      + D++  +     +        +N+Y+YP    LA+ N+++NP+     ++ FR     + K
Sbjct:   63 GNGVVCFIVLRSKNMRTVTNLFILNLAISDLLVGIFCMPTTLLDNIITGWPFGSMVCKMSGMVQGISVSASVFTLVAIAVDRFRCIV-YPFKQ-KLTISTATFIIVIIWVLAVSIMCPSGVMLQV--TKEQNIRVFRGNNRSSPFYWCRENWPNQEMR-KIYTTVLFANIYLAPLSLIVIMYARIGITLFKTA--------MPAGGKHGHDN------RHSVSK---------KKQRVIKMLLIVALLFILSWLPLWTLMMLTDYVKLTEHQYRV--------INIYIYPFAHWLAFFNSSVNPIIYGFFNENFRRGFQAIFK 349          
BLAST of Neuropeptide FF receptor 2 vs. Ensembl Zebrafish
Match: NPFFR2 (neuropeptide FF receptor 2a [Source:NCBI gene;Acc:560955])

HSP 1 Score: 117.857 bits (294), Expect = 2.552e-28
Identity = 95/323 (29.41%), Postives = 162/323 (50.15%), Query Frame = 2
Query:  398 GNICVILCVTLFRNMRTISHVFLLNLACSDLLVFLICEPFTIASLINPDWIFGESLCRLNGVFQGTSVGVSILTLTSVCIERYIVIVGKGFNQNRFNFRHLICWVVGIWITSFLITSP---LLQAYEVKEKNLTFIK------PTRYCMETWSGKNNRKKVFTTXXXXXXXXXXXXXXXXXYSKVGNHLRRSTNTLINIENKPSAKRLKTQDTNNVISTHSMSKLNSIKGINNTRQRISKLLMILTLLFAIFWLPYHVTSFIIDFIFGSNIDNNLESFSDVGWLNVYVYPMTQILAYVNNAINPLCTLIISKKFRTTLNQMRK 1339
            GN  V   V   +NMRT++++F+LNLA SDLLV + C P T+   I   W FG  +C+++G+ QG SV  S+ TL ++ ++R+  IV   F Q +         +V IW+ +  I  P   +LQ    KE+N+   +      P  +C E W  +  R K++TT++F   YL PL  ++I+Y+++G  L ++          P+  +    +       HS+SK          +QR+ K+L+I+ LLF + WLP      + D++  +     +        +N+Y+YP    LA+ N+++NP+     ++ FR     + K
Sbjct:   63 GNGVVCFIVLRSKNMRTVTNLFILNLAISDLLVGIFCMPTTLLDNIITGWPFGSMVCKMSGMVQGISVSASVFTLVAIAVDRFRCIV-YPFKQ-KLTISTATFIIVIIWVLAVSIMCPSGVMLQV--TKEQNIRVFRGNNRSSPFYWCRENWPNQEMR-KIYTTVLFANIYLAPLSLIVIMYARIGITLFKTA--------MPAGGKHGHDN------RHSVSK---------KKQRVIKMLLIVALLFILSWLPLWTLMMLTDYVKLTEHQYRV--------INIYIYPFAHWLAFFNSSVNPIIYGFFNENFRRGFQAIFK 349          
BLAST of Neuropeptide FF receptor 2 vs. Ensembl Zebrafish
Match: NPFFR2 (neuropeptide FF receptor 2a [Source:NCBI gene;Acc:560955])

HSP 1 Score: 117.857 bits (294), Expect = 2.552e-28
Identity = 95/323 (29.41%), Postives = 162/323 (50.15%), Query Frame = 2
Query:  398 GNICVILCVTLFRNMRTISHVFLLNLACSDLLVFLICEPFTIASLINPDWIFGESLCRLNGVFQGTSVGVSILTLTSVCIERYIVIVGKGFNQNRFNFRHLICWVVGIWITSFLITSP---LLQAYEVKEKNLTFIK------PTRYCMETWSGKNNRKKVFTTXXXXXXXXXXXXXXXXXYSKVGNHLRRSTNTLINIENKPSAKRLKTQDTNNVISTHSMSKLNSIKGINNTRQRISKLLMILTLLFAIFWLPYHVTSFIIDFIFGSNIDNNLESFSDVGWLNVYVYPMTQILAYVNNAINPLCTLIISKKFRTTLNQMRK 1339
            GN  V   V   +NMRT++++F+LNLA SDLLV + C P T+   I   W FG  +C+++G+ QG SV  S+ TL ++ ++R+  IV   F Q +         +V IW+ +  I  P   +LQ    KE+N+   +      P  +C E W  +  R K++TT++F   YL PL  ++I+Y+++G  L ++          P+  +    +       HS+SK          +QR+ K+L+I+ LLF + WLP      + D++  +     +        +N+Y+YP    LA+ N+++NP+     ++ FR     + K
Sbjct:   63 GNGVVCFIVLRSKNMRTVTNLFILNLAISDLLVGIFCMPTTLLDNIITGWPFGSMVCKMSGMVQGISVSASVFTLVAIAVDRFRCIV-YPFKQ-KLTISTATFIIVIIWVLAVSIMCPSGVMLQV--TKEQNIRVFRGNNRSSPFYWCRENWPNQEMR-KIYTTVLFANIYLAPLSLIVIMYARIGITLFKTA--------MPAGGKHGHDN------RHSVSK---------KKQRVIKMLLIVALLFILSWLPLWTLMMLTDYVKLTEHQYRV--------INIYIYPFAHWLAFFNSSVNPIIYGFFNENFRRGFQAIFK 349          
BLAST of Neuropeptide FF receptor 2 vs. Ensembl Zebrafish
Match: npffr2b (neuropeptide FF receptor 2b [Source:ZFIN;Acc:ZDB-GENE-070705-159])

HSP 1 Score: 110.923 bits (276), Expect = 2.311e-26
Identity = 91/326 (27.91%), Postives = 164/326 (50.31%), Query Frame = 2
Query:  398 GNICVILCVTLFRNMRTISHVFLLNLACSDLLVFLICEPFTIASLINPDWIFGESLCRLNGVFQGTSVGVSILTLTSVCIERYIVIVGKGFNQNRFNFRHLICWVVGIWITSFLITSP---LLQAYEVKEKNLTFI-------KPTRYCMETWSGKNNRKKVFTTXXXXXXXXXXXXXXXXXYSKVGNHLRRSTNTLINIENKPSAKRLKTQDTNNVISTHSMSKLNSIKGINNTRQRISKLLMILTLLFAIFWLPYHVTSFIIDFIFGSNIDNNLESFSDVGWLNVYVYPMTQILAYVNNAINPLCTLIISKKFRTTLNQMRKCQ 1345
            GN  V   V   +NMRT++++F+LNLA SDLLV + C P T+   I   W FG  +C+L+G+ QG SV  S+ TL ++ ++R+  IV   F Q +         ++ IW+ +  I  P   +LQ    KE  ++ +       +P  +C E W  +  R K++TT++F   YL PL  ++I+Y+++G  L +++           A   +   + +   +    +  S + ++  ++R+ K+L+++ LLF + WLP      + D+   S   + +        +N+Y YP+   LA+ N+++NP+     ++ FR       K Q
Sbjct:   32 GNGVVCFIVLRSKNMRTVTNLFILNLAISDLLVGIFCMPTTLVDNIITGWPFGSLVCKLSGMVQGISVSASVFTLVAIAVDRFRCIV-YPFKQ-KLTISTSTLIIIIIWVLAISIMCPSGVMLQV--TKEHRVSILLSDGNTTQPFYWCRENWPNQEMR-KIYTTVLFANIYLAPLTLIVIMYARIGITLFKTSM---------PAPVSQVGTSGSGSGSGKQCRYESRQLVSRKKKRVIKMLLVVALLFILSWLPLWALMMLSDYASLSERQHRV--------INIYFYPLAHWLAFCNSSVNPIIYGFFNENFRKGFKAAFKLQ 335          
BLAST of Neuropeptide FF receptor 2 vs. Ensembl Xenopus
Match: clstn2 (calsyntenin 2 [Source:Xenbase;Acc:XB-GENE-958942])

HSP 1 Score: 114.005 bits (284), Expect = 1.081e-26
Identity = 92/326 (28.22%), Postives = 158/326 (48.47%), Query Frame = 2
Query:  398 GNICVILCVTLFRNMRTISHVFLLNLACSDLLVFLICEPFTIASLINPDWIFGESLCRLNGVFQGTSVGVSILTLTSVCIERYIVIVGKGFNQNRFNFRHLICWVVGIWITSFLITSPLLQAYEVKEKNLTFI-------KPTRYCMETWSGKNNRKKVFTTXXXXXXXXXXXXXXXXXYSKVGNHLRRSTNTLINIENKPSAKRLKTQDTNNVISTHSMSKLNSIKGINNTRQRISKLLMILTLLFAIFWLPYHVTSFIIDFIFGSNIDNNLESFSDVGWLNVYVYPMTQILAYVNNAINPLCTLIISKKFRTTLNQMRKCQFAS 1354
            GN+ V   V   R MRT++++F+LNLA SDLLV + C P T+   +   W F   +C+++G+ QG SV  S+ TL ++ +ER+  IV   F Q +   R  I  ++ IW+ + +I  P      V + +  F+        P   C E W     R K++TT++F   YL PL  ++I+Y+++   L +S+  +                        S+S+ N  + ++  + R+  +L+I+ L F++ WLP      + D+   S+   NL        + VYV+P    LA+ N+++NP+     ++ FR    +  K Q  S
Sbjct:   54 GNMLVCFIVLKNRQMRTVTNMFILNLAISDLLVGIFCMPTTLVDNLITGWPFDNIMCKMSGLVQGMSVSASVFTLVAIAVERFRCIV-YPFRQ-KLTLRKAIITIIIIWVLALIIMCPSAVTLTVTKDDFHFMVDDYNNYYPLYSCWEEWPDTEMR-KIYTTVLFSHIYLAPLTLIVIMYARIAFKLFKSSAPI----------------------RGSVSEENEGRRVSKRKVRVIYMLIIVALFFSLSWLPLWTLMLLTDYGHLSDYQLNL--------IAVYVFPFAHWLAFFNSSVNPIIYGYFNENFRRGFQEAFKVQVCS 346          
BLAST of Neuropeptide FF receptor 2 vs. Ensembl Xenopus
Match: clstn2 (calsyntenin 2 [Source:Xenbase;Acc:XB-GENE-958942])

HSP 1 Score: 113.62 bits (283), Expect = 1.373e-26
Identity = 92/326 (28.22%), Postives = 158/326 (48.47%), Query Frame = 2
Query:  398 GNICVILCVTLFRNMRTISHVFLLNLACSDLLVFLICEPFTIASLINPDWIFGESLCRLNGVFQGTSVGVSILTLTSVCIERYIVIVGKGFNQNRFNFRHLICWVVGIWITSFLITSPLLQAYEVKEKNLTFI-------KPTRYCMETWSGKNNRKKVFTTXXXXXXXXXXXXXXXXXYSKVGNHLRRSTNTLINIENKPSAKRLKTQDTNNVISTHSMSKLNSIKGINNTRQRISKLLMILTLLFAIFWLPYHVTSFIIDFIFGSNIDNNLESFSDVGWLNVYVYPMTQILAYVNNAINPLCTLIISKKFRTTLNQMRKCQFAS 1354
            GN+ V   V   R MRT++++F+LNLA SDLLV + C P T+   +   W F   +C+++G+ QG SV  S+ TL ++ +ER+  IV   F Q +   R  I  ++ IW+ + +I  P      V + +  F+        P   C E W     R K++TT++F   YL PL  ++I+Y+++   L +S+  +                        S+S+ N  + ++  + R+  +L+I+ L F++ WLP      + D+   S+   NL        + VYV+P    LA+ N+++NP+     ++ FR    +  K Q  S
Sbjct:   55 GNMLVCFIVLKNRQMRTVTNMFILNLAISDLLVGIFCMPTTLVDNLITGWPFDNIMCKMSGLVQGMSVSASVFTLVAIAVERFRCIV-YPFRQ-KLTLRKAIITIIIIWVLALIIMCPSAVTLTVTKDDFHFMVDDYNNYYPLYSCWEEWPDTEMR-KIYTTVLFSHIYLAPLTLIVIMYARIAFKLFKSSAPI----------------------RGSVSEENEGRRVSKRKVRVIYMLIIVALFFSLSWLPLWTLMLLTDYGHLSDYQLNL--------IAVYVFPFAHWLAFFNSSVNPIIYGYFNENFRRGFQEAFKVQVCS 347          
BLAST of Neuropeptide FF receptor 2 vs. Ensembl Xenopus
Match: NPFFR2 (neuropeptide FF receptor 2 [Source:NCBI gene;Acc:100498122])

HSP 1 Score: 106.301 bits (264), Expect = 3.288e-24
Identity = 103/341 (30.21%), Postives = 171/341 (50.15%), Query Frame = 2
Query:  398 GNICVILCVTLFRNMRTISHVFLLNLACSDLLVFLICEPFTIASLINPDWIFGESLCRLNGVFQGTSVGVSILTLTSVCIERYIVIVGKGFNQNRFNFRHLICWVVGIWITSFLITSPLLQAYEVKE-KNLTFI-------KPTRYCMETWSGKNNRKKVFTTXXXXXXXXXXXXXXXXXYSKVGNHLRRSTNTLINIENKPSAKRLKTQDTNNVISTHSMSKLNSIKGINNTRQRISKLLMILTLLFAIFWLPYHVTSFIIDFIFGSNIDNNLESFSDVGWLNVYVYPMTQILAYVNNAINPLCTLIISKKFRTTLNQMRKCQFASSSNSKLTKTLYYSQ 1396
            GN  V   V   ++MRT++++F+LNLA SDLLV + C P T+   I   W FG ++C+++G+ QG SV  S+ TL ++ ++R+  IV   F Q +      +  +V IW+ +  I  P      VKE KN   +        P  +C E W     R K++TT++F   YL PL  ++I+Y+++G  L +S    +N+ENK           N+    H++S+          +Q++ K+L+I+ LLF + WLP      + D+   +N+  N         +N+Y+YP    LA+ N++INP+     ++ FR       K Q  S    + T   + +Q
Sbjct:   59 GNGVVCFIVLSSKHMRTVTNLFILNLAISDLLVGIFCMPTTLLDNIIAGWPFGSTVCKMSGMVQGISVSASVFTLVAIAVDRFRCIV-YPFKQ-KLTISTAVVIIVVIWVLAIAIMCPSAVMSHVKEDKNFRVVIGNSNQTNPIYWCREDWPNPEMR-KIYTTVLFSNIYLAPLSLIVIMYARIGITLFKSE---LNVENK-----------NHQQPRHAVSR---------RKQKVIKMLIIIALLFILSWLPLWTLMMLTDY---ANLTQN-----QYQMINIYIYPFAHWLAFFNSSINPIIYGFFNENFRRGFQAAFKLQLCSEELERRTMYSHRAQ 365          
BLAST of Neuropeptide FF receptor 2 vs. Ensembl Xenopus
Match: slc11a2 (solute carrier family 11 member 2 [Source:Xenbase;Acc:XB-GENE-487563])

HSP 1 Score: 105.916 bits (263), Expect = 6.032e-24
Identity = 86/308 (27.92%), Postives = 161/308 (52.27%), Query Frame = 2
Query:  398 GNICVILCVTLFRNMRTISHVFLLNLACSDLLVFLICEPFTIASLINPDWIFGESLCRLNGVFQGTSVGVSILTLTSVCIERYIVIVGKGFNQNRFNFRHLICWVVGIWITSFLITSPLLQAYEVKEKNLTFIKPTRY--CMETWSGKNNRKKVFTTXXXXXXXXXXXXXXXXXYSKVGNHLRRSTNTLINIENKPSAKRLKTQDTNNVISTHSMSKLNSIKGINNTRQRISKLLMILTLLFAIFWLPYHVTSFIIDFIFGSNIDNNLESFSDVGWLNVYVYPMTQILAYVNNAINPLCTLIISKKFR 1315
            GN  V+  VT  + MRT++++F+ +LA SDLL+   C PFT+   I+ +W+ G   C++    Q T++   ILT+T + +ER+  IV     + ++  R     +  +W+ + ++  P+  A  ++ K   F+   +Y  C+E W+ + + +K++TT I ++ +LLPL  ML+LYSK+G  L                KR+        I    MSK      I   ++R   +++ + +LFA+ W P+HV   +I++   SN +N    + DV  + + ++ + QI+ + N+  NP+    +++ F+
Sbjct:   96 GNSLVLYVVTRSKAMRTVTNIFICSLALSDLLIAFFCIPFTMLQNISSNWLGGAFACKMVPFVQSTAIVTEILTMTCIAVERHQGIVHPLKMKWQYTNRRAFTMLGIVWLIAAVVGIPMWHAQRLEVK-YDFLYEKQYVCCLEAWNSQVH-QKIYTTFILVILFLLPLTVMLLLYSKIGYELW-------------IKKRVGDASVLQTIHGSEMSK------IARKKKRAIIMMITVVVLFAVCWAPFHVVHMMIEY---SNFENE---YDDVT-IKI-IFAIVQIIGFFNSICNPIVYAFMNENFK 374          
BLAST of Neuropeptide FF receptor 2 vs. Ensembl Xenopus
Match: kiss1r (KISS1 receptor [Source:NCBI gene;Acc:100316929])

HSP 1 Score: 98.9821 bits (245), Expect = 5.458e-22
Identity = 85/315 (26.98%), Postives = 151/315 (47.94%), Query Frame = 2
Query:  389 GSTGNICVILCVTLFRNMRTISHVFLLNLACSDLLVFLICEPFTIASLINPDWIFGESLCRLNGVFQGTSVGVSILTLTSVCIERYIVIVGKGFNQNRFNFRHLICWVVGIWITSFLITSPLLQAYEVKEKNLTFIKPTRYCMETWSGKNNRKKVFTTXXXXXXXXXXXXXXXXXYSKVGNHLRRSTNTLINIENKPSAKRLKTQDTNNVISTHSMSKLNSIKGINNTRQRISKLLMILTLLFAIFWLPYHVTSFIIDFIFGSNIDNNLESFSDVGWLNVYVYPMTQILAYVNNAINPLCTLIISKKFRTTLNQM 1333
            G TGN  VI  ++  + MRT+++ ++ NLA +D++  + C PFT A    P WIFGE +C+     Q  SV  + +TLT++ ++R+ V V    +  +   R      VGIWI SF+++ P+    ++ E    +  P  YC E++   ++ +K F    F++ YLLPLI + I YS +   + R           PS + +       +++  S             R +IS+++ ++ LLF I W P  +  +I+   F  +   +  ++    W N         ++Y N++INP+    +   FR   N++
Sbjct:   56 GLTGNSLVIYVISKHKQMRTVTNFYIANLAATDIIFLVSCVPFTAALYPLPGWIFGEFMCKFVNYIQQVSVQATCVTLTAMSVDRWYVTVYPLQSLRQRTPRVAAAVSVGIWIGSFIVSIPVPIYNQLIEG--YWFGPQIYCSESFPSVSH-EKAFILYNFLVVYLLPLITICICYSAMVYQMGR-----------PSVEPVDNSYQVQLLAERS----------ELMRTKISRMVAVIVLLFTICWGPIQL--YILFQAFSPSFKRDYYTYKVKIWANC--------MSYTNSSINPIVYAFMGANFRKAFNKV 336          
BLAST of Neuropeptide FF receptor 2 vs. Ensembl Mouse
Match: Npffr2 (neuropeptide FF receptor 2 [Source:MGI Symbol;Acc:MGI:1860130])

HSP 1 Score: 109.768 bits (273), Expect = 1.498e-25
Identity = 83/326 (25.46%), Postives = 160/326 (49.08%), Query Frame = 2
Query:  398 GNICVILCVTLFRNMRTISHVFLLNLACSDLLVFLICEPFTIASLINPDWIFGESLCRLNGVFQGTSVGVSILTLTSVCIERYIVIVGKGFNQNRFNFRHLICWVVGIWITSFLITSPLLQAYEVKEKNLTFIKPTR--------YCMETWSGKNNRKKVFTTXXXXXXXXXXXXXXXXXYSKVGNHLRRSTNTLINIENKPSAKRLKTQDTNNVISTHSMSKLNSIK-GINNTRQRISKLLMILTLLFAIFWLPYHVTSFIIDFIFGSNIDNNLESFSDVGWLNVYVYPMTQILAYVNNAINPLCTLIISKKFRTTL-NQMRKCQ 1345
            GN  V   V   R+M T+++ F+LNLA SDLLV + C P T+   I   W FG S+C+++G+ QG SV  S+ TL ++ ++R+  +V     + +   +     +V IW  +  I +P      V+E+    ++ +         +C E W  ++  ++++TT++F   YL PL  ++I+Y+++G  L ++                         + H   K   ++  ++  +Q++ K+L+ + LLF + WLP      + D+   +++  N      +  +N+Y+YP    LA+ N+++NP+     ++ FR    +  + CQ
Sbjct:   62 GNTVVCFIVIRNRHMHTVTNFFILNLAISDLLVGIFCMPITLLDNIIAGWPFGSSMCKISGLVQGISVAASVFTLVAIAVDRFRCVVYPF--KPKLTVKTAFVTIVIIWGLAIAIMTPSAIMLHVQEEKYYRVRLSSHNKTSTVYWCREDWP-RHEMRRIYTTVLFATIYLAPLSLIVIMYARIGASLFKT-------------------------AAHCTGKQRPVQWHVSKKKQKVIKMLLTVALLFILSWLPLWTLMMLSDY---TDLSPN-----KLRIINIYIYPFAHWLAFCNSSVNPIIYGFFNENFRNGFQDAFQICQ 351          
BLAST of Neuropeptide FF receptor 2 vs. Ensembl Mouse
Match: Qrfprl (pyroglutamylated RFamide peptide receptor like [Source:MGI Symbol;Acc:MGI:2441881])

HSP 1 Score: 98.5969 bits (244), Expect = 1.025e-21
Identity = 78/308 (25.32%), Postives = 155/308 (50.32%), Query Frame = 2
Query:  398 GNICVILCVTLFRNMRTISHVFLLNLACSDLLVFLICEPFTIASLINPDWIFGESLCRLNGVFQGTSVGVSILTLTSVCIERYIVIVGKGFNQNRFNFRHLICWVVGIWITSFLITSPL--LQAYEVKEKNLTFIKPTRYCMETWSGKNNRKKVFTTXXXXXXXXXXXXXXXXXYSKVGNHLRRSTNTLINIENKPSAKRLKTQDTNNVISTHSMSKLNSIKGINNTRQRISKLLMILTLLFAIFWLPYHVTSFIIDFIFGSNIDNNLESFSDVGWLNVYVYPMTQILAYVNNAINPLCTLIISKKFR 1315
            GN  V+  VT  + MRT++++F+ +LA SDLL+   C P T+   ++  W+ G  +C++    Q T++   ILT+T + +ER+  +V     + ++  +     +  +W+ + +I SP+  +Q  E+K  +  + K    C+E WS   + +K++TT I +  +LLPL+ + +LY K+G  L                KR+        I    M K      I   ++R   +++ + +LFA+ W P+H+   +I++       +N E   D   + + ++ + QI+ + N+  NP+   ++++ F+
Sbjct:   61 GNALVVYVVTRSKAMRTVTNIFICSLALSDLLIVFFCIPVTMLQNVSDTWLGGAFICKMVPFVQCTAIVTEILTMTCIAVERHQGLVHPFKMKRQYTNQRAFTMLGVVWLVAIIIGSPMWHVQRLEIK-YDFLYEKEHICCLEEWSSPVH-QKIYTTFILVTLFLLPLLLLSVLYGKIGYELW-------------IKKRIGDGSVLRTIHGKEMFK------IARKKKRAVIMMVTVVVLFAVCWAPFHIVHMMIEY-------SNFEKEYDEVTIKM-IFAIVQIIGFFNSICNPIIYALMNENFK 339          
BLAST of Neuropeptide FF receptor 2 vs. Ensembl Mouse
Match: Qrfpr (pyroglutamylated RFamide peptide receptor [Source:MGI Symbol;Acc:MGI:2677633])

HSP 1 Score: 97.4413 bits (241), Expect = 2.490e-21
Identity = 83/308 (26.95%), Postives = 155/308 (50.32%), Query Frame = 2
Query:  398 GNICVILCVTLFRNMRTISHVFLLNLACSDLLVFLICEPFTIASLINPDWIFGESLCRLNGVFQGTSVGVSILTLTSVCIERYIVIVGKGFNQNRFNFRHLICWVVGIWITSFLITSPL--LQAYEVKEKNLTFIKPTRYCMETWSGKNNRKKVFTTXXXXXXXXXXXXXXXXXYSKVGNHLRRSTNTLINIENKPSAKRLKTQDTNNVISTHSMSKLNSIKGINNTRQRISKLLMILTLLFAIFWLPYHVTSFIIDFIFGSNIDNNLESFSDVGWLNVYVYPMTQILAYVNNAINPLCTLIISKKFR 1315
            GN  VI  VT  + MRT++++F+ +LA SDLL+   C P T+   I+  W+ G  +C++    Q T+V   ILT+T + +ER+  ++     + ++  R     +  +W+ + ++ SP+  +Q  E+K  +  + K    C+E W+   + ++++TT I ++ +LLPL+ ML+LYSK+G  L                KR+        I    MSK      I   ++R   +++ +  LFA  W P+HV   ++++   SN +   + + DV      V+ + Q + + N+  NP     +++ F+
Sbjct:   62 GNSLVIYVVTRSKAMRTVTNIFICSLALSDLLIAFFCIPVTMLQNISDKWLGGAFICKMVPFVQSTAVVTEILTMTCIAVERHQGLIHPFKMKWQYTTRRAFTILGVVWLAAIIVGSPMWHVQRLEIK-YDFLYEKEHVCCLEEWASPMH-QRIYTTFILVILFLLPLVVMLVLYSKIGYELWIK-------------KRVGDSSALQTIHGKEMSK------IARKKKRAVVMMVTVVALFAACWAPFHVVHMMVEY---SNFE---KEYDDV--TIKMVFAVAQTIGFFNSICNPFVYAFMNENFK 340          
BLAST of Neuropeptide FF receptor 2 vs. Ensembl Mouse
Match: Hcrtr1 (hypocretin (orexin) receptor 1 [Source:MGI Symbol;Acc:MGI:2385650])

HSP 1 Score: 95.1301 bits (235), Expect = 1.475e-20
Identity = 88/330 (26.67%), Postives = 156/330 (47.27%), Query Frame = 2
Query:  398 GNICVILCVTLFRNMRTISHVFLLNLACSDLLVFLICEPFTIASLINPDWIFGESLCRLNGVFQGTSVGVSILTLTSVCIERYIVIVGKGFNQNRFNFRHLICWVVGIWITSFLITSPLLQAYEVKEKNLTFIKPTRY---CMETWSGKNNRKKVFTTXXXXXXXXXXXXXXXXXYSKV-----GNHLRRSTNTLINIENKPSAKRLKTQDTNNVISTHSMSK--LNSIKGINNTRQRISKLLMILTLLFAIFWLPYHVTSFIIDFIFG-----SNIDNNLESFSDVGWLNVYVYPMTQILAYVNNAINPLCTLIISKKFRTTLNQMRKC 1342
            GN  V L V    +MRT+++ F++NL+ +D+LV  IC P ++   I   W+FG++LC++    Q  SV V++LTL+ + ++R+  I      ++    R     ++GIW  S  +  P     E           TR    C E W+ +    K++ +  FI+ YL PL  M + Y ++     G  +  +T+ L+    +PS ++L+ Q           ++  L  +K +   R++ +K+LM++ L+FA+ +LP  V + ++  +FG     S+ +     F+   W           L Y N+A NP+    +S KFR        C
Sbjct:   63 GNTLVCLAVWRNHHMRTVTNYFIVNLSLADVLVTAICLPASLLVDITESWLFGQALCKVIPYLQAVSVSVAVLTLSFIALDRWYAICHPLLFKS--TARRARGSILGIWAVSLAVMVPQAAVMECSSVLPELANRTRLFSVCDEHWADELY-PKIYHSCFFIVTYLAPLGLMAMAYFQIFRKLWGRQIPGTTSALVRNWKRPS-EQLEAQHQGLCTEPQPRARAFLAEVKQM-RARRKTAKMLMVVLLVFALCYLPISVLN-VLKRVFGMFRQASDREAVYACFTFSHW-----------LVYANSAANPIIYNFLSGKFREQFKAAFSC 375          
BLAST of Neuropeptide FF receptor 2 vs. Ensembl Mouse
Match: Hcrtr1 (hypocretin (orexin) receptor 1 [Source:MGI Symbol;Acc:MGI:2385650])

HSP 1 Score: 95.1301 bits (235), Expect = 1.475e-20
Identity = 88/330 (26.67%), Postives = 156/330 (47.27%), Query Frame = 2
Query:  398 GNICVILCVTLFRNMRTISHVFLLNLACSDLLVFLICEPFTIASLINPDWIFGESLCRLNGVFQGTSVGVSILTLTSVCIERYIVIVGKGFNQNRFNFRHLICWVVGIWITSFLITSPLLQAYEVKEKNLTFIKPTRY---CMETWSGKNNRKKVFTTXXXXXXXXXXXXXXXXXYSKV-----GNHLRRSTNTLINIENKPSAKRLKTQDTNNVISTHSMSK--LNSIKGINNTRQRISKLLMILTLLFAIFWLPYHVTSFIIDFIFG-----SNIDNNLESFSDVGWLNVYVYPMTQILAYVNNAINPLCTLIISKKFRTTLNQMRKC 1342
            GN  V L V    +MRT+++ F++NL+ +D+LV  IC P ++   I   W+FG++LC++    Q  SV V++LTL+ + ++R+  I      ++    R     ++GIW  S  +  P     E           TR    C E W+ +    K++ +  FI+ YL PL  M + Y ++     G  +  +T+ L+    +PS ++L+ Q           ++  L  +K +   R++ +K+LM++ L+FA+ +LP  V + ++  +FG     S+ +     F+   W           L Y N+A NP+    +S KFR        C
Sbjct:   63 GNTLVCLAVWRNHHMRTVTNYFIVNLSLADVLVTAICLPASLLVDITESWLFGQALCKVIPYLQAVSVSVAVLTLSFIALDRWYAICHPLLFKS--TARRARGSILGIWAVSLAVMVPQAAVMECSSVLPELANRTRLFSVCDEHWADELY-PKIYHSCFFIVTYLAPLGLMAMAYFQIFRKLWGRQIPGTTSALVRNWKRPS-EQLEAQHQGLCTEPQPRARAFLAEVKQM-RARRKTAKMLMVVLLVFALCYLPISVLN-VLKRVFGMFRQASDREAVYACFTFSHW-----------LVYANSAANPIIYNFLSGKFREQFKAAFSC 375          
BLAST of Neuropeptide FF receptor 2 vs. UniProt/SwissProt
Match: sp|Q9Y5X5|NPFF2_HUMAN (Neuropeptide FF receptor 2 OS=Homo sapiens OX=9606 GN=NPFFR2 PE=1 SV=2)

HSP 1 Score: 122.094 bits (305), Expect = 1.966e-28
Identity = 98/357 (27.45%), Postives = 180/357 (50.42%), Query Frame = 2
Query:  314 YMILKPQTSKFQIVXXXXXXXXXXXGSTGNICVILCVTLFRN--MRTISHVFLLNLACSDLLVFLICEPFTIASLINPDWIFGESLCRLNGVFQGTSVGVSILTLTSVCIERYIVIVGKGFNQNRFNFRHLICWVVGIWITSFLITSPLLQAYEVKEKNLTFIK--------PTRYCMETWSGKNNRKKVFTTXXXXXXXXXXXXXXXXXYSKVGNHLRRSTNTLINIENKPSAKRLKTQDTNNVISTHSMSKLNSIKGINNTRQRISKLLMILTLLFAIFWLPYHVTSFIIDFIFGSNIDNNLESFSDVGWLNVYVYPMTQILAYVNNAINPLCTLIISKKFRTTLN---QMRKCQ 1345
            Y + +PQ +   I+   +   L ++G+T     ++C  + RN  M T++++F+LNLA SDLLV + C P T+   I   W FG ++C+++G+ QG SV  S+ TL ++ ++R+  +V     + +   +     ++ IW+ +  I SP      V+E+    ++        P  +C E W  +  R K++TT++F   YL PL  ++I+Y ++G  L R+          P   R K Q+  +V+S                +Q+I K+L+I+ LLF + WLP      + D+   +++  N     ++  +N+Y+YP    LA+ N+++NP+     ++ FR       Q++ CQ
Sbjct:  139 YYLHQPQVAAIFIISYFLIFFLCMMGNT-----VVCFIVMRNKHMHTVTNLFILNLAISDLLVGIFCMPITLLDNIIAGWPFGNTMCKISGLVQGISVAASVFTLVAIAVDRFQCVVYPF--KPKLTIKTAFVIIMIIWVLAITIMSPSAVMLHVQEEKYYRVRLNSQNKTSPVYWCREDWPNQEMR-KIYTTVLFANIYLAPLSLIVIMYGRIGISLFRAA--------VPHTGR-KNQEQWHVVS--------------RKKQKIIKMLLIVALLFILSWLPLWTLMMLSDY---ADLSPN-----ELQIINIYIYPFAHWLAFGNSSVNPIIYGFFNENFRRGFQEAFQLQLCQ 456          
BLAST of Neuropeptide FF receptor 2 vs. UniProt/SwissProt
Match: sp|Q924H0|NPFF2_MOUSE (Neuropeptide FF receptor 2 OS=Mus musculus OX=10090 GN=Npffr2 PE=2 SV=2)

HSP 1 Score: 109.768 bits (273), Expect = 1.048e-24
Identity = 83/326 (25.46%), Postives = 160/326 (49.08%), Query Frame = 2
Query:  398 GNICVILCVTLFRNMRTISHVFLLNLACSDLLVFLICEPFTIASLINPDWIFGESLCRLNGVFQGTSVGVSILTLTSVCIERYIVIVGKGFNQNRFNFRHLICWVVGIWITSFLITSPLLQAYEVKEKNLTFIKPTR--------YCMETWSGKNNRKKVFTTXXXXXXXXXXXXXXXXXYSKVGNHLRRSTNTLINIENKPSAKRLKTQDTNNVISTHSMSKLNSIK-GINNTRQRISKLLMILTLLFAIFWLPYHVTSFIIDFIFGSNIDNNLESFSDVGWLNVYVYPMTQILAYVNNAINPLCTLIISKKFRTTL-NQMRKCQ 1345
            GN  V   V   R+M T+++ F+LNLA SDLLV + C P T+   I   W FG S+C+++G+ QG SV  S+ TL ++ ++R+  +V     + +   +     +V IW  +  I +P      V+E+    ++ +         +C E W  ++  ++++TT++F   YL PL  ++I+Y+++G  L ++                         + H   K   ++  ++  +Q++ K+L+ + LLF + WLP      + D+   +++  N      +  +N+Y+YP    LA+ N+++NP+     ++ FR    +  + CQ
Sbjct:   62 GNTVVCFIVIRNRHMHTVTNFFILNLAISDLLVGIFCMPITLLDNIIAGWPFGSSMCKISGLVQGISVAASVFTLVAIAVDRFRCVVYPF--KPKLTVKTAFVTIVIIWGLAIAIMTPSAIMLHVQEEKYYRVRLSSHNKTSTVYWCREDWP-RHEMRRIYTTVLFATIYLAPLSLIVIMYARIGASLFKT-------------------------AAHCTGKQRPVQWHVSKKKQKVIKMLLTVALLFILSWLPLWTLMMLSDY---TDLSPN-----KLRIINIYIYPFAHWLAFCNSSVNPIIYGFFNENFRNGFQDAFQICQ 351          
BLAST of Neuropeptide FF receptor 2 vs. UniProt/SwissProt
Match: sp|Q9EQD2|NPFF2_RAT (Neuropeptide FF receptor 2 OS=Rattus norvegicus OX=10116 GN=Npffr2 PE=2 SV=1)

HSP 1 Score: 109.768 bits (273), Expect = 1.253e-24
Identity = 86/325 (26.46%), Postives = 157/325 (48.31%), Query Frame = 2
Query:  398 GNICVILCVTLFRNMRTISHVFLLNLACSDLLVFLICEPFTIASLINPDWIFGESLCRLNGVFQGTSVGVSILTLTSVCIERYIVIVGKGFNQNRFNFRHLICWVVGIWITSFLITSPLLQAYEVKEKNLTFIKPTR--------YCMETWSGKNNRKKVFTTXXXXXXXXXXXXXXXXXYSKVGNHLRRSTNTLINIENKPSAKRLKTQDTNNVISTHSMSKLNSIKGINNTRQRISKLLMILTLLFAIFWLPYHVTSFIIDFIFGSNIDNNLESFSDVGWLNVYVYPMTQILAYVNNAINPLCTLIISKKFRTTL-NQMRKCQ 1345
            GN  V   V   R M T+++ F+ NLA SDLLV + C P T+   I   W FG S+C+++G+ QG SV  S+ TL ++ ++R+  +V     + +   +     +V IW  +  I +P      V+E+    ++ +         +C E W  +  R +++TT++F   YL PL  ++I+Y+++G  L +++       +    +RL+                     ++  +Q++ K+L+ + LLF + WLP      + D+   S   N L        +N+YVYP    LA+ N+++NP+     ++ FR+   +  + CQ
Sbjct:   62 GNTVVCFVVIRNRYMHTVTNFFIFNLAISDLLVGIFCMPITLLDNIIAGWPFGSSMCKISGLVQGISVAASVFTLVAIAVDRFRCVVYPF--KPKLTVKTAFVMIVIIWGLAITIMTPSAIMLHVQEEKYYRVRLSSHNKTSTVYWCREDWPNQEMR-RIYTTVLFATIYLAPLSLIVIMYARIGASLFKTS------AHSTGKQRLEQWH------------------VSKKKQKVIKMLLTVALLFILSWLPLWTLMMLSDYADLS--PNKLRV------INIYVYPFAHWLAFCNSSVNPIIYGFFNENFRSGFQDAFQFCQ 351          
BLAST of Neuropeptide FF receptor 2 vs. UniProt/SwissProt
Match: sp|Q96P65|QRFPR_HUMAN (Pyroglutamylated RF-amide peptide receptor OS=Homo sapiens OX=9606 GN=QRFPR PE=1 SV=2)

HSP 1 Score: 102.449 bits (254), Expect = 4.495e-22
Identity = 86/308 (27.92%), Postives = 158/308 (51.30%), Query Frame = 2
Query:  398 GNICVILCVTLFRNMRTISHVFLLNLACSDLLVFLICEPFTIASLINPDWIFGESLCRLNGVFQGTSVGVSILTLTSVCIERYIVIVGKGFNQNRFNFRHLICWVVGIWITSFLITSPL--LQAYEVKEKNLTFIKPTRYCMETWSGKNNRKKVFTTXXXXXXXXXXXXXXXXXYSKVGNHLRRSTNTLINIENKPSAKRLKTQDTNNVISTHSMSKLNSIKGINNTRQRISKLLMILTLLFAIFWLPYHVTSFIIDFIFGSNIDNNLESFSDVGWLNVYVYPMTQILAYVNNAINPLCTLIISKKFR 1315
            GN  V   VT  + MRT++++F+ +LA SDLL+   C P T+   I+ +W+ G  +C++    Q T+V   ILT+T + +ER+  +V     + ++  R     +  +W+ + ++ SP+  +Q  E+K  +  + K    C+E W+   + +K++TT I ++ +LLPL+ MLILYSK+G  L                KR+        I    MSK      I   ++R   +++ +  LFA+ W P+HV   +I++   SN +   + + DV      ++ + QI+ + N+  NP+    +++ F+
Sbjct:   62 GNALVFYVVTRSKAMRTVTNIFICSLALSDLLITFFCIPVTMLQNISDNWLGGAFICKMVPFVQSTAVVTEILTMTCIAVERHQGLVHPFKMKWQYTNRRAFTMLGVVWLVAVIVGSPMWHVQQLEIK-YDFLYEKEHICCLEEWTSPVH-QKIYTTFILVILFLLPLMVMLILYSKIGYELW-------------IKKRVGDGSVLRTIHGKEMSK------IARKKKRAVIMMVTVVALFAVCWAPFHVVHMMIEY---SNFE---KEYDDVTI--KMIFAIVQIIGFSNSICNPIVYAFMNENFK 340          
BLAST of Neuropeptide FF receptor 2 vs. UniProt/SwissProt
Match: sp|Q6BD04|GPR54_ORENI (G-protein coupled receptor 54 OS=Oreochromis niloticus OX=8128 GN=gpr54 PE=2 SV=1)

HSP 1 Score: 98.9821 bits (245), Expect = 3.464e-21
Identity = 85/334 (25.45%), Postives = 156/334 (46.71%), Query Frame = 2
Query:  389 GSTGNICVILCVTLFRNMRTISHVFLLNLACSDLLVFLICEPFTIASLINPDWIFGESLCRLNGVFQGTSVGVSILTLTSVCIERYIVIVGKGFNQNRFNFRHLICWVVGIWITSFLITSPLLQAYEVKEKNLTFIKPTRYCMETWSGKNNRKKVFTTXXXXXXXXXXXXXXXXXYSKVGNHLRRSTNTLINIENKPSAKRLKTQDTNNVISTHSMSKLNSIKGINNTRQRISKLLMILTLLFAIFWLPYHVTSFIIDFIFGSNIDNNLESFSDVGWLNVYVYPMTQILAYVNNAINPLCTLIIS----KKFRTTLNQMRKCQFASSSNSKLTK 1378
            G  GN  VI  ++  R MRT ++ ++ NLA +D++  + C PFT      P WIFG  +C+     Q  +V  + +TLT++  +R  V V    +      +  +   + IWI SF++++P+L    ++E    +  P +YCME +  K + ++ F    FI  YLLP++ +   Y+            ++    +P+ + +      N++S  ++S           R ++SK+++++ LLFAI W P  +  F++   F  N   N  ++    W N         ++Y N+++NP+    +     K FR T   + K +   SS +  T 
Sbjct:   59 GLVGNSLVIYVISKHRQMRTATNFYIANLAATDIIFLVCCVPFTATLYPLPGWIFGNFMCKFVAFLQQVTVQATCITLTAMSGDRCYVTVYPLKSLRHRTPKVAMIVSICIWIGSFVLSTPILMYQRIEEG--YWYGPRQYCMERFPSKTH-ERAFILYQFIAAYLLPVLTISFCYT-----------LMVKRVGQPTVEPVDNNYQVNLLSERTIS----------IRSKVSKMVVVIVLLFAICWGPIQI--FVLFQSFYPNYQPNYATYKIKTWANC--------MSYANSSVNPIVYGFMGASFQKSFRKTFPFLFKHKVRDSSMASRTA 358          
BLAST of Neuropeptide FF receptor 2 vs. TrEMBL
Match: A0A193KUQ5 (GCR368 OS=Schmidtea mediterranea OX=79327 GN=gcr368 PE=2 SV=1)

HSP 1 Score: 795.423 bits (2053), Expect = 0.000e+0
Identity = 424/424 (100.00%), Postives = 424/424 (100.00%), Query Frame = 2
Query:  140 MNPQIESWCCFNRLKNNFPQEKTPVQSDSIKTTNDTMNFVFFENICNQITEQRCQQILYMILKPQTSKFQIVXXXXXXXXXXXGSTGNICVILCVTLFRNMRTISHVFLLNLACSDLLVFLICEPFTIASLINPDWIFGESLCRLNGVFQGTSVGVSILTLTSVCIERYIVIVGKGFNQNRFNFRHLICWVVGIWITSFLITSPLLQAYEVKEKNLTFIKPTRYCMETWSGKNNRKKVFTTXXXXXXXXXXXXXXXXXYSKVGNHLRRSTNTLINIENKPSAKRLKTQDTNNVISTHSMSKLNSIKGINNTRQRISKLLMILTLLFAIFWLPYHVTSFIIDFIFGSNIDNNLESFSDVGWLNVYVYPMTQILAYVNNAINPLCTLIISKKFRTTLNQMRKCQFASSSNSKLTKTLYYSQTVNYG 1411
            MNPQIESWCCFNRLKNNFPQEKTPVQSDSIKTTNDTMNFVFFENICNQITEQRCQQILYMILKPQTSKFQIVLIIIFILLFLIGSTGNICVILCVTLFRNMRTISHVFLLNLACSDLLVFLICEPFTIASLINPDWIFGESLCRLNGVFQGTSVGVSILTLTSVCIERYIVIVGKGFNQNRFNFRHLICWVVGIWITSFLITSPLLQAYEVKEKNLTFIKPTRYCMETWSGKNNRKKVFTTIIFILFYLLPLIFMLILYSKVGNHLRRSTNTLINIENKPSAKRLKTQDTNNVISTHSMSKLNSIKGINNTRQRISKLLMILTLLFAIFWLPYHVTSFIIDFIFGSNIDNNLESFSDVGWLNVYVYPMTQILAYVNNAINPLCTLIISKKFRTTLNQMRKCQFASSSNSKLTKTLYYSQTVNYG
Sbjct:    1 MNPQIESWCCFNRLKNNFPQEKTPVQSDSIKTTNDTMNFVFFENICNQITEQRCQQILYMILKPQTSKFQIVLIIIFILLFLIGSTGNICVILCVTLFRNMRTISHVFLLNLACSDLLVFLICEPFTIASLINPDWIFGESLCRLNGVFQGTSVGVSILTLTSVCIERYIVIVGKGFNQNRFNFRHLICWVVGIWITSFLITSPLLQAYEVKEKNLTFIKPTRYCMETWSGKNNRKKVFTTIIFILFYLLPLIFMLILYSKVGNHLRRSTNTLINIENKPSAKRLKTQDTNNVISTHSMSKLNSIKGINNTRQRISKLLMILTLLFAIFWLPYHVTSFIIDFIFGSNIDNNLESFSDVGWLNVYVYPMTQILAYVNNAINPLCTLIISKKFRTTLNQMRKCQFASSSNSKLTKTLYYSQTVNYG 424          
BLAST of Neuropeptide FF receptor 2 vs. TrEMBL
Match: A0A193KUH9 (GCR448 OS=Schmidtea mediterranea OX=79327 GN=gcr448 PE=2 SV=1)

HSP 1 Score: 184.882 bits (468), Expect = 7.152e-50
Identity = 128/347 (36.89%), Postives = 202/347 (58.21%), Query Frame = 2
Query:  332 QTSKFQIVXXXXXXXXXXXGSTGNICVILCVTLFRNMRTISHVFLLNLACSDLLVFLICEPFTIASLINPDWIFGESLCRLNGVFQGTSVGVSILTLTSVCIERYIVIVGKGFNQNRFNFRHLICWVVGIWITSFLITSPLLQAYEVKEKNLTFIKPTRYCMETWSGKNNRKKVFTTXXXXXXXXXXXXXXXXXY----SKVGNHLRRSTNTLINIENKPSAKRLKTQDTNNVISTHSMSKLNSIKGINNTRQRISKLLMILTLLFAIFWLPYHVTSFIIDFIFGSNIDNNLESFSDVGWLNVYVYPMTQILAYVNNAINPLCTLIISKKFRTTLNQMRKCQFASSS 1360
            + S F+++ ++ +I+LF +G  GN+ +++C+   ++MRTIS++FL NLA SDL +FLIC+P ++ ++I   W+FGE  C+L G+ QGT++GVSIL+L  + IERY+ +    F    +  +  I +++GIW  +  I+ PL  + E+K+     I   +YC+ETW G    K+ +T ++F++ Y  PL+ M+ILY    +KV N +++ T T  N   +    RL+TQ                       R RISK+   L  LF I WLPYH+ +   DF     I N  E+ + V +L  Y YP+ Q L Y N+AINPL T+ IS+KFR  + Q+++ +F S S
Sbjct:   43 EISIFKLINLLFYIILFTVGIFGNLLILVCIFSLKHMRTISNMFLANLAISDLFIFLICQPLSLTTIIYSSWVFGEKFCKLQGLLQGTNLGVSILSLLGLNIERYVAVRKMRFGNQLYRRKLCIMYIIGIWCIAGSISLPLAFSTELKKG----IDKKQYCLETWWGTIFWKQFYTIMLFLVLYAFPLLSMIILYYLILTKVKNSMKQQTFT-TNHSTRNYVTRLRTQ-----------------------RTRISKVSTALVCLFTICWLPYHIVNIYADF----QILN--ENQTKVYYLINYGYPIVQWLVYSNSAINPLSTIFISQKFRFAVFQVKQRRFNSRS 355          
BLAST of Neuropeptide FF receptor 2 vs. TrEMBL
Match: A0A0K0PUJ7 (Orphan G-protein coupled receptor 58 OS=Platynereis dumerilii OX=6359 PE=2 SV=1)

HSP 1 Score: 148.288 bits (373), Expect = 4.607e-36
Identity = 107/385 (27.79%), Postives = 197/385 (51.17%), Query Frame = 2
Query:  194 PQEKTPVQSDSIKTTNDTMNFVFFENICNQITEQRCQQILYMILKPQTSKFQIVXXXXXXXXXXXGSTGNICVILCVTLFRNMRTISHVFLLNLACSDLLVFLICEPFTIASLINPDWIFGESLCRLNGVFQGTSVGVSILTLTSVCIERYIVIVGKGFNQNRFNFRHLICWVVGIWITSFLITSPLLQAYEVKEKNLTFIKPTRYCMETWSGKNNRKKVFTTXXXXXXXXXXXXXXXXXYSKVGNHLRRSTNTLINIENKPSAKRLKTQDTNNVISTHSMSKLNSIKGINNTRQRISKLLMILTLLFAIFWLPYHVTSFIIDFI-FGSNIDNNLESFSDVGWLNVYVYPMTQILAYVNNAINPLCTLIISKKFRTTLNQMRKCQ 1345
            P + T +     +  N    F+   +   Q+   + +  L++   P T    IVLI +++ +FL+   GN+ V++ +   R+MR+I++ F++NLA +DLLV ++C P  I   +   WI+G+ +C++ G  QG SV  S+ T+  + ++RY+ I      +   N RH +  VVG+W+ SF I  PL+    V    L    P  +C E W    +R +++ + +FI  +++P  F+ I YS++G  L  S +    + N+ +  ++  Q  N++++               +R++++++L+ + +LFAI W+PYH+ S  +DF+  G N D           + V V P T  L + N+A+NP+    ++  FR    +M  C 
Sbjct:   12 PSQPTNMSGSGHQLENSGQQFLDPSDNLTQLVIAKFRSTLFLHTDPAT----IVLISLYLPIFLVAFLGNLLVLVVILPNRHMRSITNCFIVNLAIADLLVTVVCVPMAIGQSVYRPWIYGQFMCKITGYMQGVSVAASVFTIMMLSVDRYLAIRHPMTFRTYSNGRHALRLVVGVWLLSFAIMLPLIVVLRVDTIALPGADPLHFCKEAWRTPLSR-QLYDSFLFIFMFIMPGCFVTISYSRLGCQL-WSVSQQAQLYNRDT--KVGKQQANHIMA---------------SRRQVARMLVFIAVLFAICWMPYHILSLYLDFVELGPNTD----------LMAVKVLPFTIWLGHSNSALNPILYCFMNNSFRRYTTRMLHCH 363          
BLAST of Neuropeptide FF receptor 2 vs. TrEMBL
Match: A0A4V6ARK8 (G-protein coupled receptor 74 OS=Collichthys lucidus OX=240159 GN=D9C73_018400 PE=3 SV=1)

HSP 1 Score: 141.354 bits (355), Expect = 1.278e-31
Identity = 112/396 (28.28%), Postives = 201/396 (50.76%), Query Frame = 2
Query:  206 TPVQSDSIKTTNDTMNFVFFENICNQITEQRCQQILYMILKPQTSKFQIVXXXXXXXXXXXGSTGNICVILCVTLFRNMRTISHVFLLNLACSDLLVFLICEPFTIASLINPDWIFGESLCRLNGVFQGTSVGVSILTLTSVCIERYIVIVGKGFNQNRFNFRHLICWVVGIWITSFLITSP---LLQAYEVKEKNLTFI-------KPTRYCMETWSGKNNRKKVFTTXXXXXXXXXXXXXXXXXYSKVGNHLRRSTNTLINIENKPSAKRLKTQDTNNVISTHSMSKLNSIKGINNTRQRISKLLMILTLLFAIFWLPYHVTSFIIDFIFGSNIDNNLESFSDVGW--LNVYVYPMTQILAYVNNAINPLCTLIISKKFRTTLNQMRKCQFASS 1357
            T  Q+  + TT +  NF+  +   N +T Q    + + + KP  +    V  ++  L+ ++G+ G +C I+  +  +NMRT++++F+LNLA SDLLV + C P T+   I   W FG  +C+L+G+ QG SV  S+ TL ++ ++R+  IV     +       LI  +V IW+ +  I  P   +LQ    KE+ +  +       +P  +C E W  +  R K++TT++F   YL PL  ++I+Y+++G  L R+T   +      S   + + +  ++ S H++SK          + R+  +L+I+ LLF + WLP      + D+           S ++  +  +N+YVYP+   LA+ N+++NP+     ++ FR       K Q  S+
Sbjct: 1178 TMTQNLILNTTWEDSNFLSLQE--NPLTHQNITYVDFYLHKPSVAAVFTVSYLLIFLVCMLGN-GVVCFIVLRS--KNMRTVTNLFILNLAISDLLVGIFCMPTTLVDNIITGWPFGSVVCKLSGMVQGISVSASVFTLVAIAVDRFRCIVYPFKQKLTIATSKLI--IVIIWVLAVSIMCPSGVMLQV--TKEQRVRIVLGRNNDTRPFYWCRENWPNQEMR-KIYTTVLFANIYLAPLSLIVIMYARIGFTLSRTTILTMRGSGIASQDGIGSNNKLSMESRHTVSK---------KKTRVIMMLLIVALLFILSWLPLWTLMMLSDY----------ASLTEHQYRVINIYVYPLAHWLAFFNSSVNPIIYGFFNENFRRGFQAAFKFQLCSA 1544          
BLAST of Neuropeptide FF receptor 2 vs. TrEMBL
Match: A0A1I8FU19 (G_PROTEIN_RECEP_F1_2 domain-containing protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 135.191 bits (339), Expect = 5.204e-31
Identity = 89/257 (34.63%), Postives = 139/257 (54.09%), Query Frame = 2
Query:  410 VILCVTLFRNMRTISHVFLLNLACSDLLVFLICEPFTIASLINPDWIFGESLCRLNGVFQGTSVGVSILTLTSVCIERYIVI-----VGKGFNQNRFNFRHLICWVVGIWITSFLITSPLLQAYEVKEKNLTFIKPTRYCMETWSGKNNRKKVFTTXXXXXXXXXXXXXXXXXYSKVGNHLRRSTNTLINIENKPSAKRLKTQDTNNVISTHSMSKLNSIKGINNTRQRISKLLMILTLLFAIFWLPYHVTSFIIDF 1165
            VIL +T+F  MR+ +++FLL+LA SD+L+FLIC P TI ++++  WIFG  LC+L    QG S+ VS+ +L S+ ++R++V+       +     R  F     WV GIW+ S L+ SP+   YEV+E  + ++     C+E W    +RK ++T  +F L YLLPL+ M +   K+    RR  +T         A+  + Q   N               +   R + SK++M+L   F+I WLPYHV + +ID 
Sbjct:   99 VILSITVFPGMRSRTNLFLLSLALSDMLIFLICLPLTIYNVLHLQWIFGSVLCKLTPFLQGLSISVSVWSLASLSVKRFVVVRYPLAAKEALTNTRMGF-----WVGGIWLLSLLVCSPIPMVYEVREAQVFWLVTMHTCVEHWHQHPSRKTIYTVCLFGLLYLLPLLAMSVFSWKLS---RRLVST---------ARFSRDQAGQN--------------SVTQGRVKASKVVMVLLAAFSICWLPYHVVNILIDL 324          
BLAST of Neuropeptide FF receptor 2 vs. Ensembl Cavefish
Match: npffr1 (neuropeptide FF receptor 1 [Source:ZFIN;Acc:ZDB-GENE-030131-8106])

HSP 1 Score: 120.939 bits (302), Expect = 2.031e-29
Identity = 87/313 (27.80%), Postives = 152/313 (48.56%), Query Frame = 2
Query:  398 GNICVILCVTLFRNMRTISHVFLLNLACSDLLVFLICEPFTIASLINPDWIFGESLCRLNGVFQGTSVGVSILTLTSVCIERYIVIVGKGFNQNRFNFRHLICWVVGIWITSFLITSPLLQAYEVKEKNLTFI-------KPTRYCMETWSGKNNRKKVFTTXXXXXXXXXXXXXXXXXYSKVGNHLRRSTNTLINIENKPSAKRLKTQDTNNVISTHSMSKLNSIKGINNTRQRISKLLMILTLLFAIFWLPYHVTSFIIDFIFGSNIDNNLESFSDVGWLNVYVYPMTQILAYVNNAINPLCTLIISKKFR 1315
            GN+ V L V   + MRT++++F+LNLA SDLLV + C P T+A  +   W F E  C+++G+ QG SV  S+ TL ++ +ER+  IV     Q +   R  I  +  IW  + +I  P      V      F+        P   C E W  ++ R K++T ++F   YL P+  ++I+Y+++   L +S  ++ + + +   +R                       +   + R+  +L+I+ LLF + WLP  +   + D+        N+ S S +  + VY++P    LA+ N++INP+     ++ FR
Sbjct:   62 GNLLVCLIVLKNKQMRTVTNIFILNLAISDLLVGIFCLPITLADNLVTGWPFDEVTCKMSGLIQGASVSASVFTLVAIAVERFRCIVYP--FQQKLTLRQAIITIAFIWALAIIIMCPSAVTLTVSHDAFHFMVDRDNATYPLYTCWEAWPDQSMR-KIYTMVLFSHIYLAPVTLIVIMYTRIALKLFKSPASIRDAQAEDEGRR-----------------------VYRRKIRVVNMLLIVALLFTVSWLPLWIIILLTDY-------GNMSS-SQLNVIAVYIFPFAHWLAFFNSSINPIVYGYFNENFR 340          
BLAST of Neuropeptide FF receptor 2 vs. Ensembl Cavefish
Match: npffr2b (neuropeptide FF receptor 2-like [Source:NCBI gene;Acc:103031865])

HSP 1 Score: 119.783 bits (299), Expect = 8.051e-29
Identity = 97/334 (29.04%), Postives = 164/334 (49.10%), Query Frame = 2
Query:  398 GNICVILCVTLFRNMRTISHVFLLNLACSDLLVFLICEPFTIASLINPDWIFGESLCRLNGVFQGTSVGVSILTLTSVCIERYIVIVGKGFNQNRFNFRHLICWVVGIWITSFLITSP---LLQAYE-------VKEKNLTFIKPTRYCMETWSGKNNRKKVFTTXXXXXXXXXXXXXXXXXYSKVGNHLRRSTNTLINIENKPSAKRLKTQDTNNVISTHSMSKLNSIKGINNTRQRISKLLMILTLLFAIFWLPYHVTSFIIDFIFGSNIDNNLESFSDVGWLNVYVYPMTQILAYVNNAINPLCTLIISKKFRTTLNQMRKCQFASSSNSK 1369
            GN  V   V   ++MRT++++F+LNLA SDLLV + C P T+   I   W FG  +C+L+G+ QG SV  S+ TL  + ++R+  IV   F Q +         +V IW+ +  I  P   +LQ  +       + E N T  +P  +C E W  +  R K++TT++F   YL PL  ++I+Y+++G  L ++          P   R   +   + +S                ++R+ K+L+++ LLF + WLP      + D+   S   + +        +N+YVYP+   LA+ N+++NP+     ++ FR     + K QF S+   K
Sbjct:   65 GNGLVCFIVLRSKSMRTVTNLFILNLAISDLLVGIFCMPTTLVDNIITGWPFGSLVCKLSGMVQGISVSASVFTLVVIAVDRFRCIV-YPFKQ-KLTISTSTVIIVIIWVLAISIMCPSGVMLQVTKESRVSILLGESNAT--RPFYWCRENWPSQEMR-KIYTTVLFANIYLAPLTLIVIMYARIGITLFKTA--------VPVPTRGGYEGRGHTVS--------------RKKKRVIKMLLVVALLFILSWLPLWTLMMLSDYASLSEYQHRV--------INIYVYPLAHWLAFCNSSVNPIIYGFFNENFRRGFQIVFKLQFCSAQRGK 363          
BLAST of Neuropeptide FF receptor 2 vs. Ensembl Cavefish
Match: npffr2b (neuropeptide FF receptor 2-like [Source:NCBI gene;Acc:103031865])

HSP 1 Score: 118.627 bits (296), Expect = 2.244e-28
Identity = 105/385 (27.27%), Postives = 191/385 (49.61%), Query Frame = 2
Query:  263 FENIC------NQITEQRCQQILYMILKPQTSKFQIVXXXXXXXXXXXGSTGNICVILCVTLFRNMRTISHVFLLNLACSDLLVFLICEPFTIASLINPDWIFGESLCRLNGVFQGTSVGVSILTLTSVCIERYIVIVGKGFNQNRFNFRHLICWVVGIWITSFLITSP---LLQAYE-------VKEKNLTFIKPTRYCMETWSGKNNRKKVFTTXXXXXXXXXXXXXXXXXYSKVGNHLRRSTNTLINIENKPSAKRLKTQDTNNVISTHSMSKLNSIKGINNTRQRISKLLMILTLLFAIFWLPYHVTSFIIDFIFGSNIDNNLESFSDVGWLNVYVYPMTQILAYVNNAINPLCTLIISKKFRTTLNQMRKCQFASSSNSK 1369
            FENI       +Q+       + + + +P  S   IV  ++  ++ ++G+ G +C I+  +  ++MRT++++F+LNLA SDLLV + C P T+   I   W FG  +C+L+G+ QG SV  S+ TL  + ++R+  IV   F Q +         +V IW+ +  I  P   +LQ  +       + E N T  +P  +C E W  +  R K++TT++F   YL PL  ++I+Y+++G  L +   T + +  +       T   +     +          ++  ++R+ K+L+++ LLF + WLP      + D+   S   + +        +N+YVYP+   LA+ N+++NP+     ++ FR     + K QF S+   K
Sbjct:   23 FENISLDSSFYHQLPGPNITYVDFYLHEPSVSAIFIVSYLLIFVVCMVGN-GLVCFIVLRS--KSMRTVTNLFILNLAISDLLVGIFCMPTTLVDNIITGWPFGSLVCKLSGMVQGISVSASVFTLVVIAVDRFRCIV-YPFKQ-KLTISTSTVIIVIIWVLAISIMCPSGVMLQVTKESRVSILLGESNAT--RPFYWCRENWPSQEMR-KIYTTVLFANIYLAPLTLIVIMYARIGITLFK---TAVPVPTRAGGSDSGTGSGSGKEGGYEGRG----HTVSRKKKRVIKMLLVVALLFILSWLPLWTLMMLSDYASLSEYQHRV--------INIYVYPLAHWLAFCNSSVNPIIYGFFNENFRRGFQIVFKLQFCSAQRGK 384          
BLAST of Neuropeptide FF receptor 2 vs. Ensembl Cavefish
Match: NPFFR2 (neuropeptide FF receptor 2 [Source:NCBI gene;Acc:103039748])

HSP 1 Score: 117.472 bits (293), Expect = 3.580e-28
Identity = 96/334 (28.74%), Postives = 164/334 (49.10%), Query Frame = 2
Query:  398 GNICVILCVTLFRNMRTISHVFLLNLACSDLLVFLICEPFTIASLINPDWIFGESLCRLNGVFQGTSVGVSILTLTSVCIERYIVIVGKGFNQNRFNFRHLICWVVGIWITSFLITSP---LLQAYEVKEKNLTFI-------KPTRYCMETWSGKNNRKKVFTTXXXXXXXXXXXXXXXXXYSKVGNHLRRSTNTLINIENKPSAKRLKTQDTNNVISTHSMSKLNSIKGINNTRQRISKLLMILTLLFAIFWLPYHVTSFIIDFIFGSNIDNNLESFSDVGWLNVYVYPMTQILAYVNNAINPLCTLIISKKFRTTLNQMRKCQFASSSNSK 1369
            GN  V   V   +NMRT++++F+LNLA SDLLV + C P T+   I   W FG  +C+++G+ QG SV  S+ TL ++ ++R+  IV   F Q +         +V IW+ +  I  P   +LQ    KE+++           P  +C E W  +  R K++TT++F   YL PL  ++I+Y+++G  L +   T +    KP              + H++SK          +QR+ K+L+I+ LLF + WLP      + D+   +     L        +N+Y+YP    LA+ N+++NP+     ++ FR     + K +  ++   +
Sbjct:   63 GNGVVCFIVLRSKNMRTVTNLFILNLAVSDLLVGIFCMPTTLLDNIITGWPFGSMVCKMSGMVQGISVSASVFTLVAIAVDRFRCIV-YPFKQ-KLTISTATLIIVIIWVLAISIMCPSGVMLQV--TKEQSIRVFLGDGNRTSPFYWCRENWPNQEMR-KIYTTVLFANIYLAPLSLIVIMYARIGITLFK---TAVPTGGKPGND-----------NRHTVSK---------KKQRVIKMLLIVALLFILSWLPLWTLMMLTDYARLTEHQYRL--------INIYIYPFAHWLAFFNSSVNPIIYGFFNENFRRGFQAIFKFRLCTAGGHR 360          
BLAST of Neuropeptide FF receptor 2 vs. Ensembl Cavefish
Match: npffr1 (neuropeptide FF receptor 1 [Source:ZFIN;Acc:ZDB-GENE-030131-8106])

HSP 1 Score: 112.849 bits (281), Expect = 8.266e-27
Identity = 86/313 (27.48%), Postives = 146/313 (46.65%), Query Frame = 2
Query:  398 GNICVILCVTLFRNMRTISHVFLLNLACSDLLVFLICEPFTIASLINPDWIFGESLCRLNGVFQGTSVGVSILTLTSVCIERYIVIVGKGFNQNRFNFRHLICWVVGIWITSFLITSPLLQAYEVKEKNLTFI-------KPTRYCMETWSGKNNRKKVFTTXXXXXXXXXXXXXXXXXYSKVGNHLRRSTNTLINIENKPSAKRLKTQDTNNVISTHSMSKLNSIKGINNTRQRISKLLMILTLLFAIFWLPYHVTSFIIDFIFGSNIDNNLESFSDVGWLNVYVYPMTQILAYVNNAINPLCTLIISKKFR 1315
            GN+ V L V   + MRT++++F+LNLA SDLLV + C P T+A  +   W F E  C+++G+ QG SV  S+ TL ++ +ER+  IV     Q +   R  I  +  IW  + +I  P      V      F+        P   C E W  ++ R K++T ++F   YL P+  ++I+Y+++   L +S                                    + +   + R+  +L+I+ LLF + WLP  +   + D+        N+ S S +  + VY++P    LA+ N++INP+     ++ FR
Sbjct:   52 GNLLVCLIVLKNKQMRTVTNIFILNLAISDLLVGIFCLPITLADNLVTGWPFDEVTCKMSGLIQGASVSASVFTLVAIAVERFRCIVYPF--QQKLTLRQAIITIAFIWALAIIIMCPSAVTLTVSHDAFHFMVDRDNATYPLYTCWEAWPDQSMR-KIYTMVLFSHIYLAPVTLIVIMYTRIALKLFKSPG----------------------------------RRVYRRKIRVVNMLLIVALLFTVSWLPLWIIILLTDY-------GNMSS-SQLNVIAVYIFPFAHWLAFFNSSINPIVYGYFNENFR 319          
BLAST of Neuropeptide FF receptor 2 vs. Ensembl Sea Lamprey
Match: npffr1l3 (neuropeptide FF receptor 1 like 3 [Source:ZFIN;Acc:ZDB-GENE-070424-44])

HSP 1 Score: 118.242 bits (295), Expect = 1.519e-29
Identity = 90/313 (28.75%), Postives = 157/313 (50.16%), Query Frame = 2
Query:  398 GNICVILCVTLFRNMRTISHVFLLNLACSDLLVFLICEPFTIASLINPDWIFGESLCRLNGVFQGTSVGVSILTLTSVCIERYIVIVGKGFNQNRFN---FRHLICWVVGIWI---TSFLITSPLLQA-YEVKEKNLTFIKPTRYCMETWSGKNNRKKVFTTXXXXXXXXXXXXXXXXXYSKVGNHLRRSTNTLINIENKPSAKRLKTQDTNNVISTHSMSKLNSIKGINNTRQRISKLLMILTLLFAIFWLPYHVTSFIIDFIFGSNIDNNLESFSDVGWLNVYVYPMTQILAYVNNAINPLCTLIISKKFR 1315
            GN  V   V   R MRT++++F+LNLA SDLLV + C P T+   +   W FG  +C+++G+ QGTSV  S+ TL ++ ++R+  IV     + R +   F  L+ W + + I   ++ ++T+ + +  Y V         P   C E W     RK  +TT++F   YL PL  +L++Y+++G  L   + +     +  +  R                      G+   R ++ K+L+I+ +LF + WLP      ++D+        NL  + D+ +LN+YVYP+   LA+ N+++NP+     ++ FR
Sbjct:   66 GNGLVCYVVLQSRRMRTVTNLFILNLAVSDLLVGIFCMPITLVDNLITGWPFGVVVCKMSGLVQGTSVSASVFTLVAIAVDRFRCIVYPFKRKLRISHALFTILVIWALALSIMCPSALMLTAEVSRGHYMVYSDGSNDTHPLHQCWEAWPDPRMRKA-YTTVLFANVYLAPLALILLMYARIGFRLCSLSASAAAAASAAAPSRGGGGGAT---------------GVTRRRVKVIKMLIIVAMLFMLSWLPLWTVMMLVDY-------ANLSPW-DLAFLNMYVYPVAHWLAFFNSSVNPIVYGYFNENFR 354          
BLAST of Neuropeptide FF receptor 2 vs. Ensembl Sea Lamprey
Match: qrfpr4 (pyroglutamylated RFamide peptide receptor 4 [Source:ZFIN;Acc:ZDB-GENE-091204-354])

HSP 1 Score: 104.375 bits (259), Expect = 7.390e-25
Identity = 78/317 (24.61%), Postives = 157/317 (49.53%), Query Frame = 2
Query:  395 TGNICVILCVTLFRNMRTISHVFLLNLACSDLLVFLICEPFTIASLINPDWIFGESLCRLNGVFQGTSVGVSILTLTSVCIERYIVIVGKGFNQNRFNFRHLICWVVGIWITSFLITSPLLQAYEVK-EKNLTFIKPTRYCMETWSGKNNRKKVFTTXXXXXXXXXXXXXXXXXYSKVGNHLRRSTNTLINIENKPSAKRLKTQDTNNVISTHSMSKLNSIKGINNTRQRISKLLMILTLLFAIFWLPYHVTSFIIDFIFGSNIDNNLESFSDVGWLNVYVYPMTQILAYVNNAINPLCTLIISKKFRTTLNQMRKC 1342
            +GN  VI  V   + + T+++VF+ +LA SDL++ + C P T+      +WI G +LC+L    Q T+V  S+LT+  + +ER+  I+    +++R+        + G+W+    + +P+  A+ V+   ++ +      C E WS   +R+  +TT + ++ ++LPL+ M  LY+++ + L                  +KT+  + V +    S++N    I  +++R  K+++I+ +LFA+ W P+HV + ++          NLE   D   +      M Q+  + N+  NP+    +++ ++  L     C
Sbjct:   61 SGNALVIFVVARRKALHTVANVFVCSLAVSDLMITVFCIPITLMQNFFSNWIAGVALCKLVPFIQVTAVTTSMLTMACIAVERFQGILHPLRSRSRYTTARAASMLCGVWLVGLCVAAPMFYAHTVQVTYDVLYDVSHTGCSEQWSHAEHRQA-YTTTLLLVTFVLPLLTMTALYTRLAHEL-----------------WVKTRVHDAVFNALQRSEINK---ITRSKKRAVKMMVIVVILFAVCWAPFHVVNSLVP-------KGNLEMSFD---MEAITLAMVQLFGFSNSLWNPIVYAALNQNYKKQLAIALSC 346          
BLAST of Neuropeptide FF receptor 2 vs. Ensembl Sea Lamprey
Match: npy8br (neuropeptide Y receptor Y8b [Source:ZFIN;Acc:ZDB-GENE-980526-208])

HSP 1 Score: 92.0485 bits (227), Expect = 1.672e-20
Identity = 73/266 (27.44%), Postives = 132/266 (49.62%), Query Frame = 2
Query:  389 GSTGNICVILCVTLFRNMRTISHVFLLNLACSDLLVFLICEPFTIASLINPDWIFGESLCRLNGVFQGTSVGVSILTLTSVCIERYIVIVGKGFNQNRFNFRHLICWVVGIWITSFLITSPLLQAYEVKE---KNLTFIKPTR----YCMETWSGKNNRKKVFTTXXXXXXXXXXXXXXXXXYSKVGNHLRRSTNTLINIENKPSAKRLKTQDTNNVISTHSMSKLNSIKGINNTRQRISKLLMILTLLFAIFWLPYHVTSFIIDF 1165
            G  GN  ++L +     +  ++++ ++NLA SD+LV L+C P TIA  +   WIFGE+LC+ +   Q ++V VSI +L  + IER+ +I+     +   N  H    +  IW+T+F ++SP L  + + +   +NL+   P       C+E W   +  K  FTT + +  +  PL+F+ + Y ++   LR+    L      P+ +       N V ++H               ++I+ +L+ +   FAI WLP +  + + D+
Sbjct:   52 GLLGNSLLVLVILRHSELHNVTNILIVNLAFSDMLVGLVCLPLTIAYTLMDHWIFGEALCKGSPFLQCSAVSVSIFSLVLIAIERHQLIINPTGWKPSLN--HAYVAIGAIWVTAFAMSSPFLAFHVLTDEPYRNLSHYFPDYGEKVACIELWP-SDTSKFAFTTSLLVFQFSCPLLFVFLCYLRIFLRLRQRKKML------PTGRE---GGGNGVRASH--------------MKKINMMLVAIVAGFAICWLPLYAFNAVSDW 291          
BLAST of Neuropeptide FF receptor 2 vs. Ensembl Sea Lamprey
Match: kiss1rb (KISS1 receptor b [Source:ZFIN;Acc:ZDB-GENE-060526-54])

HSP 1 Score: 87.8113 bits (216), Expect = 3.088e-19
Identity = 79/322 (24.53%), Postives = 151/322 (46.89%), Query Frame = 2
Query:  389 GSTGNICVILCVTLFRNMRTISHVFLLNLACSDLLVFLICEPFTIASLINPDWIFGESLCRLNGVFQGTSVGVSILTLTSVCIERYIVIVGKGFNQNRFNFRHLICWVVGIWITSFLITSPLLQAYEVKEKNLTFIKPTRYCMETWSGKNNRKKVFTTXXXXXXXXXXXXXXXXXYSKVGNHLRRSTNTLINIENKPSAKRLKTQDTNNVISTHSMSKLNSIKGINNTRQRISKLLMILTLLFAIFWLPYHVTSFIIDFIFGSNIDNNLESFSDVGWLNVYVYPMTQILAYVNNAINPLCTLIISKKFRTTLNQMRKCQFAS 1354
            G  GN  VI  +T  R MRT+++ F++NLA +D++  + C PFT      P W+FG+ +C+     Q  +V  + +TLT++ ++R  V V    +          C  +GIWI S +++ P+   ++   K   +  P  YC + +    + +  F    F+L Y+LPL+ + + YS            +I    +P+   ++ QD N  +    +++ N       TR +++++++++ L+F + W P  +  FI+   F  +   +  ++    W N         ++Y N++INP     +   FR T  +   C F +
Sbjct:   50 GLVGNSLVIFVITKNRQMRTVTNFFIVNLAGTDIIFLVCCVPFTATLYPLPSWVFGDFMCKFVNYLQQVTVQATCMTLTAMSVDRCYVTVYPIRSLQHRTPCLAACISIGIWIGSLVMSLPMALYHKTDTKE--WYGPKTYCFDAFPSVPH-EHAFVLYSFVLVYMLPLVTISVCYS-----------IMIKKIGRPA---VEPQDDN--VQLQMLTERN-----EATRAKVTRMVVVVVLVFMLCWGPIQL--FILFQSFYPHFAISYTTYKLKTWANC--------MSYANSSINPFVYCFMGDSFRKTFKKAFPCLFKA 337          
BLAST of Neuropeptide FF receptor 2 vs. Ensembl Sea Lamprey
Match: galr1b (galanin receptor 1b [Source:ZFIN;Acc:ZDB-GENE-140624-1])

HSP 1 Score: 82.8037 bits (203), Expect = 1.371e-17
Identity = 88/332 (26.51%), Postives = 146/332 (43.98%), Query Frame = 2
Query:  389 GSTGNICVILCVTLFRNMRTISHVFLLNLACSDLLVFLICEPFTIASLINPDWIFGESLCRLNGVFQGTSVGVSILTLTSVCIERYIVIVGKGFNQNRFNFRHLICWVVGIWITSFLITSPLLQAYEVKEKNLTFIKPTRYCMETWSGKNNRKKVFTTXXXXXXXXXXXXXXXXXYSKVGNHLRRSTNTLINIENKPSAKRLKTQDTNNVISTHSMSKLNSIKGINNTRQRISKLLMILTLLFAIFWLPYHVTSFIIDFIFGS-NIDNNLESFSDVGWLNVYVYPMTQILAYVNNAINPLCTLIISKKFRTTLNQMRKCQFASSSNSKLTKT 1381
            G+T  + V+LC    R  R  ++ F+LNL+ +DL   ++C PF     + P W+FG  LC+    F    + VSI TL ++ +ERYI +V    +      R+ +  V  IW  S +   P  Q   + +  + +  P ++    W  + ++++ + T IFI  YLLPL+ +   Y  V  HL+R      NI  K    + KT  T                            ++++  +F I WLP+HV    +  ++GS  + +   +F  V          +  L+Y N+  NP+    +S+ FR    Q+  CQ   SS+ K   T
Sbjct:   46 GNTLVLVVLLCRKSRRVQRNTTNTFILNLSVADLTFLMVCVPFQSTIYVLPTWVFGAFLCKAVHYFVTVFMLVSIFTLAAMSVERYIAVVHSHRSPVLRTTRNALAGVAVIWALSVVAAIPCAQNRMLVD-GVNYSHPGQF--FCWEAEASKRRAYITGIFIFGYLLPLLLISCCYISVLTHLQRKVR---NISKKSQRSKKKTAQT----------------------------VLVVVAVFCISWLPHHVIHMWV--LYGSFPLTSASFAFRIV----------SHCLSYGNSCANPIIYAFLSENFRKAYRQVFSCQLPVSSSLKAKST 331          
BLAST of Neuropeptide FF receptor 2 vs. Ensembl Nematostella
Match: EDO42883 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S011])

HSP 1 Score: 99.3673 bits (246), Expect = 2.664e-23
Identity = 93/311 (29.90%), Postives = 151/311 (48.55%), Query Frame = 2
Query:  398 GNICVILCVTLFRNMRTISHVFLLNLACSDLLVFLICEPFTIASL-INPDWIFGESLCRLNGVFQGTSVGVSILTLTSVCIERYIVIVGKGFNQNRFNFRHLICWVVGIWITSFLITSPLLQAYEVKEKNLTFIKPTRYCMETWSGKNNRKKVFTTXXXXXXXXXXXXXXXXXYSKVGNHLRRSTNTLINIENKPSAKRLKTQDTNNVISTHSMSKLNSIKGINNTRQRISKLLMILTLLFAIFWLPYHVTSFIIDFIFGSNIDNNLESFSDVGWLNVYVYPMTQILAYVNNAINPLCTLIISKKFRTTLN 1327
            GN  VI  ++   NM+T ++  LLNL  +DLL+     PF    L I   WIFG  +CR+    Q      SIL LT++ +ERY+ +              +IC V  +W  +   T PLL A     K    I+   YC+E+W+  ++   ++T ++  LFY +PLI M  LY+K+G  L RS                 T+ TN++  + S +KL        ++ R++K+ + + L FA+ W P H+ + +  F      +   ES++ V   N+ ++P+   +A+ N A+NPL    +S+ FR  L 
Sbjct:   11 GNCLVIYVISRVHNMKTSTNTLLLNLCIADLLIAAFYLPFVTVDLYITDHWIFGGFMCRIVSFSQSVGTKASILILTALSLERYLTVCKSNLVIVTARNTCIICIV--LWGVAIAFTLPLLIA-----KTTISIEENEYCIESWT--SSHAIIYTLVVLTLFYFVPLIVMTALYAKIGKKLFRS-----------------TRRTNSMRLSISSNKLTV-----TSKARLTKICVTIILSFALSWAPTHILTLVYYF-----SEMTPESYTIV---NMIIFPIVSCVAFSNCALNPLLYCYMSQNFRNALK 282          
BLAST of Neuropeptide FF receptor 2 vs. Ensembl Nematostella
Match: EDO27481 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T950])

HSP 1 Score: 94.7449 bits (234), Expect = 1.260e-21
Identity = 81/310 (26.13%), Postives = 144/310 (46.45%), Query Frame = 2
Query:  389 GSTGNICVILCVTLFRNMRTISHVFLLNLACSDLLVFLICEPFTI-ASLINPDWIFGESLCRLNGVFQGTSVGVSILTLTSVCIERYIVIVGKGFNQNRFNFRHLICWVVGIWITSFLITSPLLQAYEVKEKNLTFIKPTRYCMETWSGKNNRKKVFTTXXXXXXXXXXXXXXXXXYSKVGNHLRRSTNTLINIENKPSAKRLKTQDTNNVISTHSMSKLNSIKGINNTRQRISKLLMILTLLFAIFWLPYHVTSFIIDFIFGSNIDNNLESFSDVGWLNVYVYPMTQILAYVNNAINPLCTLIISKKFR 1315
             + GN  V + +   + M+T+++ F+LNLA +DL +  IC PF I    +   W +G  +C++    Q  ++  S+ TLT+V + RY  IV     Q   +    +  V+ IW+ S L  +P +        +L+++  ++YC E W   N RK  +T  +F   Y++PL  +   Y  + + L R T     + N+      + ++T  V+                      ++LMI+TLLFA+  LP +V    +DF      D + + F D       V     +  ++N+A NP+C  I+++ +R
Sbjct:   17 SAAGNTLVCIVILKRKKMKTVTNYFILNLAVADLALTCICIPFDIPVQEMGYIWPYGAVMCKVLYPLQTLTLFASVYTLTAVSLTRYWAIVHPLRKQLSVSKAKTL--VIAIWVLSLLPVAPYMN-------SLSYVPHSKYCEENWDNHNARKG-YTASLFAFQYVIPLTIIATAYCSITSELSRRTIESACVRNQ------QHKETKKVV----------------------RMLMIVTLLFAVCVLPNNVMWLWLDF---GAADKSFKYFWD-------VVAFCHVWTFLNSAANPICYTILNENYR 278          
BLAST of Neuropeptide FF receptor 2 vs. Ensembl Nematostella
Match: EDO36453 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SIH9])

HSP 1 Score: 93.5893 bits (231), Expect = 3.566e-21
Identity = 81/310 (26.13%), Postives = 142/310 (45.81%), Query Frame = 2
Query:  389 GSTGNICVILCVTLFRNMRTISHVFLLNLACSDLLVFLICEPFTI-ASLINPDWIFGESLCRLNGVFQGTSVGVSILTLTSVCIERYIVIVGKGFNQNRFNFRHLICWVVGIWITSFLITSPLLQAYEVKEKNLTFIKPTRYCMETWSGKNNRKKVFTTXXXXXXXXXXXXXXXXXYSKVGNHLRRSTNTLINIENKPSAKRLKTQDTNNVISTHSMSKLNSIKGINNTRQRISKLLMILTLLFAIFWLPYHVTSFIIDFIFGSNIDNNLESFSDVGWLNVYVYPMTQILAYVNNAINPLCTLIISKKFR 1315
             + GN  V + +   + M+T+++ F+LNLA +DL +  IC PF I    +   W +G  +C++    Q  ++  S+ TLT+V + RY  IV     Q   +    +  V+ IW+ S L  +P + +       L+++  ++YC E W   N RK  +T  +F   Y++PL  +   Y  +   L R T     + N+                 H  +K            ++ ++LMI+TLLFA+  LP +V    +DF      D + + F D       V     +  ++N+A NP+C  I+++ +R
Sbjct:   49 SAAGNTLVCIVILKRKKMKTVTNYFILNLAVADLALTCICIPFDIPVQEMGYIWPYGAVMCKVLYPLQTLTLFASVYTLTAVSLTRYWAIVHPLRKQLSVSKAKTL--VIAIWVLSLLPVAPYMNS-------LSYVPHSKYCEENWDNHNARKG-YTASLFAFQYVIPLTIIATAYCSITRELSRRTIESACVRNQ----------------QHKETK------------KVVRMLMIVTLLFAVCVLPNNVMWLWLDF---GAADKSFKYFWD-------VVAFCHVWTFLNSAANPICYTILNENYR 310          
BLAST of Neuropeptide FF receptor 2 vs. Ensembl Nematostella
Match: EDO44418 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RVN5])

HSP 1 Score: 91.6633 bits (226), Expect = 1.031e-20
Identity = 87/311 (27.97%), Postives = 148/311 (47.59%), Query Frame = 2
Query:  398 GNICVILCVTLFRNMRTISHVFLLNLACSDLLVFLICEPFTIASLINPDWIFGESLCRLNGVFQGTSVGVSILTLTSVCIERYIVIVGKGFNQNRFNFRHLICWVVGIWITSFLITSPLLQAYEVKEKNLTFIKPTRYCMETWSGKNNRKKV---FTTXXXXXXXXXXXXXXXXXYSKVGNHL--RRSTNTLINIENKPSAKRLKTQDTNNVISTHSMSKLNSIKGINNTRQRISKLLMILTLLFAIFWLPYHVTSFIIDFIFGSNIDNNLESFSDVGWLNVYVYPMTQILAYVNNAINPLCTLIISKKFR 1315
            GN  VI  V   R+M++++++F+ NLA SDLL+  +  P  I  L   +W+FG  LC+L    Q  SVG S+LTL ++  +R++ I+     + R +F+     ++ IW  S  I +PL+ A +V             C E W+   + K     +T ++F++ Y +P++ M +LY+ +   L  RR    +I     PSA       + N +S                R+++ K+L+ + +LF   WLP HV SF I F      D +          N  +Y ++  L + N+A NP    + ++ +R
Sbjct:   13 GNTVVIFTVCRNRHMKSVTNLFIANLAASDLLITFLGMPHQITELYTTEWMFGTVLCKLVVYLQSVSVGSSVLTLLAITKDRFVAIIFPF--RPRMSFKTAKTIIMLIWSLSLGIMAPLIYATKVHNNQ---------CTEDWTPAFDAKTAPRDYTVVLFVMLYAVPMLTMAVLYAIIVRKLWRRRRIGEVI-----PSA------SSKNEVS----------------RKKVIKMLITVIMLFTFSWLPLHVFSF-ISFFAPFCPDTS----------NTALYFVSLFLGHGNSAANPYLYALFNQNYR 274          
BLAST of Neuropeptide FF receptor 2 vs. Ensembl Nematostella
Match: EDO49570 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RGN9])

HSP 1 Score: 89.7373 bits (221), Expect = 5.964e-20
Identity = 93/309 (30.10%), Postives = 140/309 (45.31%), Query Frame = 2
Query:  398 GNICVILCVTLFRNMRTISHVFLLNLACSDLLVFLICEPFTIASLINPDWIFGESLCRLNGVFQGTSVGVSILTLTSVCIERYIVIVGKGFNQNRFNFRHLICWVVGIWITSFLITSPLLQAYEVKEKNLTFIKPTRYCMETWSGKNN---RKKVFTTXXXXXXXXXXXXXXXXXYSKVGNHLRRSTNTLINIENKPSAKRLKTQDTNNVISTHSMSKLNSIKGINNTRQRISKLLMILTLLFAIFWLPYHVTSFIIDFIFGSNIDNNLESFSDVGWLNVYVYPMTQILAYVNNAINPLCTLIISKKFR 1315
            GN  VI  V L    R+++  F+ NLA SD+L+     P  I       W+FG  +C+L    Q  SV  S+LTL +V I+R+I IV     + R         V   WI S  I +PL+ A + K+    F     YC+E W    N     K FT ++F++ Y+ PL+ M +LY  +   L + T+        P A+  +T+       TH          +  +R+R+ K+L+ +TLLFA+ WLP  +  FI+ F            FS         Y ++  L + N+AINP      +  FR
Sbjct:   13 GNSTVIY-VVLNHRARSMTDTFVANLAASDILITFTGMPNMITEQYIRHWVFGPIVCKLVVYLQSVSVASSVLTLLAVTIDRFISIVFP--LRGRIALSKAKYIVAVTWIISLSIMAPLIDAQKAKQ----FPDGMYYCIEEWQPPFNPLEAPKSFTVLLFVVMYVAPLLTMAVLYCAICRTLWKRTS--------PGARITRTE-------TH----------LQRSRKRVLKMLLAVTLLFAVCWLPLWIFQFIMFF-----SPQTFPCFSKP------FYFVSLFLGHSNSAINPFLYSFFNANFR 278          
BLAST of Neuropeptide FF receptor 2 vs. Ensembl Medaka
Match: npffr2b (neuropeptide FF receptor 2-like [Source:NCBI gene;Acc:101174760])

HSP 1 Score: 119.398 bits (298), Expect = 9.149e-29
Identity = 95/327 (29.05%), Postives = 161/327 (49.24%), Query Frame = 2
Query:  398 GNICVILCVTLFRNMRTISHVFLLNLACSDLLVFLICEPFTIASLINPDWIFGESLCRLNGVFQGTSVGVSILTLTSVCIERYIVIVGKGFNQNRFNFRHLICWVVGIWITSFLITSPLLQAYEVKEKNLTFI--------KPTRYCMETWSGKNNRKKVFTTXXXXXXXXXXXXXXXXXYSKVGNHLRRSTNTLINIENKPSAKRLKTQDTNNVISTHSMSKLNSIKGINNTRQRISKLLMILTLLFAIFWLPYHVTSFIIDFIFGSNIDNNLESFSDVGWLNVYVYPMTQILAYVNNAINPLCTLIISKKFRTTLNQMRKCQFAS 1354
            GN  V   V   +NMRT++++F+LNLA SDLLV + C P T+   I   W FG  +C+L+G+ QG SV  S+ TL ++ ++R+  IV     +       +I  +V IW+ +  I  P     +V E+    I        +P  +C E W  +  R K++TT++F   YL PL  ++I+Y+++G  L ++T             R     T    S + +S ++  + I+  ++R+  +L+I+ LLF + WLP      + D+   +     +        +N+YVYP    LA+ N+++NP+     ++ FR       K Q  S
Sbjct:   62 GNGVVCFIVLRSKNMRTVTNLFILNLAISDLLVGIFCMPTTLLDNIITGWPFGSIVCKLSGMVQGISVSASVFTLVAIAVDRFRCIVYPFRQKLTIGTSKMI--IVIIWVLALFIMCPSGVMLQVTEEPTVRIVVDHRSKTRPFYWCRENWPSQEMR-KIYTTVLFANIYLAPLNLIVIMYARIGFTLFKTTI---------PPTRGSGSATGESSSANKLS-MDGRQTISRKKKRVIMMLVIVALLFVLSWLPLWTLMMLSDYARLTEHQYRV--------INIYVYPFAHWLAFFNSSVNPIIYGFFNENFRRGFQAAFKFQLCS 367          
BLAST of Neuropeptide FF receptor 2 vs. Ensembl Medaka
Match: ENSORLT00000042596.1 (neuropeptide FF receptor 2 [Source:NCBI gene;Acc:101169169])

HSP 1 Score: 112.079 bits (279), Expect = 3.482e-26
Identity = 89/332 (26.81%), Postives = 161/332 (48.49%), Query Frame = 2
Query:  398 GNICVILCVTLFRNMRTISHVFLLNLACSDLLVFLICEPFTIASLINPDWIFGESLCRLNGVFQGTSVGVSILTLTSVCIERYIVIVGKGFNQNRFNFRHLICWVVGIWITSFLITSPLLQAYEVKEKNLTFI--------KPTRYCMETWSGKNNRKKVFTTXXXXXXXXXXXXXXXXXYSKVGNHLRRSTNTLINIENKPSAKRLKTQDTNNVISTHSMSKLNSIKGINNTRQRISKLLMILTLLFAIFWLPYHVTSFIIDFIFGSNIDNNLESFSDVGWLNVYVYPMTQILAYVNNAINPLCTLIISKKFRTTLNQMRKCQFASSSNSK 1369
            GN  V   V   +NM T++++F+LNLA SDLLV + C P T+   I   W FG  +C+++G+ QG SV  S+ TL ++ ++R+  IV   F Q +         +V IW+ +  I  P     +V +++   +         P  +C E W  +  R K++TT++F   YL PL  ++I+Y+++G  L ++T         P+  +   ++ +NV               +  +QR+ K+L+++ LLF + WLP      + D+   +     +        +N+YVYP    LA+ N+++NP+     ++ FR     + K    ++   +
Sbjct:  109 GNGVVCFIVLRSKNMWTVTNLFILNLAVSDLLVGIFCMPTTLLDNIITGWPFGSLVCKMSGMVQGISVSASVFTLVAIAVDRFRCIV-YPFKQ-KLTISTATMIIVIIWVLAVSIMCPSGVMLQVTKEHTVRVLLGYDNKSSPFYWCKEDWPNQEMR-KIYTTVLFANIYLAPLSLIVIMYARIGITLFKTT--------VPTGGKPGQENRHNV---------------SKKKQRVIKMLLVVALLFIMSWLPLWTLMMLSDYARLTEQQYRI--------INIYVYPFAHWLAFFNSSVNPIIYGFFNENFRRGFQAVFKFSLCAADGHR 406          
BLAST of Neuropeptide FF receptor 2 vs. Ensembl Medaka
Match: npffr2b (neuropeptide FF receptor 2-like [Source:NCBI gene;Acc:101174760])

HSP 1 Score: 110.923 bits (276), Expect = 5.699e-26
Identity = 91/328 (27.74%), Postives = 155/328 (47.26%), Query Frame = 2
Query:  395 TGNICVILCVTLFRNMRTISHVFLLNLACSDLLVFLICEPFTIASLINPDWIFGESLCRLNGVFQGTSVGVSILTLTSVCIERYIVIVGKGFNQNRFNFRHLICWVVGIWITSFLITSPLLQAYEVKEKNLTFI--------KPTRYCMETWSGKNNRKKVFTTXXXXXXXXXXXXXXXXXYSKVGNHLRRSTNTLINIENKPSAKRLKTQDTNNVISTHSMSKLNSIKGINNTRQRISKLLMILTLLFAIFWLPYHVTSFIIDFIFGSNIDNNLESFSDVGWLNVYVYPMTQILAYVNNAINPLCTLIISKKFRTTLNQMRKCQFAS 1354
             GN  V   V   +NMRT++++F+LNLA SDLLV + C P T+   I   W FG  +C+L+G+ QG SV  S+ TL ++ ++R+  IV     +       +I  +V IW+ +  I  P     +V E+    I        +P  +C E W  +  R K++TT++F   YL PL  ++I+Y+++G  L ++T                               +   +G + +++R+  +L+I+ LLF + WLP      + D+   +     +        +N+YVYP    LA+ N+++NP+     ++ FR       K Q  S
Sbjct:   60 VGNGVVCFIVLRSKNMRTVTNLFILNLAISDLLVGIFCMPTTLLDNIITGWPFGSIVCKLSGMVQGISVSASVFTLVAIAVDRFRCIVYPFRQKLTIGTSKMI--IVIIWVLALFIMCPSGVMLQVTEEPTVRIVVDHRSKTRPFYWCRENWPSQEMR-KIYTTVLFANIYLAPLNLIVIMYARIGFTLFKTT-------------------------------IPPTRG-SGSKKRVIMMLVIVALLFVLSWLPLWTLMMLSDYARLTEHQYRV--------INIYVYPFAHWLAFFNSSVNPIIYGFFNENFRRGFQAAFKFQLCS 344          
BLAST of Neuropeptide FF receptor 2 vs. Ensembl Medaka
Match: npy2r (neuropeptide Y receptor Y2 [Source:ZFIN;Acc:ZDB-GENE-040924-8])

HSP 1 Score: 107.457 bits (267), Expect = 5.636e-25
Identity = 82/326 (25.15%), Postives = 150/326 (46.01%), Query Frame = 2
Query:  389 GSTGNICVILCVTLFRNMRTISHVFLLNLACSDLLVFLICEPFTIASLINPDWIFGESLCRLNGVFQGTSVGVSILTLTSVCIERYIVIVGKGFNQNRFNFRHLICWVVGIWITSFLITSPLLQAYEVKEKNLTFIKPTRYCMETWSGKNNRKKVFTTXXXXXXXXXXXXXXXXXYSKVGNHLRRSTNTLINIENKPSAKRLKTQDTNNVISTHSMSKLNSIKGINNTRQRISKLLMILTLLFAIFWLPYHVTSFIIDFIFGSNIDNNLESFSDVGWLNVYVYPMTQILAYVNNAINPLCTLIISKKFRTTLNQMRKCQFASSSNS 1366
            G TGN  V+  V  FRN+RT+++ F++NLA +DLLV  +C PFT+   +  +W+FG+ LC L    QG +V VS +TL  + ++R+  IV     +   +   ++  +V  W+ S L+ SPL    E    + +  +  + C E W G +   ++++  + ++   +PL    + Y ++   L+       N   +                                R++ +K+++ + ++FA+ WLP+H     ID      IDN +    D       V+ +  ILA  +  +NP+    ++  +RT    + KC  + + NS
Sbjct:   61 GVTGNSLVVYVVYKFRNLRTVTNFFIINLAVADLLVNTLCLPFTLIYTLYDEWMFGQVLCYLLPFAQGMTVQVSTITLNIIALDRHRSIVHHMETKMSKDMCAMV--IVFSWVISALLASPLAIFREYGSFDFSPEESIQVCTEKWPGSSMNGRLYSMSMLVVQVAIPLAINSVAYIRIWKKLKHHMKCGRNDHQR--------------------------------RRKTTKMMLTMVVVFAVCWLPFHAFQLAID------IDNTVLHMKDFK----LVFTVFHILAMCSTCVNPILYGWMNNNYRTAFLTVCKCCGSLTVNS 342          
BLAST of Neuropeptide FF receptor 2 vs. Ensembl Medaka
Match: npy2rl (neuropeptide Y receptor type 2 [Source:NCBI gene;Acc:101162714])

HSP 1 Score: 104.375 bits (259), Expect = 4.622e-24
Identity = 100/381 (26.25%), Postives = 176/381 (46.19%), Query Frame = 2
Query:  221 DSIKTTNDTMNFVFFENICNQITEQRCQQILYMILKPQTSK----FQIVXXXXXXXXXXXGSTGNICVILCVTLFRNMRTISHVFLLNLACSDLLVFLICEPFTIASLINPDWIFGESLCRLNGVFQGTSVGVSILTLTSVCIERYIVIVGKGFNQNRFNFRHLICW-VVGI-WITSFLITSPLLQAYEVKEKNLTFIKPTRYCMETWSGKNNRKKVFTTXXXXXXXXXXXXXXXXXYSKVGNHLRRSTNTLINIENKPSAKRLKTQDTNNVISTHSMSKLNSIKGINNTRQRISKLLMILTLLFAIFWLPYHVTSFIIDFIFGSNIDNNLESFSDVGWLNVYVYPMTQILAYVNNAINPLCTLIISKKFRTTLNQMRKCQ 1345
            D +K T  T   VFF  +  Q +  RC     + ++P TS      ++VLI+ +  + ++G  GN  VI  +  F+ +RT+++ F+ NLA +DLLV  +C PFT+   +  +W FG +LC L    QG +V VS +TL  + ++R+  IV           R  +C+ V+ + W+ S ++ SPL    E     L      + C E W GK+    +++  + IL Y LPL  +   Y+++ + LR   +      N  +      +                       R++ +K+L+ + ++FA+ WLP+H       F   ++IDN +    D   L    Y +  ++A  +   NPL    +++ +R     + KC+
Sbjct:   11 DDVKNTKIT---VFFYGVALQ-SHCRCVS---LKVEPFTSSALVCLKVVLILAYSTIIVLGVLGNSLVIYVIYRFKTLRTVTNFFIANLAVADLLVNTLCLPFTLVYTLQGEWKFGSTLCFLLPYAQGLAVHVSTVTLNVIALDRHRCIV----YHLETRMRKDVCFGVIALTWVLSAVLASPLAIFREYGSFTLEPGHTIQVCTEKWPGKSTDGTIYSISMLILQYFLPLSIISFAYARIWSKLRGHVSPAEGGANSSAGSERHRR-----------------------RRKTTKMLVTMVVVFAVSWLPFHA------FQLATDIDNKVLDMRDFRLL----YTIFHVVAMCSTFANPLLYGWMNRNYRAAFLAVFKCR 347          
BLAST of Neuropeptide FF receptor 2 vs. Planmine SMEST
Match: SMESG000062880.1 (SMESG000062880.1)

HSP 1 Score: 795.423 bits (2053), Expect = 0.000e+0
Identity = 424/424 (100.00%), Postives = 424/424 (100.00%), Query Frame = 2
Query:  140 MNPQIESWCCFNRLKNNFPQEKTPVQSDSIKTTNDTMNFVFFENICNQITEQRCQQILYMILKPQTSKFQIVXXXXXXXXXXXGSTGNICVILCVTLFRNMRTISHVFLLNLACSDLLVFLICEPFTIASLINPDWIFGESLCRLNGVFQGTSVGVSILTLTSVCIERYIVIVGKGFNQNRFNFRHLICWVVGIWITSFLITSPLLQAYEVKEKNLTFIKPTRYCMETWSGKNNRKKVFTTXXXXXXXXXXXXXXXXXYSKVGNHLRRSTNTLINIENKPSAKRLKTQDTNNVISTHSMSKLNSIKGINNTRQRISKLLMILTLLFAIFWLPYHVTSFIIDFIFGSNIDNNLESFSDVGWLNVYVYPMTQILAYVNNAINPLCTLIISKKFRTTLNQMRKCQFASSSNSKLTKTLYYSQTVNYG 1411
            MNPQIESWCCFNRLKNNFPQEKTPVQSDSIKTTNDTMNFVFFENICNQITEQRCQQILYMILKPQTSKFQIVLIIIFILLFLIGSTGNICVILCVTLFRNMRTISHVFLLNLACSDLLVFLICEPFTIASLINPDWIFGESLCRLNGVFQGTSVGVSILTLTSVCIERYIVIVGKGFNQNRFNFRHLICWVVGIWITSFLITSPLLQAYEVKEKNLTFIKPTRYCMETWSGKNNRKKVFTTIIFILFYLLPLIFMLILYSKVGNHLRRSTNTLINIENKPSAKRLKTQDTNNVISTHSMSKLNSIKGINNTRQRISKLLMILTLLFAIFWLPYHVTSFIIDFIFGSNIDNNLESFSDVGWLNVYVYPMTQILAYVNNAINPLCTLIISKKFRTTLNQMRKCQFASSSNSKLTKTLYYSQTVNYG
Sbjct:    1 MNPQIESWCCFNRLKNNFPQEKTPVQSDSIKTTNDTMNFVFFENICNQITEQRCQQILYMILKPQTSKFQIVLIIIFILLFLIGSTGNICVILCVTLFRNMRTISHVFLLNLACSDLLVFLICEPFTIASLINPDWIFGESLCRLNGVFQGTSVGVSILTLTSVCIERYIVIVGKGFNQNRFNFRHLICWVVGIWITSFLITSPLLQAYEVKEKNLTFIKPTRYCMETWSGKNNRKKVFTTIIFILFYLLPLIFMLILYSKVGNHLRRSTNTLINIENKPSAKRLKTQDTNNVISTHSMSKLNSIKGINNTRQRISKLLMILTLLFAIFWLPYHVTSFIIDFIFGSNIDNNLESFSDVGWLNVYVYPMTQILAYVNNAINPLCTLIISKKFRTTLNQMRKCQFASSSNSKLTKTLYYSQTVNYG 424          
BLAST of Neuropeptide FF receptor 2 vs. Planmine SMEST
Match: SMESG000009621.1 (SMESG000009621.1)

HSP 1 Score: 184.882 bits (468), Expect = 1.989e-53
Identity = 128/347 (36.89%), Postives = 202/347 (58.21%), Query Frame = 2
Query:  332 QTSKFQIVXXXXXXXXXXXGSTGNICVILCVTLFRNMRTISHVFLLNLACSDLLVFLICEPFTIASLINPDWIFGESLCRLNGVFQGTSVGVSILTLTSVCIERYIVIVGKGFNQNRFNFRHLICWVVGIWITSFLITSPLLQAYEVKEKNLTFIKPTRYCMETWSGKNNRKKVFTTXXXXXXXXXXXXXXXXXY----SKVGNHLRRSTNTLINIENKPSAKRLKTQDTNNVISTHSMSKLNSIKGINNTRQRISKLLMILTLLFAIFWLPYHVTSFIIDFIFGSNIDNNLESFSDVGWLNVYVYPMTQILAYVNNAINPLCTLIISKKFRTTLNQMRKCQFASSS 1360
            + S F+++ ++ +I+LF +G  GN+ +++C+   ++MRTIS++FL NLA SDL +FLIC+P ++ ++I   W+FGE  C+L G+ QGT++GVSIL+L  + IERY+ +    F    +  +  I +++GIW  +  I+ PL  + E+K+     I   +YC+ETW G    K+ +T ++F++ Y  PL+ M+ILY    +KV N +++ T T  N   +    RL+TQ                       R RISK+   L  LF I WLPYH+ +   DF     I N  E+ + V +L  Y YP+ Q L Y N+AINPL T+ IS+KFR  + Q+++ +F S S
Sbjct:   43 EISIFKLINLLFYIILFTVGIFGNLLILVCIFSLKHMRTISNMFLANLAISDLFIFLICQPLSLTTIIYSSWVFGEKFCKLQGLLQGTNLGVSILSLLGLNIERYVAVRKMRFGNQLYRRKLCIMYIIGIWCIAGSISLPLAFSTELKKG----IDKKQYCLETWWGTIFWKQFYTIMLFLVLYAFPLLSMIILYYLILTKVKNSMKQQTFT-TNHSTRNYVTRLRTQ-----------------------RTRISKVSTALVCLFTICWLPYHIVNIYADF----QILN--ENQTKVYYLINYGYPIVQWLVYSNSAINPLSTIFISQKFRFAVFQVKQRRFNSRS 355          
BLAST of Neuropeptide FF receptor 2 vs. Planmine SMEST
Match: SMESG000039924.1 (SMESG000039924.1)

HSP 1 Score: 130.954 bits (328), Expect = 3.511e-33
Identity = 103/331 (31.12%), Postives = 173/331 (52.27%), Query Frame = 2
Query:  389 GSTGNICVILCVTLFRNMRTISHVFLLNLACSDLLVFLICEPFTIASLINPDWIFGESLCRLNGVFQGTSVGVSILTLTSVCIERYIVIVGKGFNQNRFNFRHLICWVVGIWITSFLITSPLLQAYEVKEKNLTFIKPTRYCMETWSGKNNRKKVFTTXXXXXXXXXXXXXXXXXYSKVGNHLRRSTNTLINIENKPSAKRLKTQDTNNVISTHSMSKLNSIKGINNTRQRISKLLMILTLLFAIFWLPYHVTSFIIDFIFGSNIDNNLESFSDVGWLNVYVYPMTQILAYVNNAINPLCTLIISKKFRTTLNQMRKCQFASSSNSKLTKT 1381
            G  GN  VI+ V LF+ MR  +++FLLNLA SD+LV  I  PFT+ + +N  + F    C++    Q T+V VS+L+L S+  ER+ VI+     +  F    L  W++ IW+ S  ++ PL  A E+   + +    T  C ETW G    +K++T   F + YL+PL FMLIL+  +   L                 ++  + TN++ S             +N R+++S +L++L L+F I WLP+HV     DFI       ++    D  ++   + P++Q + Y+N++INP C+L+IS KFR  +  + K  ++++ +    ++
Sbjct:   75 GIIGNFLVIMSVLLFQFMRNFANIFLLNLAISDILVLTIAAPFTLFNQVNLVYKFSPFFCQVQSGLQSTTVHVSVLSLMSISFERFYVIMFPMQYKMIFKNSRLKIWLLSIWLLSIALSMPLGYASEIVHVDGS--NNTNQCKETWFGNQLYRKIYTFFSFFILYLIPLFFMLILHFILITKLW----------------KMPKEITNSIRSV----------DYSNRRKKLSIILIMLCLIFLICWLPHHVRCIYNDFIIKIYSAESISRKYD-DFILERLTPISQFMCYLNSSINPFCSLLISTKFRYCVKYIFKYLYSAAKHRGFNRS 376          
BLAST of Neuropeptide FF receptor 2 vs. Planmine SMEST
Match: SMESG000053241.1 (SMESG000053241.1)

HSP 1 Score: 106.686 bits (265), Expect = 6.539e-25
Identity = 89/313 (28.43%), Postives = 164/313 (52.40%), Query Frame = 2
Query:  389 GSTGNICVILCVTLFRNMRTISHVFLLNLACSDLLVFLICEPFTIASLI--NPDWIFGESLCRLNGVFQGTSVGVSILTLTSVCIERYIVIVGKGFNQNRFNFRHLICWVVGIWITSFLITSPLLQAYEVKEKNLTFIKPTRYCMETWSGKNNRKKV-FTTXXXXXXXXXXXXXXXXXYSKVGNHLRRSTNTLINIENKPSAKRLKTQDTNNVISTHSMSKLNSIKGINNTRQRISKLLMI-LTLLFAIFWLPYHVTSFIIDFIFGSNIDNNLESFSDVGWLNVYVYPMTQILAYVNNAINPLCTLIISKKFR 1315
            G+ G+  VI  V   + +RT  ++F+LNLA +DL++    +PF I  L+  + +WIFGE +C+L G+F GT+V VS +++T++ ++RY VI+     +N       I  ++GIWI S +I SPL+    V+  N+     TR    T      + KV ++    +L Y++PL  + I Y K+   +++  N L          +   + +N++ ++H M  L   +  +  RQR + +L++ +T++FAI WLP ++ + I+D     N        S VG +++ +  +  ++   +   NP+    ++  FR
Sbjct:   66 GTLGSSLVIYVVLRSKTLRTPRNMFILNLAITDLILCAFSQPFNIIRLLSFHKEWIFGEWVCKLVGLFTGTNVCVSTISITAIALDRYQVILCP--TRNSLQLIGAIKVMLGIWILSLIIASPLVLFSGVETVNMLKANHTRCTEHTVEIYMRKLKVGYSIATLVLLYVIPLSIVTITYMKIYRIIKQRMNNL---------HKKDLESSNSLPNSHKMELLTDKQKYDIQRQRRANILLLSITIVFAISWLPLNLINMIMDLYLMYN-------ESTVGPMSLRIQSICLLMVLTSACTNPILYGWLNDNFR 360          
BLAST of Neuropeptide FF receptor 2 vs. Planmine SMEST
Match: SMESG000004267.1 (SMESG000004267.1)

HSP 1 Score: 96.6709 bits (239), Expect = 3.385e-21
Identity = 94/354 (26.55%), Postives = 174/354 (49.15%), Query Frame = 2
Query:  389 GSTGNICVILCVTLFRNMRTISHVFLLNLACSDLLVFLICEPFTIASLI---NPDWIFGESLCRLNGVFQGTSVGVSILTLTSVCIERYIVIVGKGFNQNRFNFRHLICWVVGIWITSFLITSPLLQAYEVKEKNLTFIKPTRYCMETWSGKNNRKKVFTTXXXXXXXXXXXXXXXXXYSKVGNHLR-RSTNTLINIENKPSAKRLKTQDTNNVISTHSMSKLNSIKGINNTRQRISKLLMI-LTLLFAIFWLPYHVTSFIIDF-------------------IFGSNIDNNLESFSDVGWLNVYVYPMTQILAYVNNAINPLCTLIISKKFRTTLNQMRKCQFASSSNSKLTK 1378
            G  GN  V+  V  +R ++T  +VF+LNLA SDL + +  +PF +  L+   +P W +G+ LC+++ + QGT+V VS +T+T++ ++R+ VI+    +  + +   ++C +  IWI S ++ SPLL    V + +  +      C E    +   K V+T I  +  Y +P++ + I Y ++   ++ R  N+ IN +     K  K +  N+        K ++ +     RQR + +L+  L++LFA+ WLP ++ +  +                     I  +N  NNL   +     + ++  +  +L   +  INP+    ++  FR  L +M KC    SS+SK +K
Sbjct:   81 GVFGNALVVFAVMRYRQLQTARNVFILNLAISDLCLCIFTQPFNLLRLLVKYHP-WTYGDVLCKMSALLQGTNVFVSTITITAIALDRFQVIIYPTRSAVQ-SLEAVLC-LCSIWIISCIMASPLLLFSRVYKDHRDYYS----CGEDDFRQKTNKLVYTIISIVFQYFVPILIVSIAYIRIYLRIKYRLINSAINTKQIKENKS-KYESINS-------GKFSAKQKKEKQRQRRTNMLLANLSILFALSWLPLNIVNLYMAVKEHNFNFTISTGDKKSSFSIPSTNFSNNLYDTNSNDSYSNFIQAVCLMLVLASACINPILYGWLNDNFRKVLPKMLKC----SSDSKTSK 415          
The following BLAST results are available for this feature:
BLAST of Neuropeptide FF receptor 2 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
NPFFR21.470e-3027.45neuropeptide FF receptor 2 [Source:HGNC Symbol;Acc... [more]
NPFFR21.507e-3027.45neuropeptide FF receptor 2 [Source:HGNC Symbol;Acc... [more]
NPFFR24.094e-2927.45neuropeptide FF receptor 2 [Source:HGNC Symbol;Acc... [more]
QRFPR9.360e-2327.92pyroglutamylated RFamide peptide receptor [Source:... [more]
HCRTR11.383e-1926.75hypocretin receptor 1 [Source:HGNC Symbol;Acc:HGNC... [more]
back to top
BLAST of Neuropeptide FF receptor 2 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
npr-61.582e-2228.44NeuroPeptide Receptor family [Source:UniProtKB/Tr... [more]
npr-43.658e-1825.71NeuroPeptide Receptor family [Source:UniProtKB/Tr... [more]
npr-44.457e-1825.71NeuroPeptide Receptor family [Source:UniProtKB/Tr... [more]
npr-45.081e-1825.71NeuroPeptide Receptor family [Source:UniProtKB/Tr... [more]
npr-46.021e-1825.71NeuroPeptide Receptor family [Source:UniProtKB/Tr... [more]
back to top
BLAST of Neuropeptide FF receptor 2 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
TkR99D2.134e-1725.54gene:FBgn0004622 transcript:FBtr0301656[more]
TkR99D2.659e-1725.54gene:FBgn0004622 transcript:FBtr0085507[more]
TkR99D2.854e-1725.54gene:FBgn0004622 transcript:FBtr0330298[more]
CCHa1-R2.702e-1624.93gene:FBgn0050106 transcript:FBtr0086893[more]
SIFaR7.694e-1626.50gene:FBgn0038880 transcript:FBtr0084098[more]
back to top
BLAST of Neuropeptide FF receptor 2 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CU915819.22.552e-2829.41neuropeptide FF receptor 2a [Source:NCBI gene;Acc:... [more]
AL929374.12.552e-2829.41neuropeptide FF receptor 2a [Source:NCBI gene;Acc:... [more]
NPFFR22.552e-2829.41neuropeptide FF receptor 2a [Source:NCBI gene;Acc:... [more]
NPFFR22.552e-2829.41neuropeptide FF receptor 2a [Source:NCBI gene;Acc:... [more]
npffr2b2.311e-2627.91neuropeptide FF receptor 2b [Source:ZFIN;Acc:ZDB-G... [more]
back to top
BLAST of Neuropeptide FF receptor 2 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
clstn21.081e-2628.22calsyntenin 2 [Source:Xenbase;Acc:XB-GENE-958942][more]
clstn21.373e-2628.22calsyntenin 2 [Source:Xenbase;Acc:XB-GENE-958942][more]
NPFFR23.288e-2430.21neuropeptide FF receptor 2 [Source:NCBI gene;Acc:1... [more]
slc11a26.032e-2427.92solute carrier family 11 member 2 [Source:Xenbase;... [more]
kiss1r5.458e-2226.98KISS1 receptor [Source:NCBI gene;Acc:100316929][more]
back to top
BLAST of Neuropeptide FF receptor 2 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Npffr21.498e-2525.46neuropeptide FF receptor 2 [Source:MGI Symbol;Acc:... [more]
Qrfprl1.025e-2125.32pyroglutamylated RFamide peptide receptor like [So... [more]
Qrfpr2.490e-2126.95pyroglutamylated RFamide peptide receptor [Source:... [more]
Hcrtr11.475e-2026.67hypocretin (orexin) receptor 1 [Source:MGI Symbol;... [more]
Hcrtr11.475e-2026.67hypocretin (orexin) receptor 1 [Source:MGI Symbol;... [more]
back to top
BLAST of Neuropeptide FF receptor 2 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9Y5X5|NPFF2_HUMAN1.966e-2827.45Neuropeptide FF receptor 2 OS=Homo sapiens OX=9606... [more]
sp|Q924H0|NPFF2_MOUSE1.048e-2425.46Neuropeptide FF receptor 2 OS=Mus musculus OX=1009... [more]
sp|Q9EQD2|NPFF2_RAT1.253e-2426.46Neuropeptide FF receptor 2 OS=Rattus norvegicus OX... [more]
sp|Q96P65|QRFPR_HUMAN4.495e-2227.92Pyroglutamylated RF-amide peptide receptor OS=Homo... [more]
sp|Q6BD04|GPR54_ORENI3.464e-2125.45G-protein coupled receptor 54 OS=Oreochromis nilot... [more]
back to top
BLAST of Neuropeptide FF receptor 2 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A193KUQ50.000e+0100.00GCR368 OS=Schmidtea mediterranea OX=79327 GN=gcr36... [more]
A0A193KUH97.152e-5036.89GCR448 OS=Schmidtea mediterranea OX=79327 GN=gcr44... [more]
A0A0K0PUJ74.607e-3627.79Orphan G-protein coupled receptor 58 OS=Platynerei... [more]
A0A4V6ARK81.278e-3128.28G-protein coupled receptor 74 OS=Collichthys lucid... [more]
A0A1I8FU195.204e-3134.63G_PROTEIN_RECEP_F1_2 domain-containing protein OS=... [more]
back to top
BLAST of Neuropeptide FF receptor 2 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
npffr12.031e-2927.80neuropeptide FF receptor 1 [Source:ZFIN;Acc:ZDB-GE... [more]
npffr2b8.051e-2929.04neuropeptide FF receptor 2-like [Source:NCBI gene;... [more]
npffr2b2.244e-2827.27neuropeptide FF receptor 2-like [Source:NCBI gene;... [more]
NPFFR23.580e-2828.74neuropeptide FF receptor 2 [Source:NCBI gene;Acc:1... [more]
npffr18.266e-2727.48neuropeptide FF receptor 1 [Source:ZFIN;Acc:ZDB-GE... [more]
back to top
BLAST of Neuropeptide FF receptor 2 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
npffr1l31.519e-2928.75neuropeptide FF receptor 1 like 3 [Source:ZFIN;Acc... [more]
qrfpr47.390e-2524.61pyroglutamylated RFamide peptide receptor 4 [Sourc... [more]
npy8br1.672e-2027.44neuropeptide Y receptor Y8b [Source:ZFIN;Acc:ZDB-G... [more]
kiss1rb3.088e-1924.53KISS1 receptor b [Source:ZFIN;Acc:ZDB-GENE-060526-... [more]
galr1b1.371e-1726.51galanin receptor 1b [Source:ZFIN;Acc:ZDB-GENE-1406... [more]
back to top
BLAST of Neuropeptide FF receptor 2 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Neuropeptide FF receptor 2 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO428832.664e-2329.90Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO274811.260e-2126.13Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO364533.566e-2126.13Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO444181.031e-2027.97Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO495705.964e-2030.10Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Neuropeptide FF receptor 2 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
npffr2b9.149e-2929.05neuropeptide FF receptor 2-like [Source:NCBI gene;... [more]
ENSORLT00000042596.13.482e-2626.81neuropeptide FF receptor 2 [Source:NCBI gene;Acc:1... [more]
npffr2b5.699e-2627.74neuropeptide FF receptor 2-like [Source:NCBI gene;... [more]
npy2r5.636e-2525.15neuropeptide Y receptor Y2 [Source:ZFIN;Acc:ZDB-GE... [more]
npy2rl4.622e-2426.25neuropeptide Y receptor type 2 [Source:NCBI gene;A... [more]
back to top
BLAST of Neuropeptide FF receptor 2 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000062880.10.000e+0100.00SMESG000062880.1[more]
SMESG000009621.11.989e-5336.89SMESG000009621.1[more]
SMESG000039924.13.511e-3331.12SMESG000039924.1[more]
SMESG000053241.16.539e-2528.43SMESG000053241.1[more]
SMESG000004267.13.385e-2126.55SMESG000004267.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30000095 ID=SMED30000095|Name=Neuropeptide FF receptor 2|organism=Schmidtea mediterranea sexual|type=transcript|length=1579bp
AAATTTTCCTCTAAAAATTATTTATTGTAAAGAATTTTTATTGATGAAAA
TAAAAAAAAAATCGTATAAAGTATCCATTTAAAAACAGTTGCATTGGAAT
ATAACTCTAACATTTATTAAGGAAAACATTTTCGACGAAATGAATCCACA
AATAGAAAGCTGGTGTTGCTTTAATCGTCTGAAAAATAACTTTCCTCAAG
AAAAGACTCCAGTCCAATCGGACTCGATTAAAACAACAAATGACACAATG
AATTTCGTGTTTTTTGAAAATATTTGCAACCAAATAACCGAACAACGATG
TCAACAGATTTTATATATGATTCTAAAGCCACAGACCTCAAAATTTCAGA
TAGTTTTAATAATAATTTTCATTCTACTTTTCCTAATTGGAAGCACAGGA
AATATTTGCGTGATTTTATGCGTGACTCTCTTTCGAAACATGAGAACGAT
TTCTCATGTGTTTCTATTGAATCTTGCATGTAGTGATTTGTTAGTATTTT
TGATTTGTGAACCTTTTACTATTGCTTCTTTGATTAATCCAGACTGGATT
TTCGGTGAATCTTTGTGTCGATTGAATGGGGTTTTCCAAGGAACATCTGT
CGGAGTAAGTATTTTAACTCTGACTAGTGTTTGTATAGAAAGATATATTG
TCATTGTTGGGAAAGGTTTCAATCAAAACCGGTTCAATTTTCGACACTTG
ATTTGTTGGGTTGTTGGAATCTGGATAACGTCTTTTCTCATTACCTCGCC
ACTACTTCAGGCGTATGAGGTTAAAGAAAAAAATCTTACATTTATCAAAC
CAACCCGATATTGTATGGAGACTTGGTCTGGAAAGAACAACAGGAAAAAG
GTTTTCACAACAATTATATTTATTTTATTTTATCTTCTACCTTTGATATT
TATGTTGATTCTTTATTCGAAAGTAGGAAATCATTTAAGACGAAGCACTA
ACACATTGATAAATATTGAAAATAAACCATCCGCAAAACGACTAAAAACC
CAGGATACCAATAATGTCATATCAACCCATTCAATGTCAAAATTAAACTC
TATAAAAGGTATTAACAATACTCGACAACGAATTTCGAAACTATTAATGA
TTCTCACTTTATTATTCGCAATATTTTGGTTGCCTTACCACGTAACCAGT
TTCATTATAGACTTCATCTTTGGTAGCAATATTGACAACAACTTAGAATC
ATTCTCAGATGTCGGATGGTTAAACGTATATGTCTATCCCATGACACAGA
TTCTTGCGTATGTCAATAACGCTATCAACCCTTTGTGCACGCTAATTATT
TCGAAAAAGTTTCGAACTACTCTCAACCAAATGAGAAAATGCCAATTTGC
TTCCTCTTCGAATTCAAAGTTAACAAAAACTCTTTACTATAGTCAAACTG
TAAATTATGGCTAAAGGTTTCCGGAAGTAAATTTTCAATGAGAGATCATT
TGAATGAATATTTTATATTTATAGCAAACTGTCATTGAAGATTCTATTAA
GGAAAACGGACTTGAACCGTAGACATGAATGCGACACTAATATACGTGTT
TCGGTTAAAAACTGTTTGTATCAACAATT
back to top

protein sequence of SMED30000095-orf-1

>SMED30000095-orf-1 ID=SMED30000095-orf-1|Name=SMED30000095-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=425bp
MNPQIESWCCFNRLKNNFPQEKTPVQSDSIKTTNDTMNFVFFENICNQIT
EQRCQQILYMILKPQTSKFQIVLIIIFILLFLIGSTGNICVILCVTLFRN
MRTISHVFLLNLACSDLLVFLICEPFTIASLINPDWIFGESLCRLNGVFQ
GTSVGVSILTLTSVCIERYIVIVGKGFNQNRFNFRHLICWVVGIWITSFL
ITSPLLQAYEVKEKNLTFIKPTRYCMETWSGKNNRKKVFTTIIFILFYLL
PLIFMLILYSKVGNHLRRSTNTLINIENKPSAKRLKTQDTNNVISTHSMS
KLNSIKGINNTRQRISKLLMILTLLFAIFWLPYHVTSFIIDFIFGSNIDN
NLESFSDVGWLNVYVYPMTQILAYVNNAINPLCTLIISKKFRTTLNQMRK
CQFASSSNSKLTKTLYYSQTVNYG*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: biological process
TermDefinition
GO:0007218neuropeptide signaling pathway
GO:0043408regulation of MAPK cascade
GO:0045761regulation of adenylate cyclase activity
GO:2000479regulation of cAMP-dependent protein kinase activity
GO:0007186G-protein coupled receptor signaling pathway
GO:0007165signal transduction
Vocabulary: molecular function
TermDefinition
GO:0008188neuropeptide receptor activity
GO:0031628opioid receptor binding
GO:0004930G-protein coupled receptor activity
GO:0004871signal transducer activity
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR000276GPCR_Rhodpsn
IPR017452GPCR_Rhodpsn_7TM
Vocabulary: cellular component
TermDefinition
GO:0016021integral component of membrane
GO:0016020membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000276G protein-coupled receptor, rhodopsin-likePRINTSPR00237GPCRRHODOPSNcoord: 315..339
score: 26.31
coord: 72..96
score: 25.82
coord: 186..207
score: 21.4
coord: 240..263
score: 24.25
coord: 105..126
score: 35.3
coord: 150..172
score: 29.31
coord: 366..392
score: 27.1
IPR000276G protein-coupled receptor, rhodopsin-likePFAMPF000017tm_1coord: 87..383
e-value: 4.4E-41
score: 140.9
IPR000276G protein-coupled receptor, rhodopsin-likePROSITEPS00237G_PROTEIN_RECEP_F1_1coord: 156..172
NoneNo IPR availableGENE3DG3DSA:1.20.1070.10coord: 47..422
e-value: 1.8E-67
score: 229.3
NoneNo IPR availablePANTHERPTHR45695FAMILY NOT NAMEDcoord: 64..400
NoneNo IPR availableCDDcd149937tmA_CCKR-likecoord: 86..393
e-value: 1.01299E-59
score: 194.74
NoneNo IPR availableSUPERFAMILYSSF81321Family A G protein-coupled receptor-likecoord: 64..408
NoneNo IPR availableTMHMMTMhelixcoord: 73..95
NoneNo IPR availableTMHMMTMhelixcoord: 238..260
NoneNo IPR availableTMHMMTMhelixcoord: 366..388
NoneNo IPR availableTMHMMTMhelixcoord: 187..209
NoneNo IPR availableTMHMMTMhelixcoord: 318..340
NoneNo IPR availableTMHMMTMhelixcoord: 107..129
NoneNo IPR availableTMHMMTMhelixcoord: 144..166
IPR017452GPCR, rhodopsin-like, 7TMPROSITEPS50262G_PROTEIN_RECEP_F1_2coord: 87..384
score: 37.202