Quinone oxidoreductase

Overview
NameQuinone oxidoreductase
Smed IDSMED30000093
Length (bp)1080
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Quinone oxidoreductase (SMED30000093) t-SNE clustered cells

Violin plots show distribution of expression levels for Quinone oxidoreductase (SMED30000093) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Quinone oxidoreductase (SMED30000093) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Quinone oxidoreductase (SMED30000093) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30000093

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 1

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynxSMED30000093SMESG000006168.1 dd_Smed_v4_2717_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Quinone oxidoreductase vs. Ensembl Human
Match: CRYZ (crystallin zeta [Source:HGNC Symbol;Acc:HGNC:2419])

HSP 1 Score: 284.263 bits (726), Expect = 1.167e-93
Identity = 152/321 (47.35%), Postives = 213/321 (66.36%), Query Frame = 3
Query:   24 MKAIRISEFGEPCVLKLIENLMIPKPSENEVLIEVKYAGVNPVDTYRRAGKYSVLPTLPWVPGSDCSGIISALGSNIRDKFSIGQRVFTTSTITGSYXXXXXXXXXXXXXXPSKLSFQQGASLGTPYFTAYSALFDRGQAKSGETVLIHGASGAVGIAAIQLAKANNLTVIGTAGTTEGLDMIKSIGADYVFNHNADGYVNEIKGQFANK-INIVIEMLANQNLVVDCEMAAIKARIMIVGCRGTINFDPRLTMGKLLDVRGVALGMNSLDQWENAGLQMSNWMESGDICPIISKEYDLQDAGKAHHDIIFNSGTTGKLVL 983
            M+A+R+ EFG P VLKL  ++ +P P +++VLI+V   GVNPV+TY R+G YS  P LP+ PGSD +G+I A+G N    F  G RVFT+STI+G YA +ALA+ H V+ LP KL F+QGA++G PYFTAY AL      K+GE+VL+HGASG VG+AA Q+A+A  L ++GTAGT EG  ++   GA  VFNH    Y+++IK     K I+I+IEMLAN NL  D  + +   R+++VG RGTI  +PR TM K   + GV L  ++ ++++     +   ME G + P+I  +Y L+   +AH +II  SG TGK++L
Sbjct:    8 MRAVRVFEFGGPEVLKLRSDIAVPIPKDHQVLIKVHACGVNPVETYIRSGTYSRKPLLPYTPGSDVAGVIEAVGDN-ASAFKKGDRVFTSSTISGGYAEYALAADHTVYKLPEKLDFKQGAAIGIPYFTAYRALIHSACVKAGESVLVHGASGGVGLAACQIARAYGLKILGTAGTEEGQKIVLQNGAHEVFNHREVNYIDKIKKYVGEKGIDIIIEMLANVNLSKDLSLLSHGGRVIVVGSRGTIEINPRDTMAKESSIIGVTLFSSTKEEFQQYAAALQAGMEIGWLKPVIGSQYPLEKVAEAHENIIHGSGATGKMIL 327          
BLAST of Quinone oxidoreductase vs. Ensembl Human
Match: CRYZ (crystallin zeta [Source:HGNC Symbol;Acc:HGNC:2419])

HSP 1 Score: 284.263 bits (726), Expect = 1.167e-93
Identity = 152/321 (47.35%), Postives = 213/321 (66.36%), Query Frame = 3
Query:   24 MKAIRISEFGEPCVLKLIENLMIPKPSENEVLIEVKYAGVNPVDTYRRAGKYSVLPTLPWVPGSDCSGIISALGSNIRDKFSIGQRVFTTSTITGSYXXXXXXXXXXXXXXPSKLSFQQGASLGTPYFTAYSALFDRGQAKSGETVLIHGASGAVGIAAIQLAKANNLTVIGTAGTTEGLDMIKSIGADYVFNHNADGYVNEIKGQFANK-INIVIEMLANQNLVVDCEMAAIKARIMIVGCRGTINFDPRLTMGKLLDVRGVALGMNSLDQWENAGLQMSNWMESGDICPIISKEYDLQDAGKAHHDIIFNSGTTGKLVL 983
            M+A+R+ EFG P VLKL  ++ +P P +++VLI+V   GVNPV+TY R+G YS  P LP+ PGSD +G+I A+G N    F  G RVFT+STI+G YA +ALA+ H V+ LP KL F+QGA++G PYFTAY AL      K+GE+VL+HGASG VG+AA Q+A+A  L ++GTAGT EG  ++   GA  VFNH    Y+++IK     K I+I+IEMLAN NL  D  + +   R+++VG RGTI  +PR TM K   + GV L  ++ ++++     +   ME G + P+I  +Y L+   +AH +II  SG TGK++L
Sbjct:    8 MRAVRVFEFGGPEVLKLRSDIAVPIPKDHQVLIKVHACGVNPVETYIRSGTYSRKPLLPYTPGSDVAGVIEAVGDN-ASAFKKGDRVFTSSTISGGYAEYALAADHTVYKLPEKLDFKQGAAIGIPYFTAYRALIHSACVKAGESVLVHGASGGVGLAACQIARAYGLKILGTAGTEEGQKIVLQNGAHEVFNHREVNYIDKIKKYVGEKGIDIIIEMLANVNLSKDLSLLSHGGRVIVVGSRGTIEINPRDTMAKESSIIGVTLFSSTKEEFQQYAAALQAGMEIGWLKPVIGSQYPLEKVAEAHENIIHGSGATGKMIL 327          
BLAST of Quinone oxidoreductase vs. Ensembl Human
Match: CRYZ (crystallin zeta [Source:HGNC Symbol;Acc:HGNC:2419])

HSP 1 Score: 249.595 bits (636), Expect = 1.321e-80
Identity = 139/320 (43.44%), Postives = 194/320 (60.62%), Query Frame = 3
Query:   24 MKAIRISEFGEPCVLKLIENLMIPKPSENEVLIEVKYAGVNPVDTYRRAGKYSVLPTLPWVPGSDCSGIISALGSNIRDKFSIGQRVFTTSTITGSYXXXXXXXXXXXXXXPSKLSFQQGASLGTPYFTAYSALFDRGQAKSGETVLIHGASGAVGIAAIQLAKANNLTVIGTAGTTEGLDMIKSIGADYVFNHNADGYVNEIKGQFANKINIVIEMLANQNLVVDCEMAAIKARIMIVGCRGTINFDPRLTMGKLLDVRGVALGMNSLDQWENAGLQMSNWMESGDICPIISKEYDLQDAGKAHHDIIFNSGTTGKLVL 983
            M+A+R+ EFG P VLKL  ++ +P P +++VLI+V   GVNPV+TY R+G YS  P LP+ PGSD +G+I A+G N    F  G RVFT+STI+G YA +ALA+ H V+ LP KL F+QGA++G PYFTAY AL      K+GE+VL+HGASG VG+AA Q+A+A  L ++GTAGT EG  ++   GA  VFNH    Y+++IK                                 +VG RGTI  +PR TM K   + GV L  ++ ++++     +   ME G + P+I  +Y L+   +AH +II  SG TGK++L
Sbjct:    8 MRAVRVFEFGGPEVLKLRSDIAVPIPKDHQVLIKVHACGVNPVETYIRSGTYSRKPLLPYTPGSDVAGVIEAVGDNA-SAFKKGDRVFTSSTISGGYAEYALAADHTVYKLPEKLDFKQGAAIGIPYFTAYRALIHSACVKAGESVLVHGASGGVGLAACQIARAYGLKILGTAGTEEGQKIVLQNGAHEVFNHREVNYIDKIK---------------------------------VVGSRGTIEINPRDTMAKESSIIGVTLFSSTKEEFQQYAAALQAGMEIGWLKPVIGSQYPLEKVAEAHENIIHGSGATGKMIL 293          
BLAST of Quinone oxidoreductase vs. Ensembl Human
Match: CRYZ (crystallin zeta [Source:HGNC Symbol;Acc:HGNC:2419])

HSP 1 Score: 223.402 bits (568), Expect = 4.115e-71
Identity = 121/237 (51.05%), Postives = 163/237 (68.78%), Query Frame = 3
Query:   24 MKAIRISEFGEPCVLKLIENLMIPKPSENEVLIEVKYAGVNPVDTYRRAGKYSVLPTLPWVPGSDCSGIISALGSNIRDKFSIGQRVFTTSTITGSYXXXXXXXXXXXXXXPSKLSFQQGASLGTPYFTAYSALFDRGQAKSGETVLIHGASGAVGIAAIQLAKANNLTVIGTAGTTEGLDMIKSIGADYVFNHNADGYVNEIKGQFANK-INIVIEMLANQNLVVDCEMAAIKARI 731
            M+A+R+ EFG P VLKL  ++ +P P +++VLI+V   GVNPV+TY R+G YS  P LP+ PGSD +G+I A+G N    F  G RVFT+STI+G YA +ALA+ H V+ LP KL F+QGA++G PYFTAY AL      K+GE+VL+HGASG VG+AA Q+A+A  L ++GTAGT EG  ++   GA  VFNH    Y+++IK     K I+I+IEMLAN NL  D  + +   R+
Sbjct:    8 MRAVRVFEFGGPEVLKLRSDIAVPIPKDHQVLIKVHACGVNPVETYIRSGTYSRKPLLPYTPGSDVAGVIEAVGDNA-SAFKKGDRVFTSSTISGGYAEYALAADHTVYKLPEKLDFKQGAAIGIPYFTAYRALIHSACVKAGESVLVHGASGGVGLAACQIARAYGLKILGTAGTEEGQKIVLQNGAHEVFNHREVNYIDKIKKYVGEKGIDIIIEMLANVNLSKDLSLLSHGGRV 243          
BLAST of Quinone oxidoreductase vs. Ensembl Human
Match: CRYZ (crystallin zeta [Source:HGNC Symbol;Acc:HGNC:2419])

HSP 1 Score: 200.675 bits (509), Expect = 8.698e-63
Identity = 106/200 (53.00%), Postives = 141/200 (70.50%), Query Frame = 3
Query:   24 MKAIRISEFGEPCVLKLIENLMIPKPSENEVLIEVKYAGVNPVDTYRRAGKYSVLPTLPWVPGSDCSGIISALGSNIRDKFSIGQRVFTTSTITGSYXXXXXXXXXXXXXXPSKLSFQQGASLGTPYFTAYSALFDRGQAKSGETVLIHGASGAVGIAAIQLAKANNLTVIGTAGTTEGLDMIKSIGADYVFNHNADGYV 623
            M+A+R+ EFG P VLKL  ++ +P P +++VLI+V   GVNPV+TY R+G YS  P LP+ PGSD +G+I A+G N    F  G RVFT+STI+G YA +ALA+ H V+ LP KL F+QGA++G PYFTAY AL      K+GE+VL+HGASG VG+AA Q+A+A  L ++GTAGT EG  ++   GA  VFNH    Y+
Sbjct:    8 MRAVRVFEFGGPEVLKLRSDIAVPIPKDHQVLIKVHACGVNPVETYIRSGTYSRKPLLPYTPGSDVAGVIEAVGDNA-SAFKKGDRVFTSSTISGGYAEYALAADHTVYKLPEKLDFKQGAAIGIPYFTAYRALIHSACVKAGESVLVHGASGGVGLAACQIARAYGLKILGTAGTEEGQKIVLQNGAHEVFNHREVNYI 206          
BLAST of Quinone oxidoreductase vs. Ensembl Celegans
Match: F39B2.3 (pep chromosome:WBcel235:I:14788125:14789517:-1 gene:WBGene00009554.1 transcript:F39B2.3.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:F39B2.3)

HSP 1 Score: 230.72 bits (587), Expect = 2.749e-73
Identity = 126/329 (38.30%), Postives = 194/329 (58.97%), Query Frame = 3
Query:    9 ILYEKMKAIRISEFGEPCVLKLIENLMIPKPSENEVLIEVKYAGVNPVDTYRRAGKYSVLPTLPWVPGSDCSGIISALGSNIRDKFSIGQRVFTTSTI--TGSYXXXXXXXXXXXXXXPSKLSFQQGASLGTPYFTAYSALFDRGQAKSGETVLIHGASGAVGIAAIQLAKANNLTVIGTAGTTEGLDMIKSIGADYVFNHNADGYVNEIKGQFANKINIVIEMLANQNLVVDCEMAAIKARIMIVGCRGTINFDPRLTMGKLLDVRGVALGMNSLDQWENAGLQMSNWMESGDICPIISKEYDLQDAGKAHHDIIFNSGTTGKLVLRI 989
            I    M+A  +  FG P V++ +E+ M P+  +N+VL+    AGVNPVDTY RAG+Y  LP LP+VPG D +G +  +G ++++   +G RV+  S    T  Y +            P  +SF++GASLG PY TAY ALF    AK+G+ +L+HGASG VG A +QLA   N+  +GTAG+ +G+  +KS+GA  V+NH+   YV+++K  +    N + EM A+ NL  D  + A + R+ ++G R     + R  M     V GVALGM+S  +  + G+ + ++++  +  P+I+K Y L+  G AH +I+ N G  G LV++I
Sbjct:    5 ICKSSMRAAVVRRFGAPDVIEAVESDM-PRLEKNQVLVRNYAAGVNPVDTYIRAGQYGKLPNLPYVPGKDGAGFVELVGESVKN-VKVGDRVWYGSEADSTAEYVAVNRPFEL-----PEGVSFEEGASLGVPYLTAYRALFHLAGAKTGDVILVHGASGGVGSALMQLAAWRNIEAVGTAGSADGIRFVKSLGARNVYNHSDKQYVSKMKNDYPGGFNHIFEMAAHTNLNTDLGLLAPRGRVAVIGNRAETTINARQLMVTEGAVYGVALGMSSEAELLDFGINIVSFLKETEFRPLINKLYRLEQLGLAHEEIMNNKGAKGNLVVQI 326          
BLAST of Quinone oxidoreductase vs. Ensembl Celegans
Match: rad-8 (Reticulon-4-interacting protein 1, mitochondrial [Source:UniProtKB/Swiss-Prot;Acc:Q4W4Z2])

HSP 1 Score: 74.7146 bits (182), Expect = 1.010e-14
Identity = 90/359 (25.07%), Postives = 155/359 (43.18%), Query Frame = 3
Query:   39 ISEFGEPCVLKLIENLMIPKPSENEVLIEVKYAGVNPVDT-----YRRA--GKYSVLPT-------LPWVPGSDCSGIISALGSNIRDKFSIGQRVFTTSTIT--GSYXXXXXXXXXXXXXXPSKLSFQQGASLGTPYFTAYSAL----FDRGQAKSGETVLIHGASGAVGIAAIQLAKANNLTVIGTAGTTEGLDMIKSIGADYVFNHNADGYVNEIKGQFANKINIVIEMLANQNLVVDCEMAAIKARIMIVGCRGTINFDPRLTMGKLLDVRGVALGM--NSLDQWENAGL---------------------QMSNWMESGDICPIISKEYDLQDAGKAHHDIIFNSGTTGKLVLR 986
            +SE G    LK +   +I KP   +VL++VK A VNP+D      Y R   G +  + +        P +PG DC+ ++ ++G ++ +  + G  V     +   G++A   +    +    PS LSF   A+L     TAYSA       +  AK  + VLIHG +G VG  AIQL KA     I         D++K +GA  V ++ +D    E+         ++++        VD ++A     +M V  R  ++      + + +D  GV LG+   ++  +E +                       Q+S + E G I P++ +    ++  KA+  +   +G  GK V++
Sbjct:   22 VSENGSGVELKEVPLPVINKP--GQVLLKVKAASVNPIDVDMSQGYGREFLGTWKKIESCDAAASRFPLIPGRDCTAVVESVGGDVHN-LAPGDEVMAVVPVILPGTHAEFVVTDSKYCSKKPSNLSFVSAAALPYVASTAYSAFTIARVSQRNAKQ-QRVLIHGGAGGVGSMAIQLLKAWGCEKIVATCAKGSFDIVKQLGAIPV-DYTSDQATQELIEH--APFEVILD-------TVDSQLAKWSDNVMGV-WRNCVHVSIVSPLMREMDKNGVPLGLVTTAMKHFERSFQSHLRGRWFSYAFFRPSSDLMSQLSRFAEDGKIVPVVEQVMGFEELEKAYEKVSQLNG-RGKTVIK 364          
BLAST of Quinone oxidoreductase vs. Ensembl Celegans
Match: rad-8 (Reticulon-4-interacting protein 1, mitochondrial [Source:UniProtKB/Swiss-Prot;Acc:Q4W4Z2])

HSP 1 Score: 74.7146 bits (182), Expect = 1.010e-14
Identity = 90/359 (25.07%), Postives = 155/359 (43.18%), Query Frame = 3
Query:   39 ISEFGEPCVLKLIENLMIPKPSENEVLIEVKYAGVNPVDT-----YRRA--GKYSVLPT-------LPWVPGSDCSGIISALGSNIRDKFSIGQRVFTTSTIT--GSYXXXXXXXXXXXXXXPSKLSFQQGASLGTPYFTAYSAL----FDRGQAKSGETVLIHGASGAVGIAAIQLAKANNLTVIGTAGTTEGLDMIKSIGADYVFNHNADGYVNEIKGQFANKINIVIEMLANQNLVVDCEMAAIKARIMIVGCRGTINFDPRLTMGKLLDVRGVALGM--NSLDQWENAGL---------------------QMSNWMESGDICPIISKEYDLQDAGKAHHDIIFNSGTTGKLVLR 986
            +SE G    LK +   +I KP   +VL++VK A VNP+D      Y R   G +  + +        P +PG DC+ ++ ++G ++ +  + G  V     +   G++A   +    +    PS LSF   A+L     TAYSA       +  AK  + VLIHG +G VG  AIQL KA     I         D++K +GA  V ++ +D    E+         ++++        VD ++A     +M V  R  ++      + + +D  GV LG+   ++  +E +                       Q+S + E G I P++ +    ++  KA+  +   +G  GK V++
Sbjct:   22 VSENGSGVELKEVPLPVINKP--GQVLLKVKAASVNPIDVDMSQGYGREFLGTWKKIESCDAAASRFPLIPGRDCTAVVESVGGDVHN-LAPGDEVMAVVPVILPGTHAEFVVTDSKYCSKKPSNLSFVSAAALPYVASTAYSAFTIARVSQRNAKQ-QRVLIHGGAGGVGSMAIQLLKAWGCEKIVATCAKGSFDIVKQLGAIPV-DYTSDQATQELIEH--APFEVILD-------TVDSQLAKWSDNVMGV-WRNCVHVSIVSPLMREMDKNGVPLGLVTTAMKHFERSFQSHLRGRWFSYAFFRPSSDLMSQLSRFAEDGKIVPVVEQVMGFEELEKAYEKVSQLNG-RGKTVIK 364          
BLAST of Quinone oxidoreductase vs. Ensembl Celegans
Match: mecr-1 (Enoyl-[acyl-carrier-protein] reductase, mitochondrial [Source:UniProtKB/Swiss-Prot;Acc:O45903])

HSP 1 Score: 66.6254 bits (161), Expect = 5.304e-12
Identity = 52/188 (27.66%), Postives = 89/188 (47.34%), Query Frame = 3
Query:   57 PCVLKLIENLMIPKPSENEVLIEVKYAGVNPVDTYRRAGKYSVLPTLPWVPGSDCSGIISALGSNIRDKFSIGQRVFTTSTITGSYXXXXXXXXXXXXXXPSKLSFQQGASLGTPYFTAYSALFDRGQAKSGETVLIHGASGAVGIAAIQLAKANNLTVIGTAGTTEGLD----MIKSIGADYVFNHN 608
            P  ++L    +  KPS ++VL++   A +NP D  +  G Y V P LP V G++  G + ++GSN+     +G  V    +  G++    L   + +  + + LS +  A+      TAY  L D    K G+TV  +GA+ AVG   IQ+ +   +  +    + + L+     +K +GAD V    
Sbjct:   29 PEAIQLKTVTIADKPSADQVLVQWIAAPINPADLNQIQGVYPVKPALPAVGGNEGFGKVISVGSNV-SSIKVGDHVIPDRSGLGTWRELGLHQENDLFPIDNTLSMEYAATFQVNPPTAYRMLKDFIDLKKGDTVAQNGANSAVGKHVIQICRILGIKTVNVVRSRDNLEELVKELKDLGADEVITQE 215          
BLAST of Quinone oxidoreductase vs. Ensembl Celegans
Match: Y48A6B.9 (Enoyl-[acyl-carrier-protein] reductase, mitochondrial [Source:UniProtKB/Swiss-Prot;Acc:Q9XXC8])

HSP 1 Score: 63.5438 bits (153), Expect = 5.731e-11
Identity = 59/229 (25.76%), Postives = 103/229 (44.98%), Query Frame = 3
Query:   21 KMKAIRISEFGEPCVLKLIENLMIP-KPSENEVLIEVKYAGVNPVDTYRRAGKYSVLPTLPWVPGSDCSGIISALGSNIRDKFSIGQRVFTTSTITGSYXXXXXXXXXXXXXXPSKLSFQQGASLGTPYFTAYSALFDRGQAKSGETVLIHGASGAVGIAAIQLAKANNLTVIGTAGTTEGLDMIKS----IGADYVFNHNADGYVNEIKG---QFANKINIVIEMLAN 683
            + +A+   +FG+P  +  +E + +P +P   E L+E   + +NP+D  R  G Y+V   LP + GS+  G +   GS  R  F  G  V   S  T  +    +     +  L +++     A+L     TA+  L      + G+ ++ + A+  VG + I++ KA     I      + ++ +K+    IGAD+VF         E KG   QF   IN+  ++  N
Sbjct:    6 RSQALIYRKFGDPLKVLQLETVEVPAEPGSGECLVEWLASPINPLDINRIQGNYAVRAELPVIGGSEGVGRVVKAGSGSR--FKSGDHVTIFSANTPIWTEFGVVDDDELVKLDNRIPLDLAATLMINPPTAWIMLKKYVNLQKGDYIIQNSANSGVGRSVIEMCKALGYKSINIVRNRQNIEALKTDLWRIGADHVFTE------EEFKGTSRQFLKSINVRPKLALN 226          
BLAST of Quinone oxidoreductase vs. Ensembl Fly
Match: CG16935 (gene:FBgn0033883 transcript:FBtr0087622)

HSP 1 Score: 82.8037 bits (203), Expect = 2.380e-17
Identity = 60/198 (30.30%), Postives = 102/198 (51.52%), Query Frame = 3
Query:   27 KAIRISEFGEPC-VLKLIENLMIPKPSENEVLIEVKYAGVNPVDTYRRAGKYSVLPTLPWVPGSDCSGIISALGSNIRDKFSIGQRVFTTSTITGSYXXXXXXXXXXXXXXPSKLSFQQGASLGTPYFTAYSALFDRGQAKSGETVLIHGASGAVGIAAIQLAKANNLTVIGTAG----TTEGLDMIKSIGADYVFNH 605
            K+++ ++ GEP  VL+L+E+  +P P +N+VL+++  A +NP D     GKY V P  P V G++C   +  +G  ++  F  GQ V   ++  G++ +HA+     +  +  K+   + A+      TAY  L D  Q   G+TV+ +GA+ AVG A  QL +A  +  +G         E   M++ +GA  V   
Sbjct:   24 KSLKYTQHGEPQEVLQLVED-KLPDPKDNQVLVKILAAPINPADINTIQGKYPVKPKFPAVGGNECVAEVICVGDKVKG-FEAGQHVIPLASGLGTWTTHAVYKEDQLLIVSKKVGLAEAATSTVNPTTAYRMLKDFVQLCPGDTVIQNGANSAVGQAVHQLCRAWGINSVGIVRDRPEIAELKQMLQCLGATEVLTE 219          
BLAST of Quinone oxidoreductase vs. Ensembl Fly
Match: CG16935 (gene:FBgn0033883 transcript:FBtr0339954)

HSP 1 Score: 82.8037 bits (203), Expect = 2.380e-17
Identity = 60/198 (30.30%), Postives = 102/198 (51.52%), Query Frame = 3
Query:   27 KAIRISEFGEPC-VLKLIENLMIPKPSENEVLIEVKYAGVNPVDTYRRAGKYSVLPTLPWVPGSDCSGIISALGSNIRDKFSIGQRVFTTSTITGSYXXXXXXXXXXXXXXPSKLSFQQGASLGTPYFTAYSALFDRGQAKSGETVLIHGASGAVGIAAIQLAKANNLTVIGTAG----TTEGLDMIKSIGADYVFNH 605
            K+++ ++ GEP  VL+L+E+  +P P +N+VL+++  A +NP D     GKY V P  P V G++C   +  +G  ++  F  GQ V   ++  G++ +HA+     +  +  K+   + A+      TAY  L D  Q   G+TV+ +GA+ AVG A  QL +A  +  +G         E   M++ +GA  V   
Sbjct:   24 KSLKYTQHGEPQEVLQLVED-KLPDPKDNQVLVKILAAPINPADINTIQGKYPVKPKFPAVGGNECVAEVICVGDKVKG-FEAGQHVIPLASGLGTWTTHAVYKEDQLLIVSKKVGLAEAATSTVNPTTAYRMLKDFVQLCPGDTVIQNGANSAVGQAVHQLCRAWGINSVGIVRDRPEIAELKQMLQCLGATEVLTE 219          
BLAST of Quinone oxidoreductase vs. Ensembl Fly
Match: FASN2 (gene:FBgn0042627 transcript:FBtr0335386)

HSP 1 Score: 72.0182 bits (175), Expect = 2.659e-13
Identity = 74/243 (30.45%), Postives = 112/243 (46.09%), Query Frame = 3
Query:   51 GEPCVLKLIENLMIPKPSENEVLIE---VKYAGVNPVDTYRRAGKYSVLPTLPWVPG----SDCSGIISALGSNIRDKFSIGQRVFTTSTITGSYXXXXXXXXXXXXXXPSKLSFQQGASLGTPYFTAYSALFDRGQAKSGETVLIHGASGAVGIAAIQLAKANNLTVIGTAGTTEG----LDMIKSIGADYVFNHNADGYVNEIKGQ-FANKINIVIEMLANQNLVVDCEMAAIKARIMIVG 743
            G+   L+ IE+   P+ S  +  +E   V YA +N  D    +GK  V      +PG     DC      LG     + S G+RV    T   S A++ LA+ + +  +PSK + +Q +++   Y T Y AL  RGQ K GE +LIH  SG VG AAI +A A+ LTV  T G+ E     L     + A  + N     +   I  +   N + +V+  L+ + L       A+  R + +G
Sbjct: 1448 GDLSSLRWIES---PRSSPIQSQLEPCTVYYAPLNFRDVMLASGKLGV----DALPGDLAYQDC-----VLGLEFAGRDSCGRRVMAMVT-AKSLATNCLANRNLLWEVPSKWTMEQASTVPCVYATVYYALVVRGQMKEGERILIHAGSGGVGQAAISVALAHGLTVFTTVGSKEKREFLLKRFPKLKAKNIGNSRDTSFEQLIMSETHGNGVELVLNSLSEEKLQASIRCLALNGRFLEIG 1677          
BLAST of Quinone oxidoreductase vs. Ensembl Fly
Match: FASN2 (gene:FBgn0042627 transcript:FBtr0077657)

HSP 1 Score: 72.0182 bits (175), Expect = 2.707e-13
Identity = 74/243 (30.45%), Postives = 112/243 (46.09%), Query Frame = 3
Query:   51 GEPCVLKLIENLMIPKPSENEVLIE---VKYAGVNPVDTYRRAGKYSVLPTLPWVPG----SDCSGIISALGSNIRDKFSIGQRVFTTSTITGSYXXXXXXXXXXXXXXPSKLSFQQGASLGTPYFTAYSALFDRGQAKSGETVLIHGASGAVGIAAIQLAKANNLTVIGTAGTTEG----LDMIKSIGADYVFNHNADGYVNEIKGQ-FANKINIVIEMLANQNLVVDCEMAAIKARIMIVG 743
            G+   L+ IE+   P+ S  +  +E   V YA +N  D    +GK  V      +PG     DC      LG     + S G+RV    T   S A++ LA+ + +  +PSK + +Q +++   Y T Y AL  RGQ K GE +LIH  SG VG AAI +A A+ LTV  T G+ E     L     + A  + N     +   I  +   N + +V+  L+ + L       A+  R + +G
Sbjct: 1448 GDLSSLRWIES---PRSSPIQSQLEPCTVYYAPLNFRDVMLASGKLGV----DALPGDLAYQDC-----VLGLEFAGRDSCGRRVMAMVT-AKSLATNCLANRNLLWEVPSKWTMEQASTVPCVYATVYYALVVRGQMKEGERILIHAGSGGVGQAAISVALAHGLTVFTTVGSKEKREFLLKRFPKLKAKNIGNSRDTSFEQLIMSETHGNGVELVLNSLSEEKLQASIRCLALNGRFLEIG 1677          
BLAST of Quinone oxidoreductase vs. Ensembl Fly
Match: FASN1 (gene:FBgn0283427 transcript:FBtr0077659)

HSP 1 Score: 63.1586 bits (152), Expect = 1.825e-10
Identity = 59/228 (25.88%), Postives = 106/228 (46.49%), Query Frame = 3
Query:  357 PSKLSFQQGASLGTPYFTAYSALFDRGQAKSGETVLIHGASGAVGIAAIQLAKANNLTVIGTAGTTEGLDMI---------KSIG--ADYVFNHNADGYVNEIKGQFANKINIVIEMLANQNLVVDCEMAAIKARIMIVGCRGTINFDPRLTMGKLL---DVRGVALG--MNSLDQWENAGLQM-SNWMESGDICPIISKEYDLQDAGKAHHDIIFNSGTTGKLVLRI 989
            P K + ++ +++   Y T Y AL  RGQ K GE +LIH  SG VG AAI +A A+ LTV  T G+ E  + +         ++IG   D  F       + E KG+    +++V+  L+ + L        +  R + +G     N  P L M   L      G+ L   M   ++ +N  + + +  +++G + P+ +  ++ Q   +A    + +    GK+V+++
Sbjct: 1564 PEKWTMEEASTVPCVYSTVYYALVVRGQMKKGEKILIHAGSGGVGQAAISVALAHGLTVFTTVGSKEKREFLLKRFPKLQERNIGNSRDTSFEQLV---LRETKGR---GVDLVLNSLSEEKLQASIRCLGLNGRFLEIGKFDLSNNSP-LGMSVFLKNTSFHGILLDSVMEGEEEMQNQVVSLVAEGIKTGAVVPLPTSVFNDQQVEQAFR-FMASGKHIGKVVIKV 1783          
BLAST of Quinone oxidoreductase vs. Ensembl Zebrafish
Match: cryz (crystallin, zeta (quinone reductase) [Source:ZFIN;Acc:ZDB-GENE-050306-24])

HSP 1 Score: 279.641 bits (714), Expect = 3.502e-92
Identity = 151/323 (46.75%), Postives = 205/323 (63.47%), Query Frame = 3
Query:   24 MKAIRISEFGEPCVLKLIENLMIPKPSENEVLIEVKYAGVNPVDTYRRAGKYSVLPTLPWVPGSDCSGIISALGSNIRDKFSIGQRVFTTSTITGSYXXXXXXXXXXXXXXPSKLSFQQGASLGTPYFTAYSALFDRGQAKSGETVLIHGASGAVGIAAIQLAKANNLTVIGTAGTTEGLDMIKSIGADYVFNHNADGYVNEIKGQFAN-KINIVIEMLANQNLVVDCEMAAIKARIMIVGCRGTINFDPRLTMGKLLDVRGVALGMNSLDQWENAGLQMSNWMESGDICPIISKEYDLQDAGKAHHDIIFNSGTTGKLVLRI 989
            M+A+R+SEFG P VLKL  +L +P P + +VLI V   GVNPV+TY R+G Y+  P+LP+ PGSD SG++ A+G  +      G RVFTT T+TG YA + +AS   VH LP  L++ QGA++G PYFTAY AL  +  AK GETVLIHGASG VGIAA Q+A+A  L V+GTAGT EG+ ++ + GA   FNH    Y+ +IK       +N++IEML+N NL  D ++     R++IVG RG I  +PR TM K   V GVAL   +  +       +   ME+G + P+I  EY L    +AH DII + G +GK++L +
Sbjct:    7 MRAVRVSEFGGPSVLKLCSDLPVPSPGQKQVLIRVHACGVNPVETYIRSGSYARKPSLPYTPGSDVSGVVEAVGEGV-CLLQAGDRVFTTGTVTGGYAEYTVASEDTVHKLPDSLNYCQGAAMGVPYFTAYRALVHKAHAKPGETVLIHGASGGVGIAACQIARAFGLKVLGTAGTPEGMKLVLNNGAHLAFNHREKDYLEKIKDTTNGLGVNVIIEMLSNVNLSNDLQLLDFGGRVIIVGSRGPIEINPRDTMMKESSVIGVALHFATKSETSECAAALYAGMEAGWLKPVIGPEYTLDKVAQAHEDIINSPGASGKMILTM 328          
BLAST of Quinone oxidoreductase vs. Ensembl Zebrafish
Match: cryz (crystallin, zeta (quinone reductase) [Source:ZFIN;Acc:ZDB-GENE-050306-24])

HSP 1 Score: 279.641 bits (714), Expect = 3.502e-92
Identity = 151/323 (46.75%), Postives = 205/323 (63.47%), Query Frame = 3
Query:   24 MKAIRISEFGEPCVLKLIENLMIPKPSENEVLIEVKYAGVNPVDTYRRAGKYSVLPTLPWVPGSDCSGIISALGSNIRDKFSIGQRVFTTSTITGSYXXXXXXXXXXXXXXPSKLSFQQGASLGTPYFTAYSALFDRGQAKSGETVLIHGASGAVGIAAIQLAKANNLTVIGTAGTTEGLDMIKSIGADYVFNHNADGYVNEIKGQFAN-KINIVIEMLANQNLVVDCEMAAIKARIMIVGCRGTINFDPRLTMGKLLDVRGVALGMNSLDQWENAGLQMSNWMESGDICPIISKEYDLQDAGKAHHDIIFNSGTTGKLVLRI 989
            M+A+R+SEFG P VLKL  +L +P P + +VLI V   GVNPV+TY R+G Y+  P+LP+ PGSD SG++ A+G  +      G RVFTT T+TG YA + +AS   VH LP  L++ QGA++G PYFTAY AL  +  AK GETVLIHGASG VGIAA Q+A+A  L V+GTAGT EG+ ++ + GA   FNH    Y+ +IK       +N++IEML+N NL  D ++     R++IVG RG I  +PR TM K   V GVAL   +  +       +   ME+G + P+I  EY L    +AH DII + G +GK++L +
Sbjct:    7 MRAVRVSEFGGPSVLKLCSDLPVPSPGQKQVLIRVHACGVNPVETYIRSGSYARKPSLPYTPGSDVSGVVEAVGEGV-CLLQAGDRVFTTGTVTGGYAEYTVASEDTVHKLPDSLNYCQGAAMGVPYFTAYRALVHKAHAKPGETVLIHGASGGVGIAACQIARAFGLKVLGTAGTPEGMKLVLNNGAHLAFNHREKDYLEKIKDTTNGLGVNVIIEMLSNVNLSNDLQLLDFGGRVIIVGSRGPIEINPRDTMMKESSVIGVALHFATKSETSECAAALYAGMEAGWLKPVIGPEYTLDKVAQAHEDIINSPGASGKMILTM 328          
BLAST of Quinone oxidoreductase vs. Ensembl Zebrafish
Match: cryz (crystallin, zeta (quinone reductase) [Source:ZFIN;Acc:ZDB-GENE-050306-24])

HSP 1 Score: 279.641 bits (714), Expect = 3.502e-92
Identity = 151/323 (46.75%), Postives = 205/323 (63.47%), Query Frame = 3
Query:   24 MKAIRISEFGEPCVLKLIENLMIPKPSENEVLIEVKYAGVNPVDTYRRAGKYSVLPTLPWVPGSDCSGIISALGSNIRDKFSIGQRVFTTSTITGSYXXXXXXXXXXXXXXPSKLSFQQGASLGTPYFTAYSALFDRGQAKSGETVLIHGASGAVGIAAIQLAKANNLTVIGTAGTTEGLDMIKSIGADYVFNHNADGYVNEIKGQFAN-KINIVIEMLANQNLVVDCEMAAIKARIMIVGCRGTINFDPRLTMGKLLDVRGVALGMNSLDQWENAGLQMSNWMESGDICPIISKEYDLQDAGKAHHDIIFNSGTTGKLVLRI 989
            M+A+R+SEFG P VLKL  +L +P P + +VLI V   GVNPV+TY R+G Y+  P+LP+ PGSD SG++ A+G  +      G RVFTT T+TG YA + +AS   VH LP  L++ QGA++G PYFTAY AL  +  AK GETVLIHGASG VGIAA Q+A+A  L V+GTAGT EG+ ++ + GA   FNH    Y+ +IK       +N++IEML+N NL  D ++     R++IVG RG I  +PR TM K   V GVAL   +  +       +   ME+G + P+I  EY L    +AH DII + G +GK++L +
Sbjct:    7 MRAVRVSEFGGPSVLKLCSDLPVPSPGQKQVLIRVHACGVNPVETYIRSGSYARKPSLPYTPGSDVSGVVEAVGEGV-CLLQAGDRVFTTGTVTGGYAEYTVASEDTVHKLPDSLNYCQGAAMGVPYFTAYRALVHKAHAKPGETVLIHGASGGVGIAACQIARAFGLKVLGTAGTPEGMKLVLNNGAHLAFNHREKDYLEKIKDTTNGLGVNVIIEMLSNVNLSNDLQLLDFGGRVIIVGSRGPIEINPRDTMMKESSVIGVALHFATKSETSECAAALYAGMEAGWLKPVIGPEYTLDKVAQAHEDIINSPGASGKMILTM 328          
BLAST of Quinone oxidoreductase vs. Ensembl Zebrafish
Match: cryz (crystallin, zeta (quinone reductase) [Source:ZFIN;Acc:ZDB-GENE-050306-24])

HSP 1 Score: 209.92 bits (533), Expect = 2.108e-66
Identity = 108/204 (52.94%), Postives = 141/204 (69.12%), Query Frame = 3
Query:   24 MKAIRISEFGEPCVLKLIENLMIPKPSENEVLIEVKYAGVNPVDTYRRAGKYSVLPTLPWVPGSDCSGIISALGSNIRDKFSIGQRVFTTSTITGSYXXXXXXXXXXXXXXPSKLSFQQGASLGTPYFTAYSALFDRGQAKSGETVLIHGASGAVGIAAIQLAKANNLTVIGTAGTTEGLDMIKSIGADYVFNHNADGYVNEIK 635
            M+A+R+SEFG P VLKL  +L +P P + +VLI V   GVNPV+TY R+G Y+  P+LP+ PGSD SG++ A+G  +      G RVFTT T+TG YA + +AS   VH LP  L++ QGA++G PYFTAY AL  +  AK GETVLIHGASG VGIAA Q+A+A  L V+GTAGT EG+ ++ + GA   FNH    Y+ +IK
Sbjct:    7 MRAVRVSEFGGPSVLKLCSDLPVPSPGQKQVLIRVHACGVNPVETYIRSGSYARKPSLPYTPGSDVSGVVEAVGEGV-CLLQAGDRVFTTGTVTGGYAEYTVASEDTVHKLPDSLNYCQGAAMGVPYFTAYRALVHKAHAKPGETVLIHGASGGVGIAACQIARAFGLKVLGTAGTPEGMKLVLNNGAHLAFNHREKDYLEKIK 209          
BLAST of Quinone oxidoreductase vs. Ensembl Zebrafish
Match: vat1 (vesicle amine transport 1 [Source:NCBI gene;Acc:368752])

HSP 1 Score: 114.005 bits (284), Expect = 1.313e-27
Identity = 67/196 (34.18%), Postives = 108/196 (55.10%), Query Frame = 3
Query:   93 PKPSENEVLIEVKYAGVNPVDTYRRAGKYSVLPTLPWVPGSDCSGIISALGSNIRDKFSIGQRVFTTSTITGSYXXXXXXXXXXXXXXPSKLSFQQGASLGTPYFTAYSALFDRGQAKSGETVLIHGASGAVGIAAIQLAKA-NNLTVIGTAGTTEGLDMIKSIGADYVFNHNADGYVNEIKGQFANKINIVIEML 677
            P     EV++ VK  G+N  D   R G Y  LP+ P  PG +CSG+I A+G  + D+  +G +V   +  +G +    + +  H   +P  +SF++ A+L   Y TAY  LFD G  +  ++VL+H A+G VGIAA QL K  N++TV GTA  ++  ++I   G  +  ++    YV E++      ++IV++ L
Sbjct:   94 PALKSGEVMVRVKMCGLNFADLMARQGLYDRLPSPPVTPGMECSGVIEAVGEEVTDR-KVGDKVLVLNR-SGMWQEVVVVASTHTFLMPEGMSFEEAAALPVNYITAYMMLFDFGHLRPNQSVLVHMAAGGVGIAATQLCKTVNDVTVFGTASASKH-EVISQGGVTHPIDYRTRDYVEEVRKISPKGLDIVLDPL 286          
BLAST of Quinone oxidoreductase vs. Ensembl Xenopus
Match: cbln4 (cerebellin 4 precursor [Source:Xenbase;Acc:XB-GENE-986703])

HSP 1 Score: 285.804 bits (730), Expect = 2.097e-94
Identity = 151/323 (46.75%), Postives = 212/323 (65.63%), Query Frame = 3
Query:   24 MKAIRISEFGEPCVLKLIENLMIPKPSENEVLIEVKYAGVNPVDTYRRAGKYSVLPTLPWVPGSDCSGIISALGSNIRDKFSIGQRVFTTSTITGSYXXXXXXXXXXXXXXPSKLSFQQGASLGTPYFTAYSALFDRGQAKSGETVLIHGASGAVGIAAIQLAKANNLTVIGTAGTTEGLDMIKSIGADYVFNHNADGYVNEIKGQFANK-INIVIEMLANQNLVVDCEMAAIKARIMIVGCRGTINFDPRLTMGKLLDVRGVALGMNSLDQWENAGLQMSNWMESGDICPIISKEYDLQDAGKAHHDIIFNSGTTGKLVLRI 989
            M+AIR+ EFG+  VLKL  +L +P P ENEVLI V   G+NPV+TY RAG Y+  PTLP+ PG+D +G+I ++G ++   F  G RVFTTSTI+G YA +++AS   V+ LP  LSF+QGA++  PYFTAY ALF +   + GE +L+HGASG VGIAA Q+A+A    V GTAGT EGL+++   GA  VFNH  + Y+++I+       +++++EML+N NL  D  + A   R++IVGCRG I  +PR TM K   + GV+L   + +        +   ME+G + P+I  EY L+ A +AH DII +SG +GK+V  I
Sbjct:    8 MRAIRVFEFGKADVLKLCTDLPLPSPGENEVLIRVHACGINPVETYIRAGTYARKPTLPYTPGTDVAGVIESVGKDV-TLFKRGDRVFTTSTISGGYAEYSIASADTVYPLPDLLSFKQGAAISIPYFTAYRALFSKAHGRPGEVILVHGASGGVGIAACQIARAYGFRVFGTAGTPEGLNLVLKNGAHKVFNHREEDYIDKIQEATGGAGVDVILEMLSNVNLSHDLNLLAAGGRVIIVGCRGPIEINPRDTMAKETSIIGVSLFSATKEDRMETAAALFGGMEAGWLKPLIGCEYPLEKASQAHEDIIQSSGASGKMVFVI 329          
BLAST of Quinone oxidoreductase vs. Ensembl Xenopus
Match: fcn2 (ficolin 2 [Source:Xenbase;Acc:XB-GENE-5789613])

HSP 1 Score: 113.235 bits (282), Expect = 2.526e-27
Identity = 71/218 (32.57%), Postives = 115/218 (52.75%), Query Frame = 3
Query:   27 KAIRISEFGEPCVLKLIENLMIPKPSENEVLIEVKYAGVNPVDTYRRAGKYSVLPTLPWVPGSDCSGIISALGSNIRDKFSIGQRVFTTSTITGSYXXXXXXXXXXXXXXPSKLSFQQGASLGTPYFTAYSALFDRGQAKSGETVLIHGASGAVGIAAIQLAKA-NNLTVIGTAGTTEGLDMIKSIGADYVFNHNADGYVNEIKGQFANKINIVIEML 677
            K++ +S  G    +KL      P P   EVL+ VK  G+N  D   R G Y  LP+LP   G +C+GI+  LG  + D+  +G +V   +   G +        +H   +P  +SF++GA+    Y TAY  LF  G  +  ++VLIH A+G VG AA+QL K   N+T+ GTA  ++  + +K  G  +  ++ ++ YV E++      ++IV++ L
Sbjct:   63 KSLVLSAHGGYDKVKLHTKKGSPTPKAGEVLVRVKACGLNFADLMARQGVYDRLPSLPVSLGMECAGIVEELGEGVTDR-QVGDKVMVLNRF-GLWQELISIQTNHTFLMPDGMSFEEGAAFLVNYITAYMILFHFGNLRPNQSVLIHMAAGGVGTAAVQLCKTVENITIFGTASASKH-ESLKESGVSHPIDYRSNDYVEEVRKVSPKGVDIVMDPL 277          
BLAST of Quinone oxidoreductase vs. Ensembl Xenopus
Match: prrx2 (paired related homeobox 2 [Source:Xenbase;Acc:XB-GENE-947362])

HSP 1 Score: 108.612 bits (270), Expect = 6.420e-26
Identity = 77/223 (34.53%), Postives = 118/223 (52.91%), Query Frame = 3
Query:   24 MKAIRISEFGEPCVLKLIENLMIPKPSENEVLIEVKYAGVNPVDTYRRAGKYSVLPTLPWVPGSDCSGIISALGSNIRDKFSIGQRVFTTSTITGSYXXXXXXXXXXXXXXPSKLSFQQGASLGTPYFTAYSALFDRGQAKSGETVLIHGASGAVGIAAIQLAKA-NNLTVIGTAGTTEGLDMIKSIGADYVFNHNADGYVNEIKGQFANKINIVIEMLANQN 689
            M+A+ +S FG    L++   +M P+P E E+ I VK  G+N +D   R G     P  P VPG + SGI+ A+G N+   F IG RV   +    ++A  A      V+ +P  +SF + AS    + TAY  LF+    + G +VL+H A G VG A  QL     N+ V GTA + +   +  S+   ++F+ NAD YV E+K    + ++IV++ L  +N
Sbjct:   36 MRAVLLSGFGGLNKLRVARKVM-PEPLEGELKIRVKACGLNFIDLMVRQGNIDNPPKTPLVPGFELSGIVEAIGGNVTG-FEIGDRVMAFTNYN-AWAEVACTPAEFVYKIPDDMSFSEAASFPMNFVTAYMMLFEVANLREGMSVLVHSAGGGVGQAVAQLCSTIPNVRVFGTASSFKHEAIKNSL--THLFDRNAD-YVQEVKRISPDGVDIVLDCLCGEN 252          
BLAST of Quinone oxidoreductase vs. Ensembl Xenopus
Match: tp53i3 (tumor protein p53 inducible protein 3 [Source:NCBI gene;Acc:779670])

HSP 1 Score: 95.5153 bits (236), Expect = 1.670e-21
Identity = 93/339 (27.43%), Postives = 155/339 (45.72%), Query Frame = 3
Query:   12 LYEKMKAIRISEFGEPCVLKLIENLMIPKPSENEVLIEVKYAGVNPVDTYRRAGKYSVLPTLPWVPGSDCSGIISALGSNIRDKFSIGQRVFTTSTITGSYXXXXXXXXXXXXXXPSKLSFQQGASLGTPYFTAYSALFDRGQAKSGETVLIHGASGAVGIAAIQLAKANNLTVIGTAGTTEGLDMIKSIGADYVFNHNADGYVNEIKGQFANKI--NIVIEMLANQNLVVDCEMAAIKARIMIVGCRGTINFDPRLTMGKLLDVRGVALG--MNSLDQWENAGL-------QMSNWMESGDI--CPIISKEYDLQDAGKAHHDIIFNSGTTGKLVLRI 989
            L +KM A      G P  L  ++ L  P P E EVL++V+ + +N  D  +R GKY+  P    + G + +G +  LG     ++ +G +V    +  G  A +A     H+  +P  +S    A++   + TA+  L   G+ + GETVLIH  +  VG AAIQL +      I TAG+ E L     +GA   FN+  + +  E   +F N I  +++++ +   +   + +      R ++ G  G+      L + KLL  RG  LG  + S  +     L        + +++  G I   PI+   + L     AH  +  N   TGK+VL++
Sbjct:   26 LQDKMLAAFFDAPGGPETL-YVKELAKPAPKEGEVLVKVEASALNRADLLQRRGKYAPPPGASDILGLEAAGTVVELGLGADGRWKVGDKVMALLS-GGGNAEYATVPAGHLMPVPPGMSATDAAAIPEAWLTAFQLLHFVGKVQKGETVLIHAGASGVGTAAIQLCRLAGAVPIVTAGSHEKLQTAIKLGAATGFNYKEENF-GEKCLKFTNNIGADVILDCVGASHWEKNLQCLNTDGRWVLYGLMGSGEIHGDL-LAKLLWKRGSLLGSLLRSRSKKYKEELVKAFTEQALPHFIAGGPIQLLPIVDSVFPLHQISDAHQRMEDNK-NTGKIVLQM 359          
BLAST of Quinone oxidoreductase vs. Ensembl Xenopus
Match: tp53i3 (tumor protein p53 inducible protein 3 [Source:NCBI gene;Acc:779670])

HSP 1 Score: 94.7449 bits (234), Expect = 2.753e-21
Identity = 92/339 (27.14%), Postives = 155/339 (45.72%), Query Frame = 3
Query:   12 LYEKMKAIRISEFGEPCVLKLIENLMIPKPSENEVLIEVKYAGVNPVDTYRRAGKYSVLPTLPWVPGSDCSGIISALGSNIRDKFSIGQRVFTTSTITGSYXXXXXXXXXXXXXXPSKLSFQQGASLGTPYFTAYSALFDRGQAKSGETVLIHGASGAVGIAAIQLAKANNLTVIGTAGTTEGLDMIKSIGADYVFNHNADGYVNEIKGQFANKI--NIVIEMLANQNLVVDCEMAAIKARIMIVGCRGTINFDPRLTMGKLLDVRGVALG--MNSLDQWENAGL-------QMSNWMESGDI--CPIISKEYDLQDAGKAHHDIIFNSGTTGKLVLRI 989
            + +KM A      G P  L  ++ L  P P E EVL++V+ + +N  D  +R GKY+  P    + G + +G +  LG     ++ +G +V    +  G  A +A     H+  +P  +S    A++   + TA+  L   G+ + GETVLIH  +  VG AAIQL +      I TAG+ E L     +GA   FN+  + +  E   +F N I  +++++ +   +   + +      R ++ G  G+      L + KLL  RG  LG  + S  +     L        + +++  G I   PI+   + L     AH  +  N   TGK+VL++
Sbjct:    1 MEDKMLAAFFDAPGGPETL-YVKELAKPAPKEGEVLVKVEASALNRADLLQRRGKYAPPPGASDILGLEAAGTVVELGLGADGRWKVGDKVMALLS-GGGNAEYATVPAGHLMPVPPGMSATDAAAIPEAWLTAFQLLHFVGKVQKGETVLIHAGASGVGTAAIQLCRLAGAVPIVTAGSHEKLQTAIKLGAATGFNYKEENF-GEKCLKFTNNIGADVILDCVGASHWEKNLQCLNTDGRWVLYGLMGSGEIHGDL-LAKLLWKRGSLLGSLLRSRSKKYKEELVKAFTEQALPHFIAGGPIQLLPIVDSVFPLHQISDAHQRMEDNK-NTGKIVLQM 334          
BLAST of Quinone oxidoreductase vs. Ensembl Mouse
Match: Cryz (crystallin, zeta [Source:MGI Symbol;Acc:MGI:88527])

HSP 1 Score: 286.189 bits (731), Expect = 1.408e-94
Identity = 147/323 (45.51%), Postives = 216/323 (66.87%), Query Frame = 3
Query:   24 MKAIRISEFGEPCVLKLIENLMIPKPSENEVLIEVKYAGVNPVDTYRRAGKYSVLPTLPWVPGSDCSGIISALGSNIRDKFSIGQRVFTTSTITGSYXXXXXXXXXXXXXXPSKLSFQQGASLGTPYFTAYSALFDRGQAKSGETVLIHGASGAVGIAAIQLAKANNLTVIGTAGTTEGLDMIKSIGADYVFNHNADGYVNEIKGQFANK---INIVIEMLANQNLVVDCEMAAIKARIMIVGCRGTINFDPRLTMGKLLDVRGVALGMNSLDQWENAGLQMSNWMESGDICPIISKEYDLQDAGKAHHDIIFNSGTTGKLVL 983
            M+AIR+ EFG P VLKL  ++++P P  ++VLI+V   GVNPV+TY R+G YS  P LP+ PGSD +GII ++G  +   F  G RVF  ST++G YA  ALA+   ++ LP  L+F+QGA+LG PYFTA  ALF   +A++GE+VL+HGASG VG+A  Q+A+A+ L V+GTAG+ EG  ++   GA  VFNH    Y+++IK    +K   ++++IEMLAN+NL  D ++ +   R+++VGCRG I  +PR TM K   + GV+L  ++ ++++     +   +E G + P+I  EY L+ A +AH DII  SG TGK++L
Sbjct:    8 MRAIRVFEFGGPEVLKLQSDVVVPVPQSHQVLIKVHACGVNPVETYIRSGAYSRKPALPYTPGSDVAGIIESVGDKV-SAFKKGDRVFCYSTVSGGYAEFALAADDTIYPLPETLNFRQGAALGIPYFTACRALFHSARARAGESVLVHGASGGVGLATCQIARAHGLKVLGTAGSEEGKKLVLQNGAHEVFNHKEANYIDKIKMSVGDKDKGVDVIIEMLANENLSNDLKLLSHGGRVVVVGCRGPIEINPRDTMAKETSIIGVSLSSSTKEEFQQFAGLLQAGIEKGWVKPVIGSEYPLEKAAQAHEDIIHGSGKTGKMIL 329          
BLAST of Quinone oxidoreductase vs. Ensembl Mouse
Match: Cryz (crystallin, zeta [Source:MGI Symbol;Acc:MGI:88527])

HSP 1 Score: 286.189 bits (731), Expect = 1.408e-94
Identity = 147/323 (45.51%), Postives = 216/323 (66.87%), Query Frame = 3
Query:   24 MKAIRISEFGEPCVLKLIENLMIPKPSENEVLIEVKYAGVNPVDTYRRAGKYSVLPTLPWVPGSDCSGIISALGSNIRDKFSIGQRVFTTSTITGSYXXXXXXXXXXXXXXPSKLSFQQGASLGTPYFTAYSALFDRGQAKSGETVLIHGASGAVGIAAIQLAKANNLTVIGTAGTTEGLDMIKSIGADYVFNHNADGYVNEIKGQFANK---INIVIEMLANQNLVVDCEMAAIKARIMIVGCRGTINFDPRLTMGKLLDVRGVALGMNSLDQWENAGLQMSNWMESGDICPIISKEYDLQDAGKAHHDIIFNSGTTGKLVL 983
            M+AIR+ EFG P VLKL  ++++P P  ++VLI+V   GVNPV+TY R+G YS  P LP+ PGSD +GII ++G  +   F  G RVF  ST++G YA  ALA+   ++ LP  L+F+QGA+LG PYFTA  ALF   +A++GE+VL+HGASG VG+A  Q+A+A+ L V+GTAG+ EG  ++   GA  VFNH    Y+++IK    +K   ++++IEMLAN+NL  D ++ +   R+++VGCRG I  +PR TM K   + GV+L  ++ ++++     +   +E G + P+I  EY L+ A +AH DII  SG TGK++L
Sbjct:    8 MRAIRVFEFGGPEVLKLQSDVVVPVPQSHQVLIKVHACGVNPVETYIRSGAYSRKPALPYTPGSDVAGIIESVGDKV-SAFKKGDRVFCYSTVSGGYAEFALAADDTIYPLPETLNFRQGAALGIPYFTACRALFHSARARAGESVLVHGASGGVGLATCQIARAHGLKVLGTAGSEEGKKLVLQNGAHEVFNHKEANYIDKIKMSVGDKDKGVDVIIEMLANENLSNDLKLLSHGGRVVVVGCRGPIEINPRDTMAKETSIIGVSLSSSTKEEFQQFAGLLQAGIEKGWVKPVIGSEYPLEKAAQAHEDIIHGSGKTGKMIL 329          
BLAST of Quinone oxidoreductase vs. Ensembl Mouse
Match: Cryz (crystallin, zeta [Source:MGI Symbol;Acc:MGI:88527])

HSP 1 Score: 254.988 bits (650), Expect = 8.829e-83
Identity = 132/295 (44.75%), Postives = 197/295 (66.78%), Query Frame = 3
Query:   24 MKAIRISEFGEPCVLKLIENLMIPKPSENEVLIEVKYAGVNPVDTYRRAGKYSVLPTLPWVPGSDCSGIISALGSNIRDKFSIGQRVFTTSTITGSYXXXXXXXXXXXXXXPSKLSFQQGASLGTPYFTAYSALFDRGQAKSGETVLIHGASGAVGIAAIQLAKANNLTVIGTAGTTEGLDMIKSIGADYVFNHNADGYVNEIKGQFANK---INIVIEMLANQNLVVDCEMAAIKARIMIVGCRGTINFDPRLTMGKLLDVRGVALGMNSLDQWENAGLQMSNWMESGDICPII 899
            M+AIR+ EFG P VLKL  ++++P P  ++VLI+V   GVNPV+TY R+G YS  P LP+ PGSD +GII ++G  +   F  G RVF  ST++G YA  ALA+   ++ LP  L+F+QGA+LG PYFTA  ALF   +A++GE+VL+HGASG VG+A  Q+A+A+ L V+GTAG+ EG  ++   GA  VFNH    Y+++IK    +K   ++++IEMLAN+NL  D ++ +   R+++VGCRG I  +PR TM K   + GV+L  ++ ++++     +   +E G + P+I
Sbjct:    8 MRAIRVFEFGGPEVLKLQSDVVVPVPQSHQVLIKVHACGVNPVETYIRSGAYSRKPALPYTPGSDVAGIIESVGDKV-SAFKKGDRVFCYSTVSGGYAEFALAADDTIYPLPETLNFRQGAALGIPYFTACRALFHSARARAGESVLVHGASGGVGLATCQIARAHGLKVLGTAGSEEGKKLVLQNGAHEVFNHKEANYIDKIKMSVGDKDKGVDVIIEMLANENLSNDLKLLSHGGRVVVVGCRGPIEINPRDTMAKETSIIGVSLSSSTKEEFQQFAGLLQAGIEKGWVKPVI 301          
BLAST of Quinone oxidoreductase vs. Ensembl Mouse
Match: Cryz (crystallin, zeta [Source:MGI Symbol;Acc:MGI:88527])

HSP 1 Score: 201.83 bits (512), Expect = 3.746e-63
Identity = 105/218 (48.17%), Postives = 151/218 (69.27%), Query Frame = 3
Query:   24 MKAIRISEFGEPCVLKLIENLMIPKPSENEVLIEVKYAGVNPVDTYRRAGKYSVLPTLPWVPGSDCSGIISALGSNIRDKFSIGQRVFTTSTITGSYXXXXXXXXXXXXXXPSKLSFQQGASLGTPYFTAYSALFDRGQAKSGETVLIHGASGAVGIAAIQLAKANNLTVIGTAGTTEGLDMIKSIGADYVFNHNADGYVNEIKGQFANKINIVIEML 677
            M+AIR+ EFG P VLKL  ++++P P  ++VLI+V   GVNPV+TY R+G YS  P LP+ PGSD +GII ++G  +   F  G RVF  ST++G YA  ALA+   ++ LP  L+F+QGA+LG PYFTA  ALF   +A++GE+VL+HGASG VG+A  Q+A+A+ L V+GTAG+ EG  ++   GA  VFNH    Y+++IK +     ++V+++L
Sbjct:    8 MRAIRVFEFGGPEVLKLQSDVVVPVPQSHQVLIKVHACGVNPVETYIRSGAYSRKPALPYTPGSDVAGIIESVGDKV-SAFKKGDRVFCYSTVSGGYAEFALAADDTIYPLPETLNFRQGAALGIPYFTACRALFHSARARAGESVLVHGASGGVGLATCQIARAHGLKVLGTAGSEEGKKLVLQNGAHEVFNHKEANYIDKIKDR-----HLVVQIL 219          
BLAST of Quinone oxidoreductase vs. Ensembl Mouse
Match: Cryz (crystallin, zeta [Source:MGI Symbol;Acc:MGI:88527])

HSP 1 Score: 166.777 bits (421), Expect = 3.380e-50
Identity = 86/166 (51.81%), Postives = 119/166 (71.69%), Query Frame = 3
Query:   24 MKAIRISEFGEPCVLKLIENLMIPKPSENEVLIEVKYAGVNPVDTYRRAGKYSVLPTLPWVPGSDCSGIISALGSNIRDKFSIGQRVFTTSTITGSYXXXXXXXXXXXXXXPSKLSFQQGASLGTPYFTAYSALFDRGQAKSGETVLIHGASGAVGIAAIQLAKAN 521
            M+AIR+ EFG P VLKL  ++++P P  ++VLI+V   GVNPV+TY R+G YS  P LP+ PGSD +GII ++G  +   F  G RVF  ST++G YA  ALA+   ++ LP  L+F+QGA+LG PYFTA  ALF   +A++GE+VL+HGASG VG+A  Q+A+A+
Sbjct:    8 MRAIRVFEFGGPEVLKLQSDVVVPVPQSHQVLIKVHACGVNPVETYIRSGAYSRKPALPYTPGSDVAGIIESVGDKV-SAFKKGDRVFCYSTVSGGYAEFALAADDTIYPLPETLNFRQGAALGIPYFTACRALFHSARARAGESVLVHGASGGVGLATCQIARAH 172          
BLAST of Quinone oxidoreductase vs. UniProt/SwissProt
Match: sp|P11415|QOR_CAVPO (Quinone oxidoreductase OS=Cavia porcellus OX=10141 GN=CRYZ PE=1 SV=1)

HSP 1 Score: 291.582 bits (745), Expect = 6.113e-96
Identity = 152/321 (47.35%), Postives = 222/321 (69.16%), Query Frame = 3
Query:   24 MKAIRISEFGEPCVLKLIENLMIPKPSENEVLIEVKYAGVNPVDTYRRAGKYSVLPTLPWVPGSDCSGIISALGSNIRDKFSIGQRVFTTSTITGSYXXXXXXXXXXXXXXPSKLSFQQGASLGTPYFTAYSALFDRGQAKSGETVLIHGASGAVGIAAIQLAKANNLTVIGTAGTTEGLDMIKSIGADYVFNHNADGYVNEIKGQFANK-INIVIEMLANQNLVVDCEMAAIKARIMIVGCRGTINFDPRLTMGKLLDVRGVALGMNSLDQWENAGLQMSNWMESGDICPIISKEYDLQDAGKAHHDIIFNSGTTGKLVL 983
            M+AIR+ EFG P VLK+  ++ +P P +++VLI+V   G+NPV+TY R+G Y+ +P LP+ PG+D +G++ ++G+++   F  G RVFTTSTI+G YA +ALAS H V+ LP KL F+QGA++G PYFTA  ALF   +AK+GE+VL+HGASG VG+AA Q+A+A  L V+GTAGT EG  ++   GA  VFNH    Y++EIK     K ++++IEMLAN NL  D ++ +   R++IVGCRG+I  +PR TM K   + GV+L  ++ ++++     +   ME G + P+I  +Y L+ A +AH +II +SGT GK VL
Sbjct:    8 MRAIRVFEFGGPEVLKVQSDVAVPIPKDHQVLIKVHACGINPVETYIRSGTYTRIPLLPYTPGTDVAGVVESIGNDV-SAFKKGDRVFTTSTISGGYAEYALASDHTVYRLPEKLDFRQGAAIGIPYFTACRALFHSARAKAGESVLVHGASGGVGLAACQIARAYGLKVLGTAGTEEGQKVVLQNGAHEVFNHRDAHYIDEIKKSIGEKGVDVIIEMLANVNLSNDLKLLSCGGRVIIVGCRGSIEINPRDTMAKESTISGVSLFSSTKEEFQQFASTIQAGMELGWVKPVIGSQYPLEKASQAHENIIHSSGTVGKTVL 327          
BLAST of Quinone oxidoreductase vs. UniProt/SwissProt
Match: sp|P47199|QOR_MOUSE (Quinone oxidoreductase OS=Mus musculus OX=10090 GN=Cryz PE=1 SV=1)

HSP 1 Score: 286.189 bits (731), Expect = 9.849e-94
Identity = 147/323 (45.51%), Postives = 216/323 (66.87%), Query Frame = 3
Query:   24 MKAIRISEFGEPCVLKLIENLMIPKPSENEVLIEVKYAGVNPVDTYRRAGKYSVLPTLPWVPGSDCSGIISALGSNIRDKFSIGQRVFTTSTITGSYXXXXXXXXXXXXXXPSKLSFQQGASLGTPYFTAYSALFDRGQAKSGETVLIHGASGAVGIAAIQLAKANNLTVIGTAGTTEGLDMIKSIGADYVFNHNADGYVNEIKGQFANK---INIVIEMLANQNLVVDCEMAAIKARIMIVGCRGTINFDPRLTMGKLLDVRGVALGMNSLDQWENAGLQMSNWMESGDICPIISKEYDLQDAGKAHHDIIFNSGTTGKLVL 983
            M+AIR+ EFG P VLKL  ++++P P  ++VLI+V   GVNPV+TY R+G YS  P LP+ PGSD +GII ++G  +   F  G RVF  ST++G YA  ALA+   ++ LP  L+F+QGA+LG PYFTA  ALF   +A++GE+VL+HGASG VG+A  Q+A+A+ L V+GTAG+ EG  ++   GA  VFNH    Y+++IK    +K   ++++IEMLAN+NL  D ++ +   R+++VGCRG I  +PR TM K   + GV+L  ++ ++++     +   +E G + P+I  EY L+ A +AH DII  SG TGK++L
Sbjct:    8 MRAIRVFEFGGPEVLKLQSDVVVPVPQSHQVLIKVHACGVNPVETYIRSGAYSRKPALPYTPGSDVAGIIESVGDKV-SAFKKGDRVFCYSTVSGGYAEFALAADDTIYPLPETLNFRQGAALGIPYFTACRALFHSARARAGESVLVHGASGGVGLATCQIARAHGLKVLGTAGSEEGKKLVLQNGAHEVFNHKEANYIDKIKMSVGDKDKGVDVIIEMLANENLSNDLKLLSHGGRVVVVGCRGPIEINPRDTMAKETSIIGVSLSSSTKEEFQQFAGLLQAGIEKGWVKPVIGSEYPLEKAAQAHEDIIHGSGKTGKMIL 329          
BLAST of Quinone oxidoreductase vs. UniProt/SwissProt
Match: sp|Q6AYT0|QOR_RAT (Quinone oxidoreductase OS=Rattus norvegicus OX=10116 GN=Cryz PE=2 SV=1)

HSP 1 Score: 285.419 bits (729), Expect = 1.539e-93
Identity = 145/321 (45.17%), Postives = 216/321 (67.29%), Query Frame = 3
Query:   24 MKAIRISEFGEPCVLKLIENLMIPKPSENEVLIEVKYAGVNPVDTYRRAGKYSVLPTLPWVPGSDCSGIISALGSNIRDKFSIGQRVFTTSTITGSYXXXXXXXXXXXXXXPSKLSFQQGASLGTPYFTAYSALFDRGQAKSGETVLIHGASGAVGIAAIQLAKANNLTVIGTAGTTEGLDMIKSIGADYVFNHNADGYVNEIKGQFANK-INIVIEMLANQNLVVDCEMAAIKARIMIVGCRGTINFDPRLTMGKLLDVRGVALGMNSLDQWENAGLQMSNWMESGDICPIISKEYDLQDAGKAHHDIIFNSGTTGKLVL 983
            M+AIR+ EFG P VLKL  ++++P P  ++VLI+V   GVNPV+TY R+G YS  P LP+ PGSD +GII ++G  +   F  G RVF  ST++G YA  AL++ +  + LP  L F+QGA+LG PYFTA  ALF   +A++GE+VL+HGASG VG+A  Q+A+A+ L V+GTAG+ EG  ++   GA  VFNH    Y+++IK    +K ++++IEMLAN+NL  D ++ +   R+++VGCRG+I  +PR TM K   + GV+L  ++ ++++     +   +E G + P+I  EY L+ A +AH DII +SG  GK++L
Sbjct:    8 MRAIRVFEFGGPEVLKLQSDVVVPAPQSHQVLIKVHACGVNPVETYIRSGTYSRKPALPYTPGSDVAGIIESVGDGV-SAFKKGDRVFCFSTVSGGYAEFALSADNTTYPLPETLDFRQGAALGIPYFTACRALFHSARARAGESVLVHGASGGVGLATCQIARAHGLKVLGTAGSEEGKKLVLQNGAHEVFNHKEANYIDKIKTSAGDKGVDVIIEMLANKNLSNDLKLLSCGGRVIVVGCRGSIEINPRDTMAKETSIIGVSLFSSTKEEFQQFAGILQAGIEKGWVKPVIGSEYPLEKAAQAHEDIIHSSGKMGKMIL 327          
BLAST of Quinone oxidoreductase vs. UniProt/SwissProt
Match: sp|Q08257|QOR_HUMAN (Quinone oxidoreductase OS=Homo sapiens OX=9606 GN=CRYZ PE=1 SV=1)

HSP 1 Score: 284.263 bits (726), Expect = 5.602e-93
Identity = 152/321 (47.35%), Postives = 213/321 (66.36%), Query Frame = 3
Query:   24 MKAIRISEFGEPCVLKLIENLMIPKPSENEVLIEVKYAGVNPVDTYRRAGKYSVLPTLPWVPGSDCSGIISALGSNIRDKFSIGQRVFTTSTITGSYXXXXXXXXXXXXXXPSKLSFQQGASLGTPYFTAYSALFDRGQAKSGETVLIHGASGAVGIAAIQLAKANNLTVIGTAGTTEGLDMIKSIGADYVFNHNADGYVNEIKGQFANK-INIVIEMLANQNLVVDCEMAAIKARIMIVGCRGTINFDPRLTMGKLLDVRGVALGMNSLDQWENAGLQMSNWMESGDICPIISKEYDLQDAGKAHHDIIFNSGTTGKLVL 983
            M+A+R+ EFG P VLKL  ++ +P P +++VLI+V   GVNPV+TY R+G YS  P LP+ PGSD +G+I A+G N    F  G RVFT+STI+G YA +ALA+ H V+ LP KL F+QGA++G PYFTAY AL      K+GE+VL+HGASG VG+AA Q+A+A  L ++GTAGT EG  ++   GA  VFNH    Y+++IK     K I+I+IEMLAN NL  D  + +   R+++VG RGTI  +PR TM K   + GV L  ++ ++++     +   ME G + P+I  +Y L+   +AH +II  SG TGK++L
Sbjct:    8 MRAVRVFEFGGPEVLKLRSDIAVPIPKDHQVLIKVHACGVNPVETYIRSGTYSRKPLLPYTPGSDVAGVIEAVGDN-ASAFKKGDRVFTSSTISGGYAEYALAADHTVYKLPEKLDFKQGAAIGIPYFTAYRALIHSACVKAGESVLVHGASGGVGLAACQIARAYGLKILGTAGTEEGQKIVLQNGAHEVFNHREVNYIDKIKKYVGEKGIDIIIEMLANVNLSKDLSLLSHGGRVIVVGSRGTIEINPRDTMAKESSIIGVTLFSSTKEEFQQYAAALQAGMEIGWLKPVIGSQYPLEKVAEAHENIIHGSGATGKMIL 327          
BLAST of Quinone oxidoreductase vs. UniProt/SwissProt
Match: sp|O97764|QOR_BOVIN (Zeta-crystallin OS=Bos taurus OX=9913 GN=CRYZ PE=2 SV=2)

HSP 1 Score: 281.952 bits (720), Expect = 3.583e-92
Identity = 151/321 (47.04%), Postives = 215/321 (66.98%), Query Frame = 3
Query:   24 MKAIRISEFGEPCVLKLIENLMIPKPSENEVLIEVKYAGVNPVDTYRRAGKYSVLPTLPWVPGSDCSGIISALGSNIRDKFSIGQRVFTTSTITGSYXXXXXXXXXXXXXXPSKLSFQQGASLGTPYFTAYSALFDRGQAKSGETVLIHGASGAVGIAAIQLAKANNLTVIGTAGTTEGLDMIKSIGADYVFNHNADGYVNEIKGQFANK-INIVIEMLANQNLVVDCEMAAIKARIMIVGCRGTINFDPRLTMGKLLDVRGVALGMNSLDQWENAGLQMSNWMESGDICPIISKEYDLQDAGKAHHDIIFNSGTTGKLVL 983
            M+AIR+ EFG P VLKL  ++ +P P +++VLI+V+  GVNPVDTY R+G +++ P LP+ PG D +GII A+G ++   F  G RVFTT TI+G YA +ALA+ H V+ LP KL F+QGA++G PYFTAY AL      K GE+VL+HGASG VGIAA Q+A+A  L V+GTA T EG  ++   GA  VFNH    Y+++IK     K ++++IEMLAN NL  D  + +   R+++VG RGTI  +PR TM K   ++GV L  ++ ++++     +   ME G + P+I  +Y L+ A +AH +II +SG TGK++L
Sbjct:    8 MRAIRVFEFGGPEVLKLQSDVAVPIPKDHQVLIKVQACGVNPVDTYIRSGTHNIKPLLPYTPGFDVAGIIEAVGESV-SAFKKGDRVFTTRTISGGYAEYALAADHTVYTLPEKLDFKQGAAIGIPYFTAYRALLHSACVKPGESVLVHGASGGVGIAACQIARAYGLKVLGTASTEEGQKIVLENGAHKVFNHKEADYIDKIKKSVGEKGVDVIIEMLANVNLSNDLNLLSHGGRVIVVGSRGTIEINPRDTMTKESSIKGVTLFSSTKEEFQQFAAALQAGMEIGWLRPVIGPQYLLEKATQAHENIIHSSGATGKMIL 327          
BLAST of Quinone oxidoreductase vs. TrEMBL
Match: A0A210PLN1 (Quinone oxidoreductase OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT04750 PE=4 SV=1)

HSP 1 Score: 317.39 bits (812), Expect = 1.842e-103
Identity = 163/323 (50.46%), Postives = 215/323 (66.56%), Query Frame = 3
Query:   24 MKAIRISEFGEPCVLKLIENLMIPKPSENEVLIEVKYAGVNPVDTYRRAGKYSVLPTLPWVPGSDCSGIISALGSNIRDKFSIGQRVFTTSTITGSYXXXXXXXXXXXXXXPSKLSFQQGASLGTPYFTAYSALFDRGQAKSGETVLIHGASGAVGIAAIQLAKANNLTVIGTAGTTEGLDMIKSIGADYVFNHNADGYVNEIKGQFANK-INIVIEMLANQNLVVDCEMAAIKARIMIVGCRGTINFDPRLTMGKLLDVRGVALGMNSLDQWENAGLQMSNWMESGDICPIISKEYDLQDAGKAHHDIIFNSGTTGKLVLRI 989
            MKAIR+++FG P ++K+  NL IPKPSE ++LI+V  AGVNPVDTY RAG Y+  P LP+ PGSD  G++  +GS +  KF  G RVFT  T TG Y  + L        L  KLS +QGA++G PYFTAY A+   G+AK+GET+L+HGASGAVG+A +Q+AKA+ L V+GTAGT EGLD++ S+GA+ V NH  D Y   I         N++IEMLAN NL  D +MAA K RI+IVG RGT+   PRLTMGK L V+G+ L  ++ ++W+     +   M +G + P I   Y L+ A +AH DII   G TGKL+L+I
Sbjct:   12 MKAIRVAQFGGPEMMKVEANLAIPKPSEKQILIKVSAAGVNPVDTYIRAGTYAKKPDLPYTPGSDVGGVVEEVGSAV-TKFKKGDRVFTVRTDTGGYGEYTLTDSGLAGLLDDKLSLEQGAAIGVPYFTAYRAVVTHGKAKTGETILVHGASGAVGLACVQIAKAHGLRVVGTAGTQEGLDLVTSLGAEAVVNHRGDNYTQTITAACGGSGPNLIIEMLANVNLEKDLQMAAQKGRIIIVGSRGTVEVTPRLTMGKELTVQGLMLMGSTAEEWDQMHAGIKKGMAAGWLKPHIGHTYTLEQAPQAHDDIINTKGATGKLILKI 333          
BLAST of Quinone oxidoreductase vs. TrEMBL
Match: A0A2C9K2M0 (PKS_ER domain-containing protein OS=Biomphalaria glabrata OX=6526 GN=106078884 PE=4 SV=1)

HSP 1 Score: 308.531 bits (789), Expect = 4.855e-100
Identity = 156/322 (48.45%), Postives = 223/322 (69.25%), Query Frame = 3
Query:   24 MKAIRISEFGEPCVLKLIENLMIPKPSENEVLIEVKYAGVNPVDTYRRAGKYSVLPTLPWVPGSDCSGIISALGSNIRDKFSIGQRVFTTSTITGSYXXXXXXXXXXXXXXPSKLSFQQGASLGTPYFTAYSALFDRGQAKSGETVLIHGASGAVGIAAIQLAKANNLTVIGTAGTTEGLDMIKSIGADYVFNHNADGYVNEIKGQFANKINIVIEMLANQNLVVDCEMAAIKARIMIVGCRGTINFDPRLTMGKLLDVRGVALGMNSLDQWENAGLQMSNWMESGDICPIISKEYDLQDAGKAHHDIIFNSGTTGKLVLRI 989
            MKAIR+++FG    LKL  ++ IP PS++EVLI++  AG+NPVDTY R G YS +P LP+ PG D +G++ A+G  +  +F  G RVFT ++++G+YA  A A++  V  L  KLSF QGAS G PY+TAY +LF R QAK GETVL+HGASG VG+AA+QLAK++ L V+GTAGT EGLD++K  GAD+V+NH    Y++++  +    I+IV+EMLAN NL  D  +   + RI+++GCRG+I  +PRL+MGK  ++ GVAL  ++   W+     +     +G + P I K Y L++A +A +D+I N+GT G LVL+I
Sbjct:   11 MKAIRVAKFGGVENLKLETDIPIPIPSDSEVLIKIHAAGINPVDTYIRTGTYSRVPQLPYTPGQDAAGVVEAVGEGV-TQFKKGDRVFTMTSVSGTYAEFATANIKFVAHLDDKLSFAQGASFGVPYYTAYKSLFLRAQAKPGETVLVHGASGGVGLAAVQLAKSHGLRVVGTAGTKEGLDLVKKNGADFVYNHREPDYLDKVIKEVEGGIDIVLEMLANVNLQNDLNIVNFRGRIVVIGCRGSIQINPRLSMGKESNIMGVALMTSTEADWKEMHAALQAGQRTGCLVPHIGKIYSLKEADRAQNDVINNAGTFGNLVLQI 331          
BLAST of Quinone oxidoreductase vs. TrEMBL
Match: A0A2C9K2J7 (PKS_ER domain-containing protein OS=Biomphalaria glabrata OX=6526 GN=106078884 PE=4 SV=1)

HSP 1 Score: 307.76 bits (787), Expect = 1.440e-99
Identity = 156/322 (48.45%), Postives = 223/322 (69.25%), Query Frame = 3
Query:   24 MKAIRISEFGEPCVLKLIENLMIPKPSENEVLIEVKYAGVNPVDTYRRAGKYSVLPTLPWVPGSDCSGIISALGSNIRDKFSIGQRVFTTSTITGSYXXXXXXXXXXXXXXPSKLSFQQGASLGTPYFTAYSALFDRGQAKSGETVLIHGASGAVGIAAIQLAKANNLTVIGTAGTTEGLDMIKSIGADYVFNHNADGYVNEIKGQFANKINIVIEMLANQNLVVDCEMAAIKARIMIVGCRGTINFDPRLTMGKLLDVRGVALGMNSLDQWENAGLQMSNWMESGDICPIISKEYDLQDAGKAHHDIIFNSGTTGKLVLRI 989
            MKAIR+++FG    LKL  ++ IP PS++EVLI++  AG+NPVDTY R G YS +P LP+ PG D +G++ A+G  +  +F  G RVFT ++++G+YA  A A++  V  L  KLSF QGAS G PY+TAY +LF R QAK GETVL+HGASG VG+AA+QLAK++ L V+GTAGT EGLD++K  GAD+V+NH    Y++++  +    I+IV+EMLAN NL  D  +   + RI+++GCRG+I  +PRL+MGK  ++ GVAL  ++   W+     +     +G + P I K Y L++A +A +D+I N+GT G LVL+I
Sbjct:   21 MKAIRVAKFGGVENLKLETDIPIPIPSDSEVLIKIHAAGINPVDTYIRTGTYSRVPQLPYTPGQDAAGVVEAVGEGV-TQFKKGDRVFTMTSVSGTYAEFATANIKFVAHLDDKLSFAQGASFGVPYYTAYKSLFLRAQAKPGETVLVHGASGGVGLAAVQLAKSHGLRVVGTAGTKEGLDLVKKNGADFVYNHREPDYLDKVIKEVEGGIDIVLEMLANVNLQNDLNIVNFRGRIVVIGCRGSIQINPRLSMGKESNIMGVALMTSTEADWKEMHAALQAGQRTGCLVPHIGKIYSLKEADRAQNDVINNAGTFGNLVLQI 341          
BLAST of Quinone oxidoreductase vs. TrEMBL
Match: A0A093PSC0 (Quinone oxidoreductase (Fragment) OS=Manacus vitellinus OX=328815 GN=N305_09465 PE=4 SV=1)

HSP 1 Score: 299.671 bits (766), Expect = 1.390e-96
Identity = 157/321 (48.91%), Postives = 216/321 (67.29%), Query Frame = 3
Query:   24 MKAIRISEFGEPCVLKLIENLMIPKPSENEVLIEVKYAGVNPVDTYRRAGKYSVLPTLPWVPGSDCSGIISALGSNIRDKFSIGQRVFTTSTITGSYXXXXXXXXXXXXXXPSKLSFQQGASLGTPYFTAYSALFDRGQAKSGETVLIHGASGAVGIAAIQLAKANNLTVIGTAGTTEGLDMIKSIGADYVFNHNADGYVNEIKG-QFANKINIVIEMLANQNLVVDCEMAAIKARIMIVGCRGTINFDPRLTMGKLLDVRGVALGMNSLDQWENAGLQMSNWMESGDICPIISKEYDLQDAGKAHHDIIFNSGTTGKLVL 983
            M+AIR+ EFG P VLKL  +++IP P EN+VLI+V   GVNPV+TY R+G Y+  P LP+ PGSD SG+I ++G ++   F  G RVFT  T++G YA +A+A+ + V  LP KL F+QGA+LG PYFTAY ALF +G AK+GE+VL+HGASG VG+AA Q+A+A  L V+GTAGT EG++MI   GA   FNH    Y+  IK       ++I+IEML+N NL  D ++ A   R+M+VGCRG I  +PR TM K   + GV+L + + ++       + + +E+G + PI+  EY L+   KAH DII +SG  GK+VL
Sbjct:   10 MRAIRVFEFGGPEVLKLQSDVLIPVPKENQVLIKVHACGVNPVETYIRSGTYARKPALPYTPGSDVSGVIESVGEHV-TAFKKGDRVFTLETVSGGYAEYAVAAANRVFPLPDKLDFRQGAALGVPYFTAYRALFQKGCAKAGESVLVHGASGGVGLAACQIARACGLKVLGTAGTEEGMNMILRNGAHQAFNHRDPNYIERIKECTGPGGVDIIIEMLSNVNLDADLQLLAHAGRVMVVGCRGRIEINPRDTMSKESSIIGVSLFLATEEERHECATALLDGIEAGWLKPIVGSEYPLEKVAKAHEDIICSSGARGKMVL 329          
BLAST of Quinone oxidoreductase vs. TrEMBL
Match: A0A0A0AD40 (Quinone oxidoreductase (Fragment) OS=Charadrius vociferus OX=50402 GN=N301_10312 PE=4 SV=1)

HSP 1 Score: 298.901 bits (764), Expect = 3.246e-96
Identity = 151/321 (47.04%), Postives = 217/321 (67.60%), Query Frame = 3
Query:   24 MKAIRISEFGEPCVLKLIENLMIPKPSENEVLIEVKYAGVNPVDTYRRAGKYSVLPTLPWVPGSDCSGIISALGSNIRDKFSIGQRVFTTSTITGSYXXXXXXXXXXXXXXPSKLSFQQGASLGTPYFTAYSALFDRGQAKSGETVLIHGASGAVGIAAIQLAKANNLTVIGTAGTTEGLDMIKSIGADYVFNHNADGYVNEIKGQFANK-INIVIEMLANQNLVVDCEMAAIKARIMIVGCRGTINFDPRLTMGKLLDVRGVALGMNSLDQWENAGLQMSNWMESGDICPIISKEYDLQDAGKAHHDIIFNSGTTGKLVL 983
            M+A+R+ EFG P VLKL  +++IP P EN+VLI+V   GVNPV+TY R+G Y+  P LP+ PGSD +G++  +G ++   F  G RVFTT TI+G YA + +A+ + V  L  KL F+QGA++G PYFTAY ALF +G+AK+GE+VL+HGASG VGIA  Q+A+A  L V+GTAGT EG++M+   GA   FNH    Y+N+IK     + ++I+IEML+N NL  D ++ +   R+++VGCRG I  +PR TM K   + GV+L + + ++       + + ME+G + P++  EY L+   KAH DII +SG  GK+VL
Sbjct:   10 MRAVRVLEFGGPEVLKLQSDVLIPDPKENQVLIKVHACGVNPVETYIRSGNYARKPALPYTPGSDVAGVVEGVGEHV-TAFKKGDRVFTTGTISGGYADYTVAAANSVFPLSDKLDFRQGAAIGIPYFTAYRALFQKGRAKAGESVLVHGASGGVGIATCQIARACGLKVLGTAGTEEGMNMVLRNGAHQAFNHREANYINKIKEYTGMEGVDIIIEMLSNINLATDLQLLSYAGRVLVVGCRGPIEINPRDTMSKESSIIGVSLFLATEEERRECAAALLDGMEAGWLKPVVGSEYPLEKVVKAHKDIIHSSGARGKMVL 329          
BLAST of Quinone oxidoreductase vs. Ensembl Cavefish
Match: cryz (crystallin, zeta (quinone reductase) [Source:ZFIN;Acc:ZDB-GENE-050306-24])

HSP 1 Score: 275.404 bits (703), Expect = 1.640e-90
Identity = 152/321 (47.35%), Postives = 210/321 (65.42%), Query Frame = 3
Query:   24 MKAIRISEFGEPCVLKLIENLMIPKPSENEVLIEVKYAGVNPVDTYRRAGKYSVLPTLPWVPGSDCSGIISALGSNIRDKFSIGQRVFTTSTITGSYXXXXXXXXXXXXXXPSKLSFQQGASLGTPYFTAYSALFDRGQAKSGETVLIHGASGAVGIAAIQLAKANNLTVIGTAGTTEGLDMIKSIGADYVFNHNADGYVNEIK-GQFANKINIVIEMLANQNLVVDCEMAAIKARIMIVGCRGTINFDPRLTMGKLLDVRGVALGMNSLDQWENAGLQMSNWMESGDICPIISKEYDLQDAGKAHHDIIFNSGTTGKLVL 983
            MK IR+SEFG P VLKL  ++ +P P + +VLI V   GVNPV+TY RAG Y  LP+LP+ PG+D +G++ A+          G RVFTT+T TG YA   +AS   VH LP  L+++QGA++  PYFTA+ ALF +G A++GETVLIHGASG VGIAA QLA+A  L V+GTAGT EG+ ++ + GA  V+NH    Y+++I+       IN++IEML+N NL  D ++ ++  R++IVG RG I   PR TM K   + GV+L  +S +        +   ME+G + P++ +EY L  A +AH DII N GT+GK+VL
Sbjct:   10 MKCIRVSEFGGPSVLKLCSDVPVPTPGQKQVLIRVHACGVNPVETYIRAGTYGRLPSLPYTPGTDVAGVVQAV-GGGVSFLQKGDRVFTTATETGGYAEFTIASEGSVHKLPDSLAYKQGAAIAIPYFTAHRALFHKGHARAGETVLIHGASGGVGIAACQLARAFGLKVLGTAGTPEGMKLVLNNGAHAVYNHREKDYLDKIQEATDGQGINVIIEMLSNVNLSNDLKLLSVGGRVLIVGSRGPIEIHPRDTMAKESSIIGVSLFNSSKEDKAETAAVLYAGMEAGWLKPVVGQEYTLDKAAQAHEDIISNPGTSGKMVL 329          
BLAST of Quinone oxidoreductase vs. Ensembl Cavefish
Match: cryz (crystallin, zeta (quinone reductase) [Source:ZFIN;Acc:ZDB-GENE-050306-24])

HSP 1 Score: 275.018 bits (702), Expect = 1.998e-90
Identity = 152/321 (47.35%), Postives = 210/321 (65.42%), Query Frame = 3
Query:   24 MKAIRISEFGEPCVLKLIENLMIPKPSENEVLIEVKYAGVNPVDTYRRAGKYSVLPTLPWVPGSDCSGIISALGSNIRDKFSIGQRVFTTSTITGSYXXXXXXXXXXXXXXPSKLSFQQGASLGTPYFTAYSALFDRGQAKSGETVLIHGASGAVGIAAIQLAKANNLTVIGTAGTTEGLDMIKSIGADYVFNHNADGYVNEIK-GQFANKINIVIEMLANQNLVVDCEMAAIKARIMIVGCRGTINFDPRLTMGKLLDVRGVALGMNSLDQWENAGLQMSNWMESGDICPIISKEYDLQDAGKAHHDIIFNSGTTGKLVL 983
            MK IR+SEFG P VLKL  ++ +P P + +VLI V   GVNPV+TY RAG Y  LP+LP+ PG+D +G++ A+          G RVFTT+T TG YA   +AS   VH LP  L+++QGA++  PYFTA+ ALF +G A++GETVLIHGASG VGIAA QLA+A  L V+GTAGT EG+ ++ + GA  V+NH    Y+++I+       IN++IEML+N NL  D ++ ++  R++IVG RG I   PR TM K   + GV+L  +S +        +   ME+G + P++ +EY L  A +AH DII N GT+GK+VL
Sbjct:    8 MKCIRVSEFGGPSVLKLCSDVPVPTPGQKQVLIRVHACGVNPVETYIRAGTYGRLPSLPYTPGTDVAGVVQAV-GGGVSFLQKGDRVFTTATETGGYAEFTIASEGSVHKLPDSLAYKQGAAIAIPYFTAHRALFHKGHARAGETVLIHGASGGVGIAACQLARAFGLKVLGTAGTPEGMKLVLNNGAHAVYNHREKDYLDKIQEATDGQGINVIIEMLSNVNLSNDLKLLSVGGRVLIVGSRGPIEIHPRDTMAKESSIIGVSLFNSSKEDKAETAAVLYAGMEAGWLKPVVGQEYTLDKAAQAHEDIISNPGTSGKMVL 327          
BLAST of Quinone oxidoreductase vs. Ensembl Cavefish
Match: vat1l (vesicle amine transport 1 like [Source:NCBI gene;Acc:103037316])

HSP 1 Score: 112.079 bits (279), Expect = 2.246e-27
Identity = 76/225 (33.78%), Postives = 122/225 (54.22%), Query Frame = 3
Query:   18 EKMKAIRISEFGEPCVLKLIENLMIPKPSENEVLIEVKYAGVNPVDTYRRAGKYSVLPTLPWVPGSDCSGIISALGSNIRDKFSIGQRVFTTSTITGSYXXXXXXXXXXXXXXPSKLSFQQGASLGTPYFTAYSALFDRGQAKSGETVLIHGASGAVGIAAIQL-AKANNLTVIGTAGTTEGLDMIKSIGADYVFNHNADGYVNEIKGQFANKINIVIEMLANQN 689
            ++M+A+ ++ FG    LK+ +  M P+P E EV I VK  G+N +D   R G     P  P VPG +CSGI+ A+G N +  F IG RV        ++A      +  V+ +P +++F +GA+    +  AY  LF+    + G +VL+H A G VG A  QL +   N+TV GTA T +   +  S+   ++F+ N D YV E++    + ++IV++ L  +N
Sbjct:   36 KEMRAVLLTGFGGLNKLKVTKKPM-PEPQEGEVKIRVKACGLNFLDLMVRQGNIDNPPKTPLVPGFECSGIVEAIGENTKG-FEIGDRVMAFVNYN-AWAEVVCTPLEWVYKIPDEMTFPEGAAFCMNFVAAYMMLFEVANLRKGMSVLVHSAGGGVGQAVAQLCSTVPNVTVFGTASTFKHEAIRHSV--THLFDRNVD-YVAEVRKISPDGVDIVLDCLCGEN 254          
BLAST of Quinone oxidoreductase vs. Ensembl Cavefish
Match: TP53I3 (tumor protein p53 inducible protein 3 [Source:NCBI gene;Acc:103030043])

HSP 1 Score: 106.686 bits (265), Expect = 7.700e-26
Identity = 91/326 (27.91%), Postives = 151/326 (46.32%), Query Frame = 3
Query:   24 MKAIRISEFGEPCVLKLIENLMI-----PKPSENEVLIEVKYAGVNPVDTYRRAGKYSVLPTLPWVPGSDCSGIISALGSNIRDKFSIGQRVFTTSTITGSYXXXXXXXXXXXXXXPSKLSFQQGASLGTPYFTAYSALFDRGQAKSGETVLIHGASGAVGIAAIQLAKANNLTVIGTAGTTEGLDMIKSIGADYVFNHN----ADGYVNEIKGQFANKINIVIEMLANQNLVVDCEMAAIKARIMIVGCRGTINFDPRLTMGKLLDVRG-------VALGMNSLDQ--WENAGLQMSNWMESGDICPIISKEYDLQDAGKAHHDI 947
            M A+ + E G P      ENL +     PKP + EVLI+V    +N  D  +R G Y   P    + G + +G+I+ LG  ++  FS G +V    +  G YA +       +  +P  +S ++ A++   + TAY  L   G+ K GE+VLIH  +  VG AAIQLA+ +    + TAG+ E L +   +GA   FN+     +DG +   +G+    ++++++ +       +    A+  R ++ G  G  +    L +GKLL  RG         L  + L +   E A     +  +S  + PII   + + D   AH  +
Sbjct:    1 MLAVCVKEPGGP------ENLCVGEVPRPKPKDGEVLIKVNATALNRADLLQRKGIYPAPPGESEILGLEAAGVIAGLGPGVKKNFSPGDKVMALLS-GGGYAQYVAVPEELLMPVPPHISLEEAAAIPEAWLTAYQLLHFIGRVKQGESVLIHAGASGVGTAAIQLARLSCAIPVVTAGSPEKLKIASKLGAAAGFNYKEVDFSDGILQFTEGE---GVDVILDCIGGSCWEKNVRSLAMDGRWVLYGVMGGKSVGGDL-LGKLLFKRGHILSSLLSHLLQHKLVRSFTEEALTHFQSADQSTSLRPIIDSVFTMDDIADAHRHM 315          
BLAST of Quinone oxidoreductase vs. Ensembl Cavefish
Match: TP53I3 (tumor protein p53 inducible protein 3 [Source:NCBI gene;Acc:103030043])

HSP 1 Score: 105.916 bits (263), Expect = 1.527e-25
Identity = 91/329 (27.66%), Postives = 152/329 (46.20%), Query Frame = 3
Query:   24 MKAIRISEFGEPCVLKLIENLMI-----PKPSENEVLIEVKYAGVNPVDTYRRAGKYSVLPTLPWVPGSDCSGIISALGSNIRDKFSIGQRVFTTSTITGSYXXXXXXXXXXXXXXPSKLSFQQGASLGTPYFTAYSALFDRGQAKSGETVLIHGASGAVGIAAIQLAKANNLTVIGTAGTTEGLDMIKSIGADYVFNHN----ADGYVNEIKGQFANKINIVIEMLANQNLVVDCEMAAIKARIMIVGCRGTINFDPRLTMGKLLDVRG---VALGMNSLDQW---------ENAGLQMSNWMESGDICPIISKEYDLQDAGKAHHDI 947
            M A+ + E G P      ENL +     PKP + EVLI+V    +N  D  +R G Y   P    + G + +G+I+ LG  ++  FS G +V    +  G YA +       +  +P  +S ++ A++   + TAY  L   G+ K GE+VLIH  +  VG AAIQLA+ +    + TAG+ E L +   +GA   FN+     +DG +   +G+    ++++++ +       +    A+  R ++ G  G  +    L +GKLL  RG    +L  +   Q+         E A     +  +S  + PII   + + D   AH  +
Sbjct:   11 MLAVCVKEPGGP------ENLCVGEVPRPKPKDGEVLIKVNATALNRADLLQRKGIYPAPPGESEILGLEAAGVIAGLGPGVKKNFSPGDKVMALLS-GGGYAQYVAVPEELLMPVPPHISLEEAAAIPEAWLTAYQLLHFIGRVKQGESVLIHAGASGVGTAAIQLARLSCAIPVVTAGSPEKLKIASKLGAAAGFNYKEVDFSDGILQFTEGR---GVDVILDCIGGSCWEKNVRSLAMDGRWVLYGVMGGKSVGGDL-LGKLLFKRGHILSSLLRSRSLQYKAELVRSFTEEALTHFQSADQSTSLRPIIDSVFTMDDIADAHRHM 328          
BLAST of Quinone oxidoreductase vs. Ensembl Sea Lamprey
Match: vat1 (vesicle amine transport 1 [Source:NCBI gene;Acc:368752])

HSP 1 Score: 85.5001 bits (210), Expect = 1.394e-18
Identity = 68/244 (27.87%), Postives = 119/244 (48.77%), Query Frame = 3
Query:   18 EKMKAIRISEFGEPCVLKLIENLMIPKPSENEVLIEVKYAGVNPVDTYRRAGKYSVLPTLPWVPGSDCSGIISALGSNIRDKFSIGQRVFTTSTITGSYXXXXXXXXXXXXXXPSKLSFQQGASLGTPYFTAYSALFDRGQAKSGETVLIHGASGAVGIAAIQLAKA-NNLTVIGTAGTTEGLDMIKSIGADYVFNHNADGYVNEIKGQFANKINIVIEMLANQNLVVDCEMAAIKARIMIVGC 746
            E+ KA+ ++ FG    L++        P+  EV I V   G+N  +   R G Y  LP  P    + C+   + LG     +     RV   +   G + S    +      +P+++SF++GA++   Y TAY  LFD    + G++VL+H A+G VGIAA QL K   N+T+ GTA  ++  D+I+  G  +  ++ +  YV E++      ++IV++ L   +   +  +     +++I G 
Sbjct:   55 EQYKAVVLTSFGGYDKLRVERRTGAMVPAAGEVRIRVHACGLNFAELMARQGLYDCLPKKPPGRWARCAPKPTLLGVGGVGRNVG-DRVLVVNR-GGLWQSLVCVAATKTFIMPNEMSFEEGAAIPVNYITAYMMLFDFANLREGKSVLLHMAAGGVGIAATQLCKTVPNVTLFGTASASKH-DIIREQGVTHPIDYRSLDYVAEVRKISPKGVDIVLDPLGGSDNAKNYNLLKPMGKMVIYGA 295          
BLAST of Quinone oxidoreductase vs. Ensembl Sea Lamprey
Match: mecr (mitochondrial trans-2-enoyl-CoA reductase [Source:NCBI gene;Acc:550550])

HSP 1 Score: 76.6406 bits (187), Expect = 5.559e-16
Identity = 62/222 (27.93%), Postives = 105/222 (47.30%), Query Frame = 3
Query:   51 GEPCVLKLIENLMIPKPSENEVLIEVKYAGVNPVDTYRRAGKYSVLPTLPWVPGSDCSGIISALGSNIRDKFSIGQRVFTTSTITGSYXXXXXXXXXXXXXXPSKLSFQQGASLGTPYFTAYSALFDRGQAKSGETVLIHGASGAVGIAAIQLAKANNLTVIGTAGTTEGLD----MIKSIGADYVFNHNADGYVNEIKGQFANKINIVIEMLANQNLVVDC 704
            GEP  +  +E   +P   E EV + +  A +NP D     GKY V P LP V G++  G +  +GS +     +G  V    +  G++ + A+     +  +P +L     A++G    +AY  L D      G+TV+ +GA+ AVG A IQ+A +  L  I        L      +K++G D+VF        +E++ +  + +  V++ML    L ++C
Sbjct:   12 GEPQHVLRLEERTLPPVGEGEVRVRMLAAPINPGDINMVQGKYVVQPPLPAVGGNEGVGQVEEVGSKV-TTLKLGDWVLPCDSGFGTWRTRAVCPEAALLRVPPELPLLSAATIGMNPASAYRMLHDFTMLSPGDTVIQNGANSAVGQAVIQIAASLGLVSINIVRDRPELPKLVAKLKALGGDFVF--------SEVELRRPD-VREVLKMLCKPRLALNC 223          
BLAST of Quinone oxidoreductase vs. Ensembl Sea Lamprey
Match: ZADH2 (zinc binding alcohol dehydrogenase domain containing 2 [Source:HGNC Symbol;Acc:HGNC:28697])

HSP 1 Score: 70.0922 bits (170), Expect = 1.082e-13
Identity = 52/223 (23.32%), Postives = 101/223 (45.29%), Query Frame = 3
Query:   75 IENLMIPKPSENEVLIEVKYAGVNPVDTYRRAGKYSVLPTLPWVPGSDCSGIISALGSNIRDKFSIGQRVFTTSTITGSYXXXXXXXXXXXXXXPSKLSFQQGASLGTPYFTAYSALFDRGQAKSGETVLIHGASGAVGIAAIQLAKANNLTVIGTAGTTEGLDMIKSIGADYVFNHNADGYVNEIKGQFANKINIVIEMLANQNLVVDCEMAAIKARIMIVG 743
            ++   +P P  ++VL+  ++ G+N  D    AG+Y+     P+  G +  G + A G     +FS+GQ V     + G++A + +     +  LP   +  +  +L     TA  +L    + ++GE+VL+  A+G  G  A+QL+      V+GT  + E    + ++G     N   +     +K +    +N+V E +            A+  R++I+G
Sbjct:   50 LQEAPVPSPDSDQVLVRNRFVGINASDINFSAGRYNPRVRPPFDAGLEAVGTVVARGLAASARFSLGQPV--AYAVEGAFAEYKVVPTASIFPLPELKA--EYLTLPVSALTALLSLERSAELRAGESVLVTAAAGGTGQFAVQLSARAGCRVLGTCSSDEKAAFLATLGCHRPINVRKESLAKVLKEECPKGVNVVYESVGGDTFETAVNSLAVGGRLIIIG 268          
BLAST of Quinone oxidoreductase vs. Ensembl Sea Lamprey
Match: fasn (fatty acid synthase [Source:ZFIN;Acc:ZDB-GENE-030131-7802])

HSP 1 Score: 63.929 bits (154), Expect = 2.086e-11
Identity = 58/224 (25.89%), Postives = 95/224 (42.41%), Query Frame = 3
Query:  357 PSKLSFQQGASLGTPYFTAYSALFDRGQAKSGETVLIHGASGAVGIAAIQLAKANNLTVIGTAGTTEGLDMIKSIGA---DYVFNHNADGYVNE--IKGQFANKINIVIEMLANQNLVVDCEMAAIKARIMIVGCRGTINFDPRLTMGKLLDVRGVALGMNSLD--------QWENAGLQMSNWMESGDICPIISKEYDLQDAGKAHHDIIFNSGTTGKLVLRI 989
            P   S +Q +S+   Y TA  AL  RG+ + GE+VLIH  SG VG AAI +A +   TV  T G+ E    ++       D  F ++ D    +  +K      ++IV+  L  + L       A   R + +G     N  P   +G  L ++ VA     LD        +WE     + + +  G + P+ +  +  Q    A    +      GK+V+++
Sbjct:   41 PKTWSLEQASSVPVVYATAIYALLVRGRMRRGESVLIHSGSGGVGQAAIAIALSMGCTVYTTVGSAEKRAYLQKTFPQLKDEAFANSRDTTFEQHVLKATNGKGVDIVLNSLTEEKLQASLRCLARHGRFLEIGKYDLSNNSP---LGMALFLKNVAFHGILLDALFEEGNREWEEVAALLRDGIARGTVKPLRTTVFLRQQVEDAFR-FMAQGKHIGKVVVQV 260          
BLAST of Quinone oxidoreductase vs. Ensembl Sea Lamprey
Match: fasn (fatty acid synthase [Source:ZFIN;Acc:ZDB-GENE-030131-7802])

HSP 1 Score: 63.1586 bits (152), Expect = 4.175e-11
Identity = 53/193 (27.46%), Postives = 83/193 (43.01%), Query Frame = 3
Query:  357 PSKLSFQQGASLGTPYFTAYSALFDRGQAKSGETVLIHGASGAVGIAAIQLAKANNLTVIGTAGTTEGLDMIKSIG---ADYVFNHNADGYVNE--IKGQFANKINIVIEMLANQNLVVDCEMAAIKARIMIVGCRGTINFDPRLTMGKLLDVRGVALGMNSLD--------QWENAGLQMSNWMESGDICPI 896
            P   S +Q +S+   Y TA  AL  RG+ + GE+VLIH  SG VG AAI +A +   TV  T G+ E    ++       D  F ++ D    +  +K      ++IV+  L  + L       A   R + +G     N  P   +G  L ++ VA     LD        +WE     + + +  G + P+
Sbjct:  895 PKTWSLEQASSVPVVYATAIYALLVRGRMRRGESVLIHSGSGGVGQAAIAIALSMGCTVYTTVGSAEKRAYLQKTFPQLKDEAFANSRDTTFEQHVLKATNGKGVDIVLNSLTEEKLQASLRCLARHGRFLEIGKYDLSNNSP---LGMALFLKNVAFHGILLDALFEEGNREWEEVAALLRDGIARGTVKPL 1084          
BLAST of Quinone oxidoreductase vs. Ensembl Yeast
Match: ZTA1 (NADPH-dependent quinone reductase; GFP-tagged protein localizes to the cytoplasm and nucleus; has similarity to E. coli quinone oxidoreductase and to human zeta-crystallin [Source:SGD;Acc:S000000250])

HSP 1 Score: 85.5001 bits (210), Expect = 3.341e-19
Identity = 92/332 (27.71%), Postives = 145/332 (43.67%), Query Frame = 3
Query:   18 EKMKAIRISEFGEPCVLKLIENLMIPKPSENEVLIEVKYAGVNPVDTYRRAGKYSVLPTLPWVPGSDCSGIISALGSNIRDKFSIGQRV--FTTSTITGSYXXXXXXXXXXXXXXPSKLSFQQGASLGTPYFTAYSALFDRGQAKSGETVLIHGASGAVGIAAIQLAKANNLTVIGTAGTTEGLDMIKSIGADYVFNHNADGYVNEIKGQFANKINIVIEMLANQNLVVDCEMAAIKARIMIVGCRGTINFDP-----RLTMGKLLDVRGVALG-MNSLDQWENAGLQMSNWMESGDICPIISKEYDLQDAGKAHHDIIFNSGTTGKLVLRI 989
            E+ K I I E G   V+K  E+  +P  SE E+LI+ KY GVN +++Y R G Y      P+V G + SG + A G  + + F +G +V   + ST        +   V  +    S    +  A+      TA S   +    K G+ VL+  A+G VG+   QL K      I  A T E L + K  GA+Y+ N + +  + ++  +F N   +     +      +  +AA+K + + V         P     RL+   +  VR    G +   ++W+    +    + S  +   I K Y L+D   A  DI  +  T GKLVL I
Sbjct:    7 EQQKVILIDEIGGYDVIKY-EDYPVPSISEEELLIKNKYTGVNYIESYFRKGIYPC--EKPYVLGREASGTVVAKGKGVTN-FEVGDQVAYISNSTFAQYSKISSQGPVMKLPKGTSDEELKLYAAGLLQVLTALSFTNEAYHVKKGDYVLLFAAAGGVGLILNQLLKMKGAHTIAVASTDEKLKIAKEYGAEYLINASKEDILRQVL-KFTNGKGVDASFDSVGKDTFEISLAALKRKGVFVSFGNASGLIPPFSITRLSPKNITLVRPQLYGYIADPEEWKYYSDEFFGLVNSKKLNIKIYKTYPLRDYRTAAADIE-SRKTVGKLVLEI 332          
BLAST of Quinone oxidoreductase vs. Ensembl Yeast
Match: ADH1 (Alcohol dehydrogenase; fermentative isozyme active as homo- or heterotetramers; required for the reduction of acetaldehyde to ethanol, the last step in the glycolytic pathway; ADH1 has a paralog, ADH5, that arose from the whole genome duplication [Source:SGD;Acc:S000005446])

HSP 1 Score: 63.5438 bits (153), Expect = 1.041e-11
Identity = 53/198 (26.77%), Postives = 84/198 (42.42%), Query Frame = 3
Query:   78 ENLMIPKPSENEVLIEVKYAGVNPVDTYRRAGKYSVLPTLPWVPGSDCSGIISALGSNIRDKFSIGQRV---------------------------FTTSTITGSYXXXXXXXXXXXXXXPSKLSFQQGASLGTPYFTAYSALFDRGQAKSGETVLIHGASGAVGIAAIQLAKANNLTVIGTAGTTEGLDMIKSIGAD 590
            +++ +PKP  NE+LI VKY+GV   D +   G + +   LP V G + +G++  +G N++  + IG                               +  T  GS+  +A A       +P      Q A +     T Y AL       +G  V I GA+G +G  A+Q AKA    V+G  G     ++ +SIG +
Sbjct:   22 KDIPVPKPKANELLINVKYSGVCHTDLHAWHGDWPLPVKLPLVGGHEGAGVVVGMGENVKG-WKIGDYAGIKWLNGSCMACEYCELGNESNCPHADLSGYTHDGSFQQYATADAVQAAHIPQGTDLAQVAPILCAGITVYKAL-KSANLMAGHWVAISGAAGGLGSLAVQYAKAMGYRVLGIDGGEGKEELFRSIGGE 217          
BLAST of Quinone oxidoreductase vs. Ensembl Yeast
Match: ADH2 (Glucose-repressible alcohol dehydrogenase II; catalyzes the conversion of ethanol to acetaldehyde; involved in the production of certain carboxylate esters; regulated by ADR1 [Source:SGD;Acc:S000004918])

HSP 1 Score: 59.3066 bits (142), Expect = 1.960e-10
Identity = 50/198 (25.25%), Postives = 83/198 (41.92%), Query Frame = 3
Query:   78 ENLMIPKPSENEVLIEVKYAGVNPVDTYRRAGKYSVLPTLPWVPGSDCSGIISALGSNIRDKFSIGQRV---------------------------FTTSTITGSYXXXXXXXXXXXXXXPSKLSFQQGASLGTPYFTAYSALFDRGQAKSGETVLIHGASGAVGIAAIQLAKANNLTVIGTAGTTEGLDMIKSIGAD 590
            +++ +PKP  NE+LI VKY+GV   D +   G + +   LP V G + +G++  +G N++  + IG                               +  T  GS+  +A A       +P      + A +     T Y AL      ++G    I GA+G +G  A+Q AKA    V+G  G     ++  S+G +
Sbjct:   22 KDIPVPKPKPNELLINVKYSGVCHTDLHAWHGDWPLPTKLPLVGGHEGAGVVVGMGENVKG-WKIGDYAGIKWLNGSCMACEYCELGNESNCPHADLSGYTHDGSFQEYATADAVQAAHIPQGTDLAEVAPILCAGITVYKAL-KSANLRAGHWAAISGAAGGLGSLAVQYAKAMGYRVLGIDGGPGKEELFTSLGGE 217          
BLAST of Quinone oxidoreductase vs. Ensembl Yeast
Match: ADH5 (Alcohol dehydrogenase isoenzyme V; involved in ethanol production; ADH5 has a paralog, ADH1, that arose from the whole genome duplication [Source:SGD;Acc:S000000349])

HSP 1 Score: 59.3066 bits (142), Expect = 2.313e-10
Identity = 56/220 (25.45%), Postives = 90/220 (40.91%), Query Frame = 3
Query:    9 ILYEKMKAIRISEFGEPCVLKLIENLMIPKPSENEVLIEVKYAGVNPVDTYRRAGKYSVLPTLPWVPGSDCSGIISALGSNIR--------------------DKFSIGQRVF------TTSTITGSYXXXXXXXXXXXXXXPSKLSFQQGASLGTPYFTAYSALFDRGQAKSGETVLIHGASGAVGIAAIQLAKANNLTVIGTAGTTEGLDMIKSIGAD 590
            ++ EK KAI   E       K   ++ +P+P  NE+L+ VKY+GV   D +   G +      P + G + +G++  LGSN++                    +   +G          T  T  G++  +A A       +P  ++  + A +     T Y AL  R     G+ V I GA G +G  AIQ A A    VIG  G      + + +G +
Sbjct:    5 VIPEKQKAIVFYETDGKLEYK---DVTVPEPKPNEILVHVKYSGVCHSDLHAWHGDWPFQLKFPLIGGHEGAGVVVKLGSNVKGWKVGDFAGIKWLNGTCMSCEYCEVGNESQCPYLDGTGFTHDGTFQEYATADAVQAAHIPPNVNLAEVAPILCAGITVYKAL-KRANVIPGQWVTISGACGGLGSLAIQYALAMGYRVIGIDGGNAKRKLFEQLGGE 220          
BLAST of Quinone oxidoreductase vs. Ensembl Yeast
Match: ADH3 (Mitochondrial alcohol dehydrogenase isozyme III; involved in the shuttling of mitochondrial NADH to the cytosol under anaerobic conditions and ethanol production [Source:SGD;Acc:S000004688])

HSP 1 Score: 58.5362 bits (140), Expect = 4.094e-10
Identity = 52/198 (26.26%), Postives = 81/198 (40.91%), Query Frame = 3
Query:   78 ENLMIPKPSENEVLIEVKYAGVNPVDTYRRAGKYSVLPTLPWVPGSDCSGIISALGSNIRDKFSIGQ----RVFTTSTIT-----------------GSYXXXXXXXXXXXXXXPSKLSFQQGASLG--TPYF----TAYSALFDRGQAKSGETVLIHGASGAVGIAAIQLAKANNLTVIGTAGTTEGLDMIKSIGAD 590
            +++ +P+P  NE+LI VKY+GV   D +   G + +   LP V G + +G++  LGSN++  + +G     +    S +T                   Y                    QQG  L    P      T Y AL      K+G+ V I GA+G +G  A+Q A A    V+G     E   + K +G +
Sbjct:   49 KDIPVPEPKPNEILINVKYSGVCHTDLHAWHGDWPLPVKLPLVGGHEGAGVVVKLGSNVKG-WKVGDLAGIKWLNGSCMTCEFCESGHESNCPDADLSGYTHDGSFQQFATADAIQAAKIQQGTDLAEVAPILCAGVTVYKAL-KEADLKAGDWVAISGAAGGLGSLAVQYATAMGYRVLGIDAGEEKEKLFKKLGGE 244          
BLAST of Quinone oxidoreductase vs. Ensembl Nematostella
Match: EDO33308 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SSL9])

HSP 1 Score: 201.83 bits (512), Expect = 4.690e-63
Identity = 113/261 (43.30%), Postives = 164/261 (62.84%), Query Frame = 3
Query:  114 VLIEVKYAGVNPVDTYRRAGKYSVLPTLPWVPGSDCSGIISALGSNIRDKFSIGQRVFTTSTITGSYXXXXXXXXXXXXXXPSKLSFQQGASLGTPYFTAYSALFDRGQAKSGETVLIHGASGAVGIAAIQLAKANNLTVIGTAGTTEGLDMIKSIGADYVFNHNADGYVNEI-KGQFANKINIVIEMLANQNLVVDCEMAAIKARIMIVGCRGTINFDPRLTMGKLLDVRGVALGMNSLDQWENAGLQMSNWMESGDICP 893
            VLI++  A V+PV+TY R+G Y+ LP LP+ PG+  +GII A+G  +  K  +G  V+T ST+TGSYA + +    +V  L S L F +GA++G  YFTAY AL  R  AK GETVL+HGASG VG AA+Q+A+A  + VIGTAG+++G ++++  GA +VFNH    Y   I +       ++++EMLAN NL  D ++ +   RI ++G RG+I  +PRLTM K   + GV L   + D+ +     M   ME+G + P
Sbjct:    2 VLIKLSAASVSPVETYIRSGSYARLPELPFTPGNYGAGIIHAIGDEV-TKHKVGDHVYTLSTLTGSYAEYTVCEEDNVFLLHSSLGFSEGANVGITYFTAYRALCHRLGAKPGETVLVHGASGGVGTAAVQIARAYGMHVIGTAGSSKGEELVRQAGAHHVFNHRELNYTQGILEATDGQGPDVILEMLANVNLAKDLDLVSNGGRIGVIGSRGSIEINPRLTMAKECSIVGVMLLKVNKDELKEMSAAMHAGMEAGWLRP 261          
BLAST of Quinone oxidoreductase vs. Ensembl Nematostella
Match: EDO34864 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SN66])

HSP 1 Score: 95.1301 bits (235), Expect = 2.979e-22
Identity = 84/316 (26.58%), Postives = 134/316 (42.41%), Query Frame = 3
Query:  114 VLIEVKYAGVNPVDTYRRAGKYSVLPTL---PWVPGSDCSGIISALGSNIRDKFSIGQRVFTTSTITGSYXXXXXXXXXXXXXXPSKLSFQQGASLGTPYFTAYSALFDRGQAKSGETVLIHGASGAVGIAAIQLAKANNLTVIGTAGTTEGLDMIKSIGADYVFNHNADGYVNEIKGQFANKINIVIEMLANQNLVVDCEMAAIKARIMIVGCR-------------GTINFDPRL--------TMGKLLDVRGVALGMNSLDQWENAGLQMSNWMESGDICPIISKEYDLQDAGKAHHDIIFNSGTTGKLVLRI 989
            ++++    GVN  D   R G Y         P  PG + SG+I   G N+ + F IGQ VF  S + GSY+       + + ALP K+S  + A L T   TA+ A F+    + G  VL+H A+G VG   +Q+AK      +G  G    +D ++S+G D+V + +A     E K    +  + V +      L       A   +++I G               G   F P +        T  K +    ++   + ++    A  Q+  W+E G +       Y L+    AH D+  ++ T GKLVL +
Sbjct:    1 MVVKTFACGVNYADICIRWGLYESAKKFVGWPITPGFEFSGVIQWKGENVTE-FEIGQEVFGAS-LFGSYSECIRVPKNQLFALPKKMSKNEAAGLPTVALTAWYAFFELAHTRPGAWVLVHSAAGGVGSMLVQMAKIAGCHAVGVVGAGHKIDFVRSLGCDHVIDKSAQDLWQEAKVICPDGFSAVFDANGVATLKQSYAHLAPGGKLVIYGKNVMEDLSRSLMPQMGKATFYPNIPCQFLSMTTANKSIMAFNLSFMFDQIELLAGAMKQIIGWVEEGQLKVARVSSYPLKQVAMAHRDLE-SAQTVGKLVLTM 313          
BLAST of Quinone oxidoreductase vs. Ensembl Nematostella
Match: EDO47302 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RMP3])

HSP 1 Score: 95.5153 bits (236), Expect = 5.778e-22
Identity = 56/202 (27.72%), Postives = 107/202 (52.97%), Query Frame = 3
Query:   75 IENLMIPKPSENEVLIEVKYAGVNPVDTYRRAGKYSVLPTLPWVPGSDCSGIISALGSNIRDKFSIGQRVFTTSTITGSYXXXXXXXXXXXXXXPSKLSFQQGASLGTPYFTAYSALFDRGQAKSGETVLIHGASGAVGIAAIQLAKA-NNLTVIGTAGTTEGLDMIKSIGADYVFNHNADGYVNEIKGQFANKINIVIEML 677
            +E    PKP + +V+++V   GV   D  +R G + + P  P+V G +CSG++  LG  +     +G RV   +   G +  +A       + +P  ++F++GA++   Y TA+  LF  G     ++VL+H A+G VG A  Q+ K+   +TV GTA   +  + I++ G  +  ++  + YV +++    + +++V++ L
Sbjct:   55 VEKYARPKPMQGQVVVKVHACGVTFADLLQRQGHFPLAPKPPYVCGFECSGVVEELGEEVTG-IDVGARVICLAPY-GMWTEYACVDAKMCYVMPEAMTFEEGAAIPITYLTAHLILFHLGNLGLRKSVLVHMAAGGVGTAVTQICKSVEGVTVFGTASENKH-EAIQAQGVTHPIDYRKEDYVKKVREISPDGVDLVLDPL 253          
BLAST of Quinone oxidoreductase vs. Ensembl Nematostella
Match: EDO48723 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RIK0])

HSP 1 Score: 93.2041 bits (230), Expect = 1.923e-21
Identity = 71/238 (29.83%), Postives = 106/238 (44.54%), Query Frame = 3
Query:   96 KPSENEVLIEVKYAGVNPVDTYRRAGKYSVLPTLPWVPGSDCSGIISALGSNIRDKFSIGQRV-FTTSTITGSYXXXXXXXXXXXXXXPSKLSFQQGASLGTPYFTAYSALFDRGQAKSGETVLIHGASGAVGIAAIQLAKANNLTVIGTAGTTEGLDMIKSIGADYVFNHNADGYVNEIKGQFANKINIVIEMLANQNLVVDCEMAAIKARIMIVGC----RGTINFDPRLTMGKLL 794
            +P   EVL++ +YAG+N  D    AG+Y      P+  G +  G + A G + + KFS+GQ V F        Y       V      P  L+            TA  +L   G+ K GETVL+  A+G  G  A+QLAK     VIGT  T    D +KSIG D   N+  +     +  ++   I+++ E +  +         A K RI+++G     +  + F+P  T G LL
Sbjct:   35 EPGPEEVLVKTRYAGINATDINHTAGRYKPWNKPPFDAGLEGLGEVVATGKDYKGKFSVGQPVMFMRFGGFAEYTLTEKDIVPVPRTNPIFLTLPISG------MTAALSLEKLGELKKGETVLVTAAAGGTGQFAVQLAKQAGCHVIGTCSTEAKCDFLKSIGCDRPINYKTESLDKVLNKEYPKGIDVIYESIGGEIFDTCVNRLATKGRIIVIGFITAYKSQLGFNPSKT-GTLL 265          
BLAST of Quinone oxidoreductase vs. Ensembl Nematostella
Match: EDO30706 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T010])

HSP 1 Score: 80.8777 bits (198), Expect = 4.084e-17
Identity = 79/312 (25.32%), Postives = 133/312 (42.63%), Query Frame = 3
Query:   93 PKPSENEVLIEVKYAGVNPVDTYRRAGKYSVLPTLPWVPGSDCSGIISALGSNIRDKFSIGQRVFTTSTITGSYXXXXXXXXXXXXXXPSKLSFQQGASLGTPYFTAYSALFDRGQAKSGETVLIHGASGAVGIAAIQLAKANNLTVIGTAGTTEGLDMIKSIGADYVFNHNADGYVN---EIKGQFANKINIVIEMLANQNLVVDCEMAAIKARIMIVGCRGTINFD---------PRLTM-GKLLDVRGVALGMNSLDQWENAGLQMSNWMESGDICPIISKEYDLQDAGKAHHDIIFNSGTTGKLVLRI 989
            PK  E EVLI V +  +N  DT +R G Y   P    + G + SGI+  LGS     +  G +V       G YA  A     HV  +P  +S    A++   + T++  L   G  + G+ VLIH     VG A++QL +        TAG+ + +     +GA+  FN+    + +   E+ G     ++++ + +       + +  A   R ++ G  G  N D          R+T+ G  L  R +      +  +  A +       SG++ P+I     +    +AH  +  N   TGK+V+R+
Sbjct:   22 PKLKETEVLIRVHFTALNRADTLQRKGSYPPPPGESEILGLEVSGIVEELGSACNLGWRKGDKVMAL-VPGGGYAEFAAVQESHVMPIPKGMSQSDAATIPEVWLTSFQLLHLLGDIQQGDKVLIHAGGSGVGTASVQLVRLAGGVPYVTAGSQKKIQAAMDLGAEGGFNYKEGDFSDWALEVTG--GEGMDLITDCVGGSYWQQNIKALATDGRWILYGLLGGPNVDGNLLGQVLRKRVTLKGTTLRTRSIKYKAKLVKAFTEAAIPH---FSSGELKPLIDSILPMDRIQEAHTRMEQNL-NTGKIVIRV 326          
BLAST of Quinone oxidoreductase vs. Ensembl Medaka
Match: cryz (crystallin zeta [Source:NCBI gene;Acc:101174625])

HSP 1 Score: 283.878 bits (725), Expect = 8.115e-94
Identity = 147/323 (45.51%), Postives = 211/323 (65.33%), Query Frame = 3
Query:   24 MKAIRISEFGEPCVLKLIENLMIPKPSENEVLIEVKYAGVNPVDTYRRAGKYSVLPTLPWVPGSDCSGIISALGSNIRDKFSIGQRVFTTSTITGSYXXXXXXXXXXXXXXPSKLSFQQGASLGTPYFTAYSALFDRGQAKSGETVLIHGASGAVGIAAIQLAKANNLTVIGTAGTTEGLDMIKSIGADYVFNHNADGYVNEI-KGQFANKINIVIEMLANQNLVVDCEMAAIKARIMIVGCRGTINFDPRLTMGKLLDVRGVALGMNSLDQWENAGLQMSNWMESGDICPIISKEYDLQDAGKAHHDIIFNSGTTGKLVLRI 989
            M+AIR+SEFG P VLKL  ++ +P P   +VLI V+  GVNPV+TY R+G +   PTLP+ PG+D +G++ A+G  +      G RVFTT+T++G YA   +A+   VH LP  L F QG+++G PYFTAY AL  + +AK+GETVLIHGASG VG+AA QL++A  L V+GTAGT EG+ +  S GA  +FNH  +GY ++I +      ++I++EML+N NL  D +M A   R+ +VG RG+I  +PR TM K   + GVAL   + ++ +     +   ME+G + P++   Y L+ A +A HDII + G +GK+VL I
Sbjct:    7 MRAIRVSEFGGPAVLKLCSDVPVPVPGPRQVLIHVRACGVNPVETYIRSGGHGRKPTLPYTPGTDVAGVVEAVGDGV-TAVKAGDRVFTTATVSGGYAEFTVAAEDCVHWLPDALDFPQGSAIGIPYFTAYRALVHKARAKAGETVLIHGASGGVGVAACQLSRALGLRVLGTAGTPEGMKLALSNGAHLIFNHREEGYTDKIMEATGGAGVDIIVEMLSNVNLSKDLQMMAFGGRVTVVGARGSIEINPRDTMAKESSIMGVALFCATQEEKKECAALLYAGMEAGWLRPVVGSHYPLEKAAQAQHDIIESPGASGKIVLTI 328          
BLAST of Quinone oxidoreductase vs. Ensembl Medaka
Match: vat1 (synaptic vesicle membrane protein VAT-1 homolog [Source:NCBI gene;Acc:101167963])

HSP 1 Score: 109.768 bits (273), Expect = 3.389e-26
Identity = 70/218 (32.11%), Postives = 115/218 (52.75%), Query Frame = 3
Query:   27 KAIRISEFGEPCVLKLIENLMIPKPSENEVLIEVKYAGVNPVDTYRRAGKYSVLPTLPWVPGSDCSGIISALGSNIRDKFSIGQRVFTTSTITGSYXXXXXXXXXXXXXXPSKLSFQQGASLGTPYFTAYSALFDRGQAKSGETVLIHGASGAVGIAAIQLAKA-NNLTVIGTAGTTEGLDMIKSIGADYVFNHNADGYVNEIKGQFANKINIVIEML 677
            +A+ ++ +G    +KL      P     EVL+ VK  G+N  D   R G Y  LP+ P  PG +CSG++ A+G  + D+  +G +V   +   G +   A     H   +P  ++F++ A+L   Y TAY  LFD G  +  ++VL+H A+G VGIAA QL K   ++TV GTA  ++  + I S G  +  ++    YV E++      ++I+++ L
Sbjct:   63 RALVLTGYGGYDKVKLQVKKGKPALKAGEVLVRVKACGLNFADLMARQGLYDRLPSPPVTPGMECSGVVEAVGDEVTDR-KVGDKVMVLNRY-GLWQDVAAVPASHTFLIPDGMTFEEAAALPVNYITAYMMLFDFGNLRPNQSVLVHSAAGGVGIAATQLCKTVKDVTVFGTASASKH-ETISSGGVTHPIDYRTKDYVEEVRKISPKGLDIILDPL 277          
BLAST of Quinone oxidoreductase vs. Ensembl Medaka
Match: VAT1 (vesicle amine transport 1 [Source:NCBI gene;Acc:101155389])

HSP 1 Score: 106.301 bits (264), Expect = 3.005e-25
Identity = 68/219 (31.05%), Postives = 121/219 (55.25%), Query Frame = 3
Query:   27 KAIRISEFGEPCVLKLIEN-LMIPKPSENEVLIEVKYAGVNPVDTYRRAGKYSVLPTLPWVPGSDCSGIISALGSNIRDKFSIGQRVFTTSTITGSYXXXXXXXXXXXXXXPSKLSFQQGASLGTPYFTAYSALFDRGQAKSGETVLIHGASGAVGIAAIQLAKA-NNLTVIGTAGTTEGLDMIKSIGADYVFNHNADGYVNEIKGQFANKINIVIEML 677
            +A+ ++ +G    +KL E  L  P+    EVL+ VK  G+N  +   + G Y +LP+ P V G + SG++ A+G +++D+  +G RV   +  +G +    +        +P ++SF++ A+L   Y TAY  LF+    + G++VLIH A+G VG+AA QL +   ++TV GTA  ++  ++I   G  +  ++    YV EI+      ++IV++ L
Sbjct:   48 RALVLTGYGGYDKIKLQEKPLKSPQLQPGEVLVRVKACGLNFAELLGKQGLYELLPSPPVVLGMEGSGVVEAVGEDVKDR-KVGDRVIAMNR-SGMWQEWVVVPAQRTFPMPEEMSFEEAAALPINYMTAYMMLFEMANLRPGKSVLIHMAAGGVGVAATQLCQTVKDVTVFGTASASKH-EVISQGGVTHPIDYRTKDYVTEIRKVSPKGVDIVLDPL 263          
BLAST of Quinone oxidoreductase vs. Ensembl Medaka
Match: vat1l (vesicle amine transport 1 like [Source:NCBI gene;Acc:101162437])

HSP 1 Score: 96.2857 bits (238), Expect = 1.068e-21
Identity = 67/225 (29.78%), Postives = 117/225 (52.00%), Query Frame = 3
Query:   18 EKMKAIRISEFGEPCVLKLIENLMIPKPSENEVLIEVKYAGVNPVDTYRRAGKYSVLPTLPWVPGSDCSGIISALGSNIRDKFSIGQRVFTTSTITGSYXXXXXXXXXXXXXXPSKLSFQQGASLGTPYFTAYSALFDRGQAKSGETVLIHGASGAVGIAAIQL-AKANNLTVIGTAGTTEGLDMIKSIGADYVFNHNADGYVNEIKGQFANKINIVIEMLANQN 689
            ++M+A+ ++ FG    L++ +  M P+P + EV I VK  G+N +D   R G     P  P VPG +C GI+ ++G   +  F IG RV        ++A      V  V+ +P +++F + A+    +  AY  LF+    + G +VL+H A G VG A  QL A    ++V G A   +   +  S+   ++F+ N D ++ E+K    + ++IV++ L+ +N
Sbjct:   34 KEMRAVMLAGFGGLNKLRVTKKAM-PEPQDGEVKIRVKACGLNFLDLMVRQGNIDNPPKPPLVPGFECCGIVESVGEKTKG-FEIGDRVMAFVNYN-AWAEVVCTPVDFVYKMPDEMTFPEAAAFSLNFVAAYMMLFEVANLREGMSVLVHSAGGGVGQAVAQLCATVPKVSVFGIASCFKHSAIKDSV--THLFDRNID-FMQEVKKISPDGVDIVLDCLSGEN 252          
BLAST of Quinone oxidoreductase vs. Ensembl Medaka
Match: ZADH2 (zinc binding alcohol dehydrogenase domain containing 2 [Source:NCBI gene;Acc:101159978])

HSP 1 Score: 82.8037 bits (203), Expect = 3.282e-17
Identity = 64/219 (29.22%), Postives = 102/219 (46.58%), Query Frame = 3
Query:   90 IPKPSENEVLIEVKYAGVNPVDTYRRAGKYSVLPTLPWVPGSDCSGIISALGSNIRDKFSIGQRVFTTSTITGSYXXXXXXXXXXXXXXPS-KLSFQQGASLGTPYFTAYSALFDRGQAKSGETVLIHGASGAVGIAAIQLAKANNLTVIGTAGTTEGLDMIKSIGADYVFNHNADGYVNEIKGQFANKINIVIEMLANQNLVVDCEMAAIKARIMIVG 743
            +P P++ E+L+  ++ G+N  D    AG+Y      P+  G +  G +  LG +    F++G  V    +  G++A + L        +PS +  F      G    TAY AL   G    GETVL+  A+G  G  A+Q AK     VIGT  + E    +KSIG D   N+  +     +K ++   I++V E +    L +     A K R++I+G
Sbjct:   82 VPTPADTELLVRNRFVGINASDINYTAGRYDPSVKPPFDAGFEGLGEVVGLGLSASSAFTVGDTVAYFGS--GAFAEYTLVPAKESVPVPSVRPEFLTLLVSGA---TAYIALKRLGDLAKGETVLVTAAAGGTGQFAVQFAKQAGCHVIGTCSSDEKAGFLKSIGCDRPINYVTEDLAKTLKREYPKGIDVVYESVGGSVLELAVNCLANKGRLIIIG 295          
BLAST of Quinone oxidoreductase vs. Planmine SMEST
Match: SMESG000006168.1 (SMESG000006168.1)

HSP 1 Score: 631.328 bits (1627), Expect = 0.000e+0
Identity = 320/322 (99.38%), Postives = 322/322 (100.00%), Query Frame = 3
Query:   24 MKAIRISEFGEPCVLKLIENLMIPKPSENEVLIEVKYAGVNPVDTYRRAGKYSVLPTLPWVPGSDCSGIISALGSNIRDKFSIGQRVFTTSTITGSYXXXXXXXXXXXXXXPSKLSFQQGASLGTPYFTAYSALFDRGQAKSGETVLIHGASGAVGIAAIQLAKANNLTVIGTAGTTEGLDMIKSIGADYVFNHNADGYVNEIKGQFANKINIVIEMLANQNLVVDCEMAAIKARIMIVGCRGTINFDPRLTMGKLLDVRGVALGMNSLDQWENAGLQMSNWMESGDICPIISKEYDLQDAGKAHHDIIFNSGTTGKLVLRI 989
            MKAIRISEFGEPCVLKLIENLMIPKPSENEVLIEVKYAGVNPVDTYRRAGKYSVLPTLPWVPGSDCSGIISALGSNIRDKFSIGQRVFTTSTITGSYASHALASVHHVHALPSKLSFQQGASLGTPYFTAYSALFDRGQAKSGETVLIHGASGAVGIAAIQLAKANNLTVIGTAGTTEGLDMIKSIGADYVFNHNADGYVNEIKGQF+NKINIVIEMLANQNLV+DCEMAAIKARIMIVGCRGTINFDPRLTMGKLLDVRGVALGMNSLDQWENAGLQMSNWMESGDICPIISKEYDLQDAGKAHHDIIFNSGTTGKLVLRI
Sbjct:    1 MKAIRISEFGEPCVLKLIENLMIPKPSENEVLIEVKYAGVNPVDTYRRAGKYSVLPTLPWVPGSDCSGIISALGSNIRDKFSIGQRVFTTSTITGSYASHALASVHHVHALPSKLSFQQGASLGTPYFTAYSALFDRGQAKSGETVLIHGASGAVGIAAIQLAKANNLTVIGTAGTTEGLDMIKSIGADYVFNHNADGYVNEIKGQFSNKINIVIEMLANQNLVIDCEMAAIKARIMIVGCRGTINFDPRLTMGKLLDVRGVALGMNSLDQWENAGLQMSNWMESGDICPIISKEYDLQDAGKAHHDIIFNSGTTGKLVLRI 322          
BLAST of Quinone oxidoreductase vs. Planmine SMEST
Match: SMESG000021039.1 (SMESG000021039.1)

HSP 1 Score: 76.2554 bits (186), Expect = 4.097e-15
Identity = 88/352 (25.00%), Postives = 154/352 (43.75%), Query Frame = 3
Query:   21 KMKAIRISEFGEPCVLKLIENLMIPK-PSENEVLIEVKYAGVNPVD----------TYRRAGKYSVLPTLPWVPGSDCSGIISALGSNIRDKFSIGQRVFTT--STITGSYXXXXXXXXXXXXXXPSKLSFQQGASLGTPYFTAYSALFDRGQAKSG----ETVLIHGASGAVGIAAIQLAKANNLTVIGTAGTTEGLDMIKSIGADYVFNHNADGYVNEIKGQFANKINIVIEMLA------NQNLVVDCEMAAIKARIMIVGCRGTINFDPRLTMGKLLDVRGVALGMNSLDQW------ENAGLQMSNWMESGDICPIISKEYDLQDAGKAHHDIIFNSGTTGKLVLRI 989
            KM+A +I  +G+   L+L  +  +P   + N VLI+V  A VNP+D           ++  GK+  +   P   G D  G +   G +++  F  G  V         GS++ + +     +   P  L+    A+L     TAY+AL D    K+G    + VLI G SG VG  A+QLAKA +   +G     +  D++  +GAD + + N    +NE      + I    E  A      + +  V    + +K       C G       +T GK+  ++       +L QW       N    +SN ++ G I P++  +++ ++A +A    + + G  GK+++++
Sbjct:   22 KMRAWQIYNYGDIKDLRLTNSYRVPAITNTNHVLIKVDAASVNPIDLSIITGYGASIFKILGKFYNVNEFPKTLGRDFCGTVMKTGRSVK-YFKSGMEVIGALWPFQEGSHSDYVVCHQDQLAMKPQSLTCSDAAALPYAGLTAYTALVDFANLKAGTALGKRVLILGGSGGVGTIALQLAKAWD-AYVGVTCREDSEDLLMELGADAIHSDNLSS-INETYDVILDTIGDDFERNAPFLKPGSSSRYVTIRQSVLKHSDQYSPCLGVPIAAMEIT-GKI--IKNFIKSQGALYQWGFFRASGNNLSVISNLVDRGLIVPVVHAQFNFENAPEAFK-CLQSGGIKGKVIIQM 366          
BLAST of Quinone oxidoreductase vs. Planmine SMEST
Match: SMESG000021039.1 (SMESG000021039.1)

HSP 1 Score: 74.3294 bits (181), Expect = 1.312e-14
Identity = 87/351 (24.79%), Postives = 153/351 (43.59%), Query Frame = 3
Query:   24 MKAIRISEFGEPCVLKLIENLMIPK-PSENEVLIEVKYAGVNPVD----------TYRRAGKYSVLPTLPWVPGSDCSGIISALGSNIRDKFSIGQRVFTT--STITGSYXXXXXXXXXXXXXXPSKLSFQQGASLGTPYFTAYSALFDRGQAKSG----ETVLIHGASGAVGIAAIQLAKANNLTVIGTAGTTEGLDMIKSIGADYVFNHNADGYVNEIKGQFANKINIVIEMLA------NQNLVVDCEMAAIKARIMIVGCRGTINFDPRLTMGKLLDVRGVALGMNSLDQW------ENAGLQMSNWMESGDICPIISKEYDLQDAGKAHHDIIFNSGTTGKLVLRI 989
            M+A +I  +G+   L+L  +  +P   + N VLI+V  A VNP+D           ++  GK+  +   P   G D  G +   G +++  F  G  V         GS++ + +     +   P  L+    A+L     TAY+AL D    K+G    + VLI G SG VG  A+QLAKA +   +G     +  D++  +GAD + + N    +NE      + I    E  A      + +  V    + +K       C G       +T GK+  ++       +L QW       N    +SN ++ G I P++  +++ ++A +A    + + G  GK+++++
Sbjct:    1 MRAWQIYNYGDIKDLRLTNSYRVPAITNTNHVLIKVDAASVNPIDLSIITGYGASIFKILGKFYNVNEFPKTLGRDFCGTVMKTGRSVK-YFKSGMEVIGALWPFQEGSHSDYVVCHQDQLAMKPQSLTCSDAAALPYAGLTAYTALVDFANLKAGTALGKRVLILGGSGGVGTIALQLAKAWD-AYVGVTCREDSEDLLMELGADAIHSDNLSS-INETYDVILDTIGDDFERNAPFLKPGSSSRYVTIRQSVLKHSDQYSPCLGVPIAAMEIT-GKI--IKNFIKSQGALYQWGFFRASGNNLSVISNLVDRGLIVPVVHAQFNFENAPEAFK-CLQSGGIKGKVIIQM 344          
The following BLAST results are available for this feature:
BLAST of Quinone oxidoreductase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CRYZ1.167e-9347.35crystallin zeta [Source:HGNC Symbol;Acc:HGNC:2419][more]
CRYZ1.167e-9347.35crystallin zeta [Source:HGNC Symbol;Acc:HGNC:2419][more]
CRYZ1.321e-8043.44crystallin zeta [Source:HGNC Symbol;Acc:HGNC:2419][more]
CRYZ4.115e-7151.05crystallin zeta [Source:HGNC Symbol;Acc:HGNC:2419][more]
CRYZ8.698e-6353.00crystallin zeta [Source:HGNC Symbol;Acc:HGNC:2419][more]
back to top
BLAST of Quinone oxidoreductase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
F39B2.32.749e-7338.30pep chromosome:WBcel235:I:14788125:14789517:-1 gen... [more]
rad-81.010e-1425.07Reticulon-4-interacting protein 1, mitochondrial ... [more]
rad-81.010e-1425.07Reticulon-4-interacting protein 1, mitochondrial ... [more]
mecr-15.304e-1227.66Enoyl-[acyl-carrier-protein] reductase, mitochondr... [more]
Y48A6B.95.731e-1125.76Enoyl-[acyl-carrier-protein] reductase, mitochondr... [more]
back to top
BLAST of Quinone oxidoreductase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CG169352.380e-1730.30gene:FBgn0033883 transcript:FBtr0087622[more]
CG169352.380e-1730.30gene:FBgn0033883 transcript:FBtr0339954[more]
FASN22.659e-1330.45gene:FBgn0042627 transcript:FBtr0335386[more]
FASN22.707e-1330.45gene:FBgn0042627 transcript:FBtr0077657[more]
FASN11.825e-1025.88gene:FBgn0283427 transcript:FBtr0077659[more]
back to top
BLAST of Quinone oxidoreductase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cryz3.502e-9246.75crystallin, zeta (quinone reductase) [Source:ZFIN;... [more]
cryz3.502e-9246.75crystallin, zeta (quinone reductase) [Source:ZFIN;... [more]
cryz3.502e-9246.75crystallin, zeta (quinone reductase) [Source:ZFIN;... [more]
cryz2.108e-6652.94crystallin, zeta (quinone reductase) [Source:ZFIN;... [more]
vat11.313e-2734.18vesicle amine transport 1 [Source:NCBI gene;Acc:36... [more]
back to top
BLAST of Quinone oxidoreductase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cbln42.097e-9446.75cerebellin 4 precursor [Source:Xenbase;Acc:XB-GENE... [more]
fcn22.526e-2732.57ficolin 2 [Source:Xenbase;Acc:XB-GENE-5789613][more]
prrx26.420e-2634.53paired related homeobox 2 [Source:Xenbase;Acc:XB-G... [more]
tp53i31.670e-2127.43tumor protein p53 inducible protein 3 [Source:NCBI... [more]
tp53i32.753e-2127.14tumor protein p53 inducible protein 3 [Source:NCBI... [more]
back to top
BLAST of Quinone oxidoreductase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Cryz1.408e-9445.51crystallin, zeta [Source:MGI Symbol;Acc:MGI:88527][more]
Cryz1.408e-9445.51crystallin, zeta [Source:MGI Symbol;Acc:MGI:88527][more]
Cryz8.829e-8344.75crystallin, zeta [Source:MGI Symbol;Acc:MGI:88527][more]
Cryz3.746e-6348.17crystallin, zeta [Source:MGI Symbol;Acc:MGI:88527][more]
Cryz3.380e-5051.81crystallin, zeta [Source:MGI Symbol;Acc:MGI:88527][more]
back to top
BLAST of Quinone oxidoreductase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P11415|QOR_CAVPO6.113e-9647.35Quinone oxidoreductase OS=Cavia porcellus OX=10141... [more]
sp|P47199|QOR_MOUSE9.849e-9445.51Quinone oxidoreductase OS=Mus musculus OX=10090 GN... [more]
sp|Q6AYT0|QOR_RAT1.539e-9345.17Quinone oxidoreductase OS=Rattus norvegicus OX=101... [more]
sp|Q08257|QOR_HUMAN5.602e-9347.35Quinone oxidoreductase OS=Homo sapiens OX=9606 GN=... [more]
sp|O97764|QOR_BOVIN3.583e-9247.04Zeta-crystallin OS=Bos taurus OX=9913 GN=CRYZ PE=2... [more]
back to top
BLAST of Quinone oxidoreductase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A210PLN11.842e-10350.46Quinone oxidoreductase OS=Mizuhopecten yessoensis ... [more]
A0A2C9K2M04.855e-10048.45PKS_ER domain-containing protein OS=Biomphalaria g... [more]
A0A2C9K2J71.440e-9948.45PKS_ER domain-containing protein OS=Biomphalaria g... [more]
A0A093PSC01.390e-9648.91Quinone oxidoreductase (Fragment) OS=Manacus vitel... [more]
A0A0A0AD403.246e-9647.04Quinone oxidoreductase (Fragment) OS=Charadrius vo... [more]
back to top
BLAST of Quinone oxidoreductase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cryz1.640e-9047.35crystallin, zeta (quinone reductase) [Source:ZFIN;... [more]
cryz1.998e-9047.35crystallin, zeta (quinone reductase) [Source:ZFIN;... [more]
vat1l2.246e-2733.78vesicle amine transport 1 like [Source:NCBI gene;A... [more]
TP53I37.700e-2627.91tumor protein p53 inducible protein 3 [Source:NCBI... [more]
TP53I31.527e-2527.66tumor protein p53 inducible protein 3 [Source:NCBI... [more]
back to top
BLAST of Quinone oxidoreductase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
vat11.394e-1827.87vesicle amine transport 1 [Source:NCBI gene;Acc:36... [more]
mecr5.559e-1627.93mitochondrial trans-2-enoyl-CoA reductase [Source:... [more]
ZADH21.082e-1323.32zinc binding alcohol dehydrogenase domain containi... [more]
fasn2.086e-1125.89fatty acid synthase [Source:ZFIN;Acc:ZDB-GENE-0301... [more]
fasn4.175e-1127.46fatty acid synthase [Source:ZFIN;Acc:ZDB-GENE-0301... [more]
back to top
BLAST of Quinone oxidoreductase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
ZTA13.341e-1927.71NADPH-dependent quinone reductase; GFP-tagged prot... [more]
ADH11.041e-1126.77Alcohol dehydrogenase; fermentative isozyme active... [more]
ADH21.960e-1025.25Glucose-repressible alcohol dehydrogenase II; cata... [more]
ADH52.313e-1025.45Alcohol dehydrogenase isoenzyme V; involved in eth... [more]
ADH34.094e-1026.26Mitochondrial alcohol dehydrogenase isozyme III; i... [more]
back to top
BLAST of Quinone oxidoreductase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO333084.690e-6343.30Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO348642.979e-2226.58Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO473025.778e-2227.72Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO487231.923e-2129.83Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO307064.084e-1725.32Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Quinone oxidoreductase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cryz8.115e-9445.51crystallin zeta [Source:NCBI gene;Acc:101174625][more]
vat13.389e-2632.11synaptic vesicle membrane protein VAT-1 homolog [S... [more]
VAT13.005e-2531.05vesicle amine transport 1 [Source:NCBI gene;Acc:10... [more]
vat1l1.068e-2129.78vesicle amine transport 1 like [Source:NCBI gene;A... [more]
ZADH23.282e-1729.22zinc binding alcohol dehydrogenase domain containi... [more]
back to top
BLAST of Quinone oxidoreductase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 3
Match NameE-valueIdentityDescription
SMESG000006168.10.000e+099.38SMESG000006168.1[more]
SMESG000021039.14.097e-1525.00SMESG000021039.1[more]
SMESG000021039.11.312e-1424.79SMESG000021039.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30000093 ID=SMED30000093|Name=Quinone oxidoreductase|organism=Schmidtea mediterranea sexual|type=transcript|length=1080bp
CTATATAAATCTTATATGAAAAAATGAAAGCAATTAGAATAAGTGAATTT
GGAGAGCCGTGTGTTTTAAAATTAATTGAAAATCTTATGATACCAAAGCC
TTCAGAAAATGAAGTTTTGATTGAAGTTAAATATGCCGGTGTTAATCCTG
TAGACACTTATCGTCGAGCTGGCAAATATAGTGTATTGCCTACACTTCCA
TGGGTTCCTGGATCAGATTGCAGTGGAATTATATCAGCACTCGGATCCAA
TATCCGCGATAAATTTTCAATAGGACAACGAGTTTTTACAACTTCAACTA
TTACAGGATCATACGCTAGTCATGCATTAGCTTCAGTTCACCATGTTCAC
GCATTGCCTTCAAAATTATCATTCCAACAAGGTGCATCCCTTGGCACTCC
GTATTTCACGGCCTACAGTGCGCTATTTGACAGAGGACAAGCCAAGTCAG
GAGAAACAGTTTTAATCCATGGTGCCAGTGGAGCTGTTGGAATCGCTGCT
ATTCAGTTGGCCAAGGCCAATAACTTGACTGTTATCGGAACAGCGGGCAC
AACCGAAGGATTGGATATGATCAAAAGTATCGGTGCCGATTACGTATTTA
ATCACAACGCTGATGGTTATGTCAATGAAATAAAAGGACAATTCGCTAAT
AAAATTAATATCGTTATAGAAATGTTGGCAAATCAAAATCTCGTTGTTGA
TTGTGAAATGGCTGCGATTAAAGCAAGGATTATGATTGTTGGCTGTCGTG
GAACAATAAATTTTGACCCGCGATTAACAATGGGCAAATTATTGGACGTG
CGTGGTGTCGCATTGGGAATGAATTCATTGGACCAATGGGAAAATGCGGG
TTTGCAAATGAGTAATTGGATGGAAAGCGGCGATATTTGTCCAATAATAT
CCAAGGAATATGATTTACAGGATGCCGGGAAAGCTCATCATGATATCATA
TTCAATAGTGGAACAACAGGAAAACTTGTTTTAAGAATTTAATTATTTTA
TATTTGAAATGGTTTTATAGAACTTTTGTATGATTTTATTAGTTTTAATT
GATTTGTAATAAATTTATTTTCAATAAAAA
back to top

protein sequence of SMED30000093-orf-1

>SMED30000093-orf-1 ID=SMED30000093-orf-1|Name=SMED30000093-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=323bp
MKAIRISEFGEPCVLKLIENLMIPKPSENEVLIEVKYAGVNPVDTYRRAG
KYSVLPTLPWVPGSDCSGIISALGSNIRDKFSIGQRVFTTSTITGSYASH
ALASVHHVHALPSKLSFQQGASLGTPYFTAYSALFDRGQAKSGETVLIHG
ASGAVGIAAIQLAKANNLTVIGTAGTTEGLDMIKSIGADYVFNHNADGYV
NEIKGQFANKINIVIEMLANQNLVVDCEMAAIKARIMIVGCRGTINFDPR
LTMGKLLDVRGVALGMNSLDQWENAGLQMSNWMESGDICPIISKEYDLQD
AGKAHHDIIFNSGTTGKLVLRI*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0016491oxidoreductase activity
GO:0003723RNA binding
GO:0003730mRNA 3'-UTR binding
GO:0003960NADPH:quinone reductase activity
GO:0005212structural constituent of eye lens
GO:0008270zinc ion binding
GO:0070402NADPH binding
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000101muscle cell
PLANA:0003001lateral region of the whole animal
Vocabulary: INTERPRO
TermDefinition
IPR036291NAD(P)-bd_dom_sf
IPR020843PKS_ER
IPR013154ADH_N
IPR016040NAD(P)-bd_dom
IPR013149ADH_C
IPR011032GroES-like_sf
Vocabulary: biological process
TermDefinition
GO:0055114oxidation-reduction process
GO:0042178xenobiotic catabolic process
GO:0051289protein homotetramerization
Vocabulary: cellular component
TermDefinition
GO:0005737cytoplasm
GO:0005829cytosol
GO:0070062extracellular exosome
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR020843Polyketide synthase, enoylreductase domainSMARTSM00829PKS_ER_names_modcoord: 18..322
e-value: 2.5E-25
score: 100.1
IPR013149Alcohol dehydrogenase, C-terminalPFAMPF00107ADH_zinc_Ncoord: 156..275
e-value: 1.5E-16
score: 60.5
NoneNo IPR availableGENE3DG3DSA:3.90.180.10coord: 10..320
e-value: 9.9E-91
score: 306.1
NoneNo IPR availableGENE3DG3DSA:3.40.50.720coord: 125..291
e-value: 9.9E-91
score: 306.1
NoneNo IPR availablePANTHERPTHR44154FAMILY NOT NAMEDcoord: 2..323
NoneNo IPR availableCDDcd08253zeta_crystallincoord: 3..324
e-value: 1.12812E-131
score: 375.769
IPR013154Alcohol dehydrogenase, N-terminalPFAMPF08240ADH_Ncoord: 31..97
e-value: 3.8E-8
score: 33.2
IPR011032GroES-like superfamilySUPERFAMILYSSF50129GroES-likecoord: 2..154
IPR036291NAD(P)-binding domain superfamilySUPERFAMILYSSF51735NAD(P)-binding Rossmann-fold domainscoord: 117..288