retinoblastoma binding protein-1

Overview
Nameretinoblastoma binding protein-1 (AFJ24856.1)
Smed IDSMED30000072
Length (bp)1273
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of retinoblastoma binding protein-1 (SMED30000072) t-SNE clustered cells

Violin plots show distribution of expression levels for retinoblastoma binding protein-1 (SMED30000072) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of retinoblastoma binding protein-1 (SMED30000072) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for retinoblastoma binding protein-1 (SMED30000072) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30000072

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 14

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30000072SMESG000007931.1 SmedASXL_015885SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30000072SMESG000007931.1 SmedASXL_015885SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
Smed sexual biotypeSMED30000072SMESG000060842.1 SMESG000051246.1 SMESG000029096.1 SMESG000029095.1 SMESG000026371.1 SMESG000024644.1 SMESG000013977.1 SMESG000013963.1 SMESG000013956.1 SMESG000007931.1 Contig41773uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30000072SMESG000060842.1 SMESG000051246.1 SMESG000029096.1 SMESG000029095.1 SMESG000026371.1 SMESG000024644.1 SMESG000013977.1 SMESG000013963.1 SMESG000013956.1 SMESG000007931.1 Contig41773newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
neoblastSMED30000072SMESG000007931.1 dd_Smed_v4_7612_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30000072SMESG000080120.1 SMESG000074401.1 SMESG000066720.1 SMESG000045906.1 SMESG000044801.1 SMESG000021895.1 SMESG000021586.1 SMESG000018378.1 SMESG000015751.1 SMESG000007931.1 Contig34563uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30000072SMESG000080120.1 SMESG000074401.1 SMESG000066720.1 SMESG000045906.1 SMESG000044801.1 SMESG000021895.1 SMESG000021586.1 SMESG000018378.1 SMESG000015751.1 SMESG000007931.1 Contig34563newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
parapharyngeal regionSMED30000072SMESG000007931.1 dd_Smed_v6_7612_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
neuronSMED30000072SMESG000060842.1 SMESG000029096.1 SMESG000024644.1 SMESG000021373.1 SMESG000013977.1 SMESG000007931.1 Contig44727newmark_estsPMID:27612384
Roberts-Galbraith et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
neuronSMED30000072SMESG000060842.1 SMESG000029096.1 SMESG000024644.1 SMESG000021373.1 SMESG000013977.1 SMESG000007931.1 Contig44727uc_Smed_v2PMID:27612384
Roberts-Galbraith et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
zeta neoblastSMED30000072SMESG000007931.1 dd_Smed_v4_7612_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
neoblastSMED30000072SMESG000007931.1 SMED_05209_V2_1GPL14150_gene_modelsPMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
neoblastSMED30000072SMESG000007931.1 SMED_05209_V2_1GPL14150PMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
neoblastSMED30000072SMESG000034069.1 SMED_08100_V2_1GPL14150PMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
Note: Hover over icons to view figure legend
Homology
BLAST of retinoblastoma binding protein-1 vs. Ensembl Human
Match: RBBP4 (RB binding protein 4, chromatin remodeling factor [Source:HGNC Symbol;Acc:HGNC:9887])

HSP 1 Score: 437.187 bits (1123), Expect = 2.238e-151
Identity = 209/391 (53.45%), Postives = 281/391 (71.87%), Query Frame = 3
Query:  102 KDYIRWKKNTPFLYDLVMTHNLTWPSLTVQWMPDITRLEDKDYSTQRIIVGTQAEEEQDYLLIASVTVPNEYKCFESKHYDAEKDEFGGYGLVTAHTDISIKINHDGCINRARYLPQCPNVIATKSSNGNVYLFDYTRHPSKPDQSGKCKPDLVLKGHSQEGFGLSWNIKNAGVLLSSAVDGTIQLWDINCTPENKNDFKVLNSLSQYLGHEGSVEDVCWHKFSDQLFGSVGVDKNLLIWDRRE---SKPAVKVMAHSDDVVTLDFNPFSEYILATGSEDKTIGLWDLRNMGGSLKYLRGHEGSIGQLQWSLHKETILASGGSDNKVHLWDLKKTGTSKENTYSE----ELAFIHAGHCSRVIDFAWNGNEPLMMASVSYDNILQLWQPSE 1253
            ++Y  WKKNTPFLYDLVMTH L WPSLT QW+PD+TR E KD+S  R+++GT   +EQ++L+IASV +PN+   F++ HYD+EK EFGG+G V+   +I IKINH+G +NRARY+PQ P +IATK+ + +V +FDYT+HPSKPD SG+C PDL L+GH +EG+GLSWN   +G LLS++ D TI LWDI+  P+   + KV+++ + + GH   VEDV WH   + LFGSV  D+ L+IWD R    SKP+  V AH+ +V  L FNP+SE+ILATGS DKT+ LWDLRN+   L     H+  I Q+QWS H ETILAS G+D ++++WDL K G  +    +E    EL FIH GH +++ DF+WN NEP ++ SVS DNI+Q+WQ +E
Sbjct:   19 EEYKIWKKNTPFLYDLVMTHALEWPSLTAQWLPDVTRPEGKDFSIHRLVLGTHTSDEQNHLVIASVQLPNDDAQFDASHYDSEKGEFGGFGSVSGKIEIEIKINHEGEVNRARYMPQNPCIIATKTPSSDVLVFDYTKHPSKPDPSGECNPDLRLRGHQKEGYGLSWNPNLSGHLLSASDDHTICLWDISAVPK---EGKVVDAKTIFTGHTAVVEDVSWHLLHESLFGSVADDQKLMIWDTRSNNTSKPSHSVDAHTAEVNCLSFNPYSEFILATGSADKTVALWDLRNLKLKLHSFESHKDEIFQVQWSPHNETILASSGTDRRLNVWDLSKIGEEQSPEDAEDGPPELLFIHGGHTAKISDFSWNPNEPWVICSVSEDNIMQVWQMAE 406          
BLAST of retinoblastoma binding protein-1 vs. Ensembl Human
Match: RBBP4 (RB binding protein 4, chromatin remodeling factor [Source:HGNC Symbol;Acc:HGNC:9887])

HSP 1 Score: 436.802 bits (1122), Expect = 3.382e-151
Identity = 209/391 (53.45%), Postives = 281/391 (71.87%), Query Frame = 3
Query:  102 KDYIRWKKNTPFLYDLVMTHNLTWPSLTVQWMPDITRLEDKDYSTQRIIVGTQAEEEQDYLLIASVTVPNEYKCFESKHYDAEKDEFGGYGLVTAHTDISIKINHDGCINRARYLPQCPNVIATKSSNGNVYLFDYTRHPSKPDQSGKCKPDLVLKGHSQEGFGLSWNIKNAGVLLSSAVDGTIQLWDINCTPENKNDFKVLNSLSQYLGHEGSVEDVCWHKFSDQLFGSVGVDKNLLIWDRRE---SKPAVKVMAHSDDVVTLDFNPFSEYILATGSEDKTIGLWDLRNMGGSLKYLRGHEGSIGQLQWSLHKETILASGGSDNKVHLWDLKKTGTSKENTYSE----ELAFIHAGHCSRVIDFAWNGNEPLMMASVSYDNILQLWQPSE 1253
            ++Y  WKKNTPFLYDLVMTH L WPSLT QW+PD+TR E KD+S  R+++GT   +EQ++L+IASV +PN+   F++ HYD+EK EFGG+G V+   +I IKINH+G +NRARY+PQ P +IATK+ + +V +FDYT+HPSKPD SG+C PDL L+GH +EG+GLSWN   +G LLS++ D TI LWDI+  P+   + KV+++ + + GH   VEDV WH   + LFGSV  D+ L+IWD R    SKP+  V AH+ +V  L FNP+SE+ILATGS DKT+ LWDLRN+   L     H+  I Q+QWS H ETILAS G+D ++++WDL K G  +    +E    EL FIH GH +++ DF+WN NEP ++ SVS DNI+Q+WQ +E
Sbjct:   18 EEYKIWKKNTPFLYDLVMTHALEWPSLTAQWLPDVTRPEGKDFSIHRLVLGTHTSDEQNHLVIASVQLPNDDAQFDASHYDSEKGEFGGFGSVSGKIEIEIKINHEGEVNRARYMPQNPCIIATKTPSSDVLVFDYTKHPSKPDPSGECNPDLRLRGHQKEGYGLSWNPNLSGHLLSASDDHTICLWDISAVPK---EGKVVDAKTIFTGHTAVVEDVSWHLLHESLFGSVADDQKLMIWDTRSNNTSKPSHSVDAHTAEVNCLSFNPYSEFILATGSADKTVALWDLRNLKLKLHSFESHKDEIFQVQWSPHNETILASSGTDRRLNVWDLSKIGEEQSPEDAEDGPPELLFIHGGHTAKISDFSWNPNEPWVICSVSEDNIMQVWQMAE 405          
BLAST of retinoblastoma binding protein-1 vs. Ensembl Human
Match: RBBP4 (RB binding protein 4, chromatin remodeling factor [Source:HGNC Symbol;Acc:HGNC:9887])

HSP 1 Score: 435.647 bits (1119), Expect = 4.961e-151
Identity = 208/388 (53.61%), Postives = 279/388 (71.91%), Query Frame = 3
Query:  102 KDYIRWKKNTPFLYDLVMTHNLTWPSLTVQWMPDITRLEDKDYSTQRIIVGTQAEEEQDYLLIASVTVPNEYKCFESKHYDAEKDEFGGYGLVTAHTDISIKINHDGCINRARYLPQCPNVIATKSSNGNVYLFDYTRHPSKPDQSGKCKPDLVLKGHSQEGFGLSWNIKNAGVLLSSAVDGTIQLWDINCTPENKNDFKVLNSLSQYLGHEGSVEDVCWHKFSDQLFGSVGVDKNLLIWDRRE---SKPAVKVMAHSDDVVTLDFNPFSEYILATGSEDKTIGLWDLRNMGGSLKYLRGHEGSIGQLQWSLHKETILASGGSDNKVHLWDLKKTGTSKENTYSE----ELAFIHAGHCSRVIDFAWNGNEPLMMASVSYDNILQLWQ 1244
            ++Y  WKKNTPFLYDLVMTH L WPSLT QW+PD+TR E KD+S  R+++GT   +EQ++L+IASV +PN+   F++ HYD+EK EFGG+G V+   +I IKINH+G +NRARY+PQ P +IATK+ + +V +FDYT+HPSKPD SG+C PDL L+GH +EG+GLSWN   +G LLS++ D TI LWDI+  P+   + KV+++ + + GH   VEDV WH   + LFGSV  D+ L+IWD R    SKP+  V AH+ +V  L FNP+SE+ILATGS DKT+ LWDLRN+   L     H+  I Q+QWS H ETILAS G+D ++++WDL K G  +    +E    EL FIH GH +++ DF+WN NEP ++ SVS DNI+Q+WQ
Sbjct:   19 EEYKIWKKNTPFLYDLVMTHALEWPSLTAQWLPDVTRPEGKDFSIHRLVLGTHTSDEQNHLVIASVQLPNDDAQFDASHYDSEKGEFGGFGSVSGKIEIEIKINHEGEVNRARYMPQNPCIIATKTPSSDVLVFDYTKHPSKPDPSGECNPDLRLRGHQKEGYGLSWNPNLSGHLLSASDDHTICLWDISAVPK---EGKVVDAKTIFTGHTAVVEDVSWHLLHESLFGSVADDQKLMIWDTRSNNTSKPSHSVDAHTAEVNCLSFNPYSEFILATGSADKTVALWDLRNLKLKLHSFESHKDEIFQVQWSPHNETILASSGTDRRLNVWDLSKIGEEQSPEDAEDGPPELLFIHGGHTAKISDFSWNPNEPWVICSVSEDNIMQVWQ 403          
BLAST of retinoblastoma binding protein-1 vs. Ensembl Human
Match: RBBP7 (RB binding protein 7, chromatin remodeling factor [Source:HGNC Symbol;Acc:HGNC:9890])

HSP 1 Score: 422.935 bits (1086), Expect = 8.817e-146
Identity = 200/391 (51.15%), Postives = 278/391 (71.10%), Query Frame = 3
Query:  102 KDYIRWKKNTPFLYDLVMTHNLTWPSLTVQWMPDITRLEDKDYSTQRIIVGTQAEEEQDYLLIASVTVPNEYKCFESKHYDAEKDEFGGYGLVTAHTDISIKINHDGCINRARYLPQCPNVIATKSSNGNVYLFDYTRHPSKPDQSGKCKPDLVLKGHSQEGFGLSWNIKNAGVLLSSAVDGTIQLWDINCTPENKNDFKVLNSLSQYLGHEGSVEDVCWHKFSDQLFGSVGVDKNLLIWDRRE---SKPAVKVMAHSDDVVTLDFNPFSEYILATGSEDKTIGLWDLRNMGGSLKYLRGHEGSIGQLQWSLHKETILASGGSDNKVHLWDLKKTGTSKENTYSE----ELAFIHAGHCSRVIDFAWNGNEPLMMASVSYDNILQLWQPSE 1253
            ++Y  WKKNTPFLYDLVMTH L WPSLTVQW+P++T+ E KDY+   +++GT   +EQ++L++A V +PN+   F++ H D++K EFGG+G VT   +  IKINH+G +NRARY+PQ P++IATK+ + +V +FDYT+HP+KPD SG+C PDL L+GH +EG+GLSWN   +G LLS++ D T+ LWDIN  P+   + K++++ + + GH   VEDV WH   + LFGSV  D+ L+IWD R    SKP+  V AH+ +V  L FNP+SE+ILATGS DKT+ LWDLRN+   L     H+  I Q+ WS H ETILAS G+D ++++WDL K G  +    +E    EL FIH GH +++ DF+WN NEP ++ SVS DNI+Q+WQ +E
Sbjct:   18 EEYKIWKKNTPFLYDLVMTHALQWPSLTVQWLPEVTKPEGKDYALHWLVLGTHTSDEQNHLVVARVHIPNDDAQFDASHCDSDKGEFGGFGSVTGKIECEIKINHEGEVNRARYMPQNPHIIATKTPSSDVLVFDYTKHPAKPDPSGECNPDLRLRGHQKEGYGLSWNSNLSGHLLSASDDHTVCLWDINAGPK---EGKIVDAKAIFTGHSAVVEDVAWHLLHESLFGSVADDQKLMIWDTRSNTTSKPSHLVDAHTAEVNCLSFNPYSEFILATGSADKTVALWDLRNLKLKLHTFESHKDEIFQVHWSPHNETILASSGTDRRLNVWDLSKIGEEQSAEDAEDGPPELLFIHGGHTAKISDFSWNPNEPWVICSVSEDNIMQIWQMAE 405          
BLAST of retinoblastoma binding protein-1 vs. Ensembl Human
Match: RBBP7 (RB binding protein 7, chromatin remodeling factor [Source:HGNC Symbol;Acc:HGNC:9890])

HSP 1 Score: 422.165 bits (1084), Expect = 6.470e-145
Identity = 200/391 (51.15%), Postives = 278/391 (71.10%), Query Frame = 3
Query:  102 KDYIRWKKNTPFLYDLVMTHNLTWPSLTVQWMPDITRLEDKDYSTQRIIVGTQAEEEQDYLLIASVTVPNEYKCFESKHYDAEKDEFGGYGLVTAHTDISIKINHDGCINRARYLPQCPNVIATKSSNGNVYLFDYTRHPSKPDQSGKCKPDLVLKGHSQEGFGLSWNIKNAGVLLSSAVDGTIQLWDINCTPENKNDFKVLNSLSQYLGHEGSVEDVCWHKFSDQLFGSVGVDKNLLIWDRRE---SKPAVKVMAHSDDVVTLDFNPFSEYILATGSEDKTIGLWDLRNMGGSLKYLRGHEGSIGQLQWSLHKETILASGGSDNKVHLWDLKKTGTSKENTYSE----ELAFIHAGHCSRVIDFAWNGNEPLMMASVSYDNILQLWQPSE 1253
            ++Y  WKKNTPFLYDLVMTH L WPSLTVQW+P++T+ E KDY+   +++GT   +EQ++L++A V +PN+   F++ H D++K EFGG+G VT   +  IKINH+G +NRARY+PQ P++IATK+ + +V +FDYT+HP+KPD SG+C PDL L+GH +EG+GLSWN   +G LLS++ D T+ LWDIN  P+   + K++++ + + GH   VEDV WH   + LFGSV  D+ L+IWD R    SKP+  V AH+ +V  L FNP+SE+ILATGS DKT+ LWDLRN+   L     H+  I Q+ WS H ETILAS G+D ++++WDL K G  +    +E    EL FIH GH +++ DF+WN NEP ++ SVS DNI+Q+WQ +E
Sbjct:   62 EEYKIWKKNTPFLYDLVMTHALQWPSLTVQWLPEVTKPEGKDYALHWLVLGTHTSDEQNHLVVARVHIPNDDAQFDASHCDSDKGEFGGFGSVTGKIECEIKINHEGEVNRARYMPQNPHIIATKTPSSDVLVFDYTKHPAKPDPSGECNPDLRLRGHQKEGYGLSWNSNLSGHLLSASDDHTVCLWDINAGPK---EGKIVDAKAIFTGHSAVVEDVAWHLLHESLFGSVADDQKLMIWDTRSNTTSKPSHLVDAHTAEVNCLSFNPYSEFILATGSADKTVALWDLRNLKLKLHTFESHKDEIFQVHWSPHNETILASSGTDRRLNVWDLSKIGEEQSAEDAEDGPPELLFIHGGHTAKISDFSWNPNEPWVICSVSEDNIMQIWQMAE 449          
BLAST of retinoblastoma binding protein-1 vs. Ensembl Celegans
Match: lin-53 (Probable histone-binding protein lin-53 [Source:UniProtKB/Swiss-Prot;Acc:P90916])

HSP 1 Score: 395.201 bits (1014), Expect = 2.056e-135
Identity = 192/384 (50.00%), Postives = 260/384 (67.71%), Query Frame = 3
Query:  105 DYIRWKKNTPFLYDLVMTHNLTWPSLTVQWMPDITRLEDKDYSTQRIIVGTQAEEEQDYLLIASVTVPNEYKCFESKHYDAEKDEFGGYGLVTAHTDISIKINHDGCINRARYLPQCPNVIATKSSNGNVYLFDYTRHPSKPDQSGKCKPDLVLKGHSQEGFGLSWNIKNAGVLLSSAVDGTIQLWDINCTPENKNDFKVLNSLSQYLGHEGSVEDVCWHKFSDQLFGSVGVDKNLLIWDRRESKPAVKVMAHSDDVVTLDFNPFSEYILATGSEDKTIGLWDLRNMGGSLKYLRGHEGSIGQLQWSLHKETILASGGSDNKVHLWDLKKTGTSKENTYSE----ELAFIHAGHCSRVIDFAWNGNEPLMMASVSYDNILQLWQ 1244
            +Y  WKKNTPFLYDLVMTH L WPSL+VQW+PD+ + ++ D++  R+I+GT   +EQ++LLI+ + +P +   F++  YD E+ E+GG+G V    +  I+INH+G +NRARY+PQ  N+IATKS + +VY+FDY +H + P +     P + LKGH++EG+GLSWN    G++LS++ D T+  WDIN    N+N    L +   + GHE  VEDV WH   D +FGSVG DK LLIWD R S P   + AHS +V  L FNP+SE+ILATGS DKT+ LWDLRN+   L     H   I Q+QWS H ETILAS G+D ++H+WDL K G  +    +E    EL FIH GH +++ DF+WN NEP ++ SVS DNILQ+WQ
Sbjct:   17 EYKIWKKNTPFLYDLVMTHALEWPSLSVQWLPDVAK-DNSDHTIHRLILGTHTSDEQNHLLISKICMPTDDAQFDASRYDTERSEYGGFGAVNGKVEPDIRINHEGEVNRARYMPQKSNIIATKSPHADVYIFDYLKHSAVP-RDNTFNPLIRLKGHTKEGYGLSWNPNKEGLILSASDDQTVCHWDINA---NQNVAGELQAKDVFKGHESVVEDVAWHVLHDGVFGSVGDDKKLLIWDVRTSTPGHCIDAHSAEVNCLAFNPYSEFILATGSADKTVALWDLRNLRMKLHSFESHRDEIFQVQWSPHNETILASSGTDKRLHVWDLSKIGEDQSAEDAEDGPPELLFIHGGHTAKISDFSWNPNEPWVVCSVSEDNILQVWQ 395          
BLAST of retinoblastoma binding protein-1 vs. Ensembl Celegans
Match: rba-1 (Probable histone-binding protein rba-1 [Source:UniProtKB/Swiss-Prot;Acc:P90917])

HSP 1 Score: 339.347 bits (869), Expect = 1.247e-113
Identity = 174/394 (44.16%), Postives = 251/394 (63.71%), Query Frame = 3
Query:  102 KDYIRWKKNTPFLYDLVMTHNLTWPSLTVQWMPDITRLEDKDYSTQRIIVGTQA-EEEQDYLLIASVTVPNEYKCFESKHYDAEKDEFGGYGLVTAHT-DISIKINHDGCINRARYLPQCPNVIATKSSNGNVYLFDYTRHPSKPDQSGKCKPDLVLKGHSQEGFGLSWNIKNAGVLLSSAVDGTIQLWDINCTPENKNDFKVLNSLSQYLGHEGSVEDVCWHKFSDQLFGSVGVDKNLLIWDRRESKPAVKVMAHSDDVVTLDFNPFSEYILATGSEDKTIGLWDLRNMGGSLKYLRGHEGSIGQLQWSLHKETILASGGSDNKVHLWDLKK------TGTSKENTYSEELAFIHAGHCSRVIDFAWNGNEPLMMASVSYDNILQLWQPSEFL 1259
            K++  WKKN P+LYD V+T  + WPSL+VQWMPD+T+ E+ D S  R+I GT      Q++L+I+  T+  +   F+   +D+E++EFGGYG  +A   D  IKINH G ++RARY+P  P +IA++  + +VY+FDYT+HPS+P  + K +P L LKGH  EG+G+SW+    G LL++  DG I  WDIN    N+     +   S++ GH  + EDV +H   + +FGSVG D+ L +WD R+SKP +  + H+ +V  + FNPFSEYILATGS DKT+ LWD+RNM   +  L+ H   I Q+ +S H ET+LAS GSD++V +WD+ K      +  +  ++   E+ FIHAGH  +V DF+WN N P  + S    N LQ+W+ S  L
Sbjct:   12 KEHRIWKKNVPYLYDTVVTKEVEWPSLSVQWMPDVTKTENSDSSMHRMIHGTHTCGGVQNHLMISKFTITTDTPEFDDAKWDSEREEFGGYGEGSAAKWDTEIKINHPGEVHRARYMPHNPFIIASRGPSDDVYIFDYTKHPSEPKDT-KFRPQLRLKGHEGEGYGMSWSNTREGHLLTAGDDGMICHWDINA---NQTISGQIVPQSKFKGHSSNAEDVSFHALHNFVFGSVGDDRKLNLWDLRQSKPQLTAVGHTAEVNCITFNPFSEYILATGSVDKTVALWDMRNMRKKMYTLKHHNDEIFQVSFSPHYETVLASSGSDDRVIVWDISKIQDPSSSSAASSDSVPPEVIFIHAGHTGKVADFSWNPNRPWTICSSDEFNALQVWEVSNSL 401          
BLAST of retinoblastoma binding protein-1 vs. Ensembl Celegans
Match: Y54H5A.1 (pep chromosome:WBcel235:III:5153543:5155465:1 gene:WBGene00021899.1 transcript:Y54H5A.1.3 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:Y54H5A.1)

HSP 1 Score: 85.5001 bits (210), Expect = 8.336e-18
Identity = 92/391 (23.53%), Postives = 157/391 (40.15%), Query Frame = 3
Query:  132 PFLYDLVMTHNLTWPSLTVQWMPDITRLEDKDYSTQRIIV-GTQAEEEQDYLLIA-------SVTVPNEYKCFESKHYDAEKDEFGGYGLVTAHTDI-SIKINHDGCINRARY-LPQCPNVIATKSSNGNVYLFDYT---------RHPSKPDQSGKCKPDLVLKGHSQEGFGLSWNIKNAGVLLSSAVDGTIQLWDINCTPENKNDFKVLNSLSQYLGHEGSVEDVCWHKFSDQLFGSVGVDKNLLIWDRRESKPAVKVM----AHSDDVVTLDFNPFSEYILATGSEDKTIGLWDLRNM--GGSLKYLRGHEGSIGQLQWSLHKETILASGGSDNKVHLWDLKKTGTSKENT--YSEELAFIHAGHCSRVIDFAWNGNEPLMMASVSYD 1223
            P  Y L  + N  WP L+   + D        +  +  IV GTQA++ +D  +I        ++    E K  +S   + E ++            + ++ I H G INR R        V A  S  G V +++ T            SK +     +P     G  +EG+GL+W+    G L +  +   I LW +      K   +     +   GH+ SVED+ W      L  S   D ++ +WD R +     V     AH  DV  + +N   E ++ +G +D  + +W L+ +  G  +   + H   I  + W  H+ T   + G D++  +WD+      + N      +L F+H G  + V +  W+   P +  + S D
Sbjct:   61 PSAYKLFHSFNSDWPCLSFDVVKDGLGENRTQFPAECYIVSGTQADKPRDNEIIVMGLKNLTTMRKEKENKGDDSDTSEDESEDEDAEEEKKREPKMHAVSIPHYGGINRIRSDRLGDSTVCACWSDQGRVQVWNITDALNYTHGMSGESKTEVQKIDRPLFTNNGSGKEGYGLAWSSLKTGDLATGDIIKKIYLWQM------KEGGQWAVGANPLTGHKKSVEDLAWSPTETGLLASCSADGSIKLWDTRSAPKDACVCTVQKAHESDVNVISWNRH-ENLIVSGGDDGELKIWSLKTIQFGQPVALFKYHNSPITSVDWHPHETTTFMASGEDDQTTIWDIATEADGQTNIEGVPPQLMFVHMGQ-NEVKEVHWHQQIPGLAINTSID 443          
BLAST of retinoblastoma binding protein-1 vs. Ensembl Celegans
Match: Y54H5A.1 (pep chromosome:WBcel235:III:5153464:5155465:1 gene:WBGene00021899.1 transcript:Y54H5A.1.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:Y54H5A.1)

HSP 1 Score: 85.5001 bits (210), Expect = 8.336e-18
Identity = 92/391 (23.53%), Postives = 157/391 (40.15%), Query Frame = 3
Query:  132 PFLYDLVMTHNLTWPSLTVQWMPDITRLEDKDYSTQRIIV-GTQAEEEQDYLLIA-------SVTVPNEYKCFESKHYDAEKDEFGGYGLVTAHTDI-SIKINHDGCINRARY-LPQCPNVIATKSSNGNVYLFDYT---------RHPSKPDQSGKCKPDLVLKGHSQEGFGLSWNIKNAGVLLSSAVDGTIQLWDINCTPENKNDFKVLNSLSQYLGHEGSVEDVCWHKFSDQLFGSVGVDKNLLIWDRRESKPAVKVM----AHSDDVVTLDFNPFSEYILATGSEDKTIGLWDLRNM--GGSLKYLRGHEGSIGQLQWSLHKETILASGGSDNKVHLWDLKKTGTSKENT--YSEELAFIHAGHCSRVIDFAWNGNEPLMMASVSYD 1223
            P  Y L  + N  WP L+   + D        +  +  IV GTQA++ +D  +I        ++    E K  +S   + E ++            + ++ I H G INR R        V A  S  G V +++ T            SK +     +P     G  +EG+GL+W+    G L +  +   I LW +      K   +     +   GH+ SVED+ W      L  S   D ++ +WD R +     V     AH  DV  + +N   E ++ +G +D  + +W L+ +  G  +   + H   I  + W  H+ T   + G D++  +WD+      + N      +L F+H G  + V +  W+   P +  + S D
Sbjct:   61 PSAYKLFHSFNSDWPCLSFDVVKDGLGENRTQFPAECYIVSGTQADKPRDNEIIVMGLKNLTTMRKEKENKGDDSDTSEDESEDEDAEEEKKREPKMHAVSIPHYGGINRIRSDRLGDSTVCACWSDQGRVQVWNITDALNYTHGMSGESKTEVQKIDRPLFTNNGSGKEGYGLAWSSLKTGDLATGDIIKKIYLWQM------KEGGQWAVGANPLTGHKKSVEDLAWSPTETGLLASCSADGSIKLWDTRSAPKDACVCTVQKAHESDVNVISWNRH-ENLIVSGGDDGELKIWSLKTIQFGQPVALFKYHNSPITSVDWHPHETTTFMASGEDDQTTIWDIATEADGQTNIEGVPPQLMFVHMGQ-NEVKEVHWHQQIPGLAINTSID 443          
BLAST of retinoblastoma binding protein-1 vs. Ensembl Celegans
Match: Y54H5A.1 (pep chromosome:WBcel235:III:5153406:5155436:1 gene:WBGene00021899.1 transcript:Y54H5A.1.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:Y54H5A.1)

HSP 1 Score: 85.5001 bits (210), Expect = 8.336e-18
Identity = 92/391 (23.53%), Postives = 157/391 (40.15%), Query Frame = 3
Query:  132 PFLYDLVMTHNLTWPSLTVQWMPDITRLEDKDYSTQRIIV-GTQAEEEQDYLLIA-------SVTVPNEYKCFESKHYDAEKDEFGGYGLVTAHTDI-SIKINHDGCINRARY-LPQCPNVIATKSSNGNVYLFDYT---------RHPSKPDQSGKCKPDLVLKGHSQEGFGLSWNIKNAGVLLSSAVDGTIQLWDINCTPENKNDFKVLNSLSQYLGHEGSVEDVCWHKFSDQLFGSVGVDKNLLIWDRRESKPAVKVM----AHSDDVVTLDFNPFSEYILATGSEDKTIGLWDLRNM--GGSLKYLRGHEGSIGQLQWSLHKETILASGGSDNKVHLWDLKKTGTSKENT--YSEELAFIHAGHCSRVIDFAWNGNEPLMMASVSYD 1223
            P  Y L  + N  WP L+   + D        +  +  IV GTQA++ +D  +I        ++    E K  +S   + E ++            + ++ I H G INR R        V A  S  G V +++ T            SK +     +P     G  +EG+GL+W+    G L +  +   I LW +      K   +     +   GH+ SVED+ W      L  S   D ++ +WD R +     V     AH  DV  + +N   E ++ +G +D  + +W L+ +  G  +   + H   I  + W  H+ T   + G D++  +WD+      + N      +L F+H G  + V +  W+   P +  + S D
Sbjct:   61 PSAYKLFHSFNSDWPCLSFDVVKDGLGENRTQFPAECYIVSGTQADKPRDNEIIVMGLKNLTTMRKEKENKGDDSDTSEDESEDEDAEEEKKREPKMHAVSIPHYGGINRIRSDRLGDSTVCACWSDQGRVQVWNITDALNYTHGMSGESKTEVQKIDRPLFTNNGSGKEGYGLAWSSLKTGDLATGDIIKKIYLWQM------KEGGQWAVGANPLTGHKKSVEDLAWSPTETGLLASCSADGSIKLWDTRSAPKDACVCTVQKAHESDVNVISWNRH-ENLIVSGGDDGELKIWSLKTIQFGQPVALFKYHNSPITSVDWHPHETTTFMASGEDDQTTIWDIATEADGQTNIEGVPPQLMFVHMGQ-NEVKEVHWHQQIPGLAINTSID 443          
BLAST of retinoblastoma binding protein-1 vs. Ensembl Fly
Match: Caf1-55 (gene:FBgn0263979 transcript:FBtr0301845)

HSP 1 Score: 437.958 bits (1125), Expect = 5.728e-152
Identity = 211/391 (53.96%), Postives = 278/391 (71.10%), Query Frame = 3
Query:  102 KDYIRWKKNTPFLYDLVMTHNLTWPSLTVQWMPDITRLEDKDYSTQRIIVGTQAEEEQDYLLIASVTVPNEYKCFESKHYDAEKDEFGGYGLVTAHTDISIKINHDGCINRARYLPQCPNVIATKSSNGNVYLFDYTRHPSKPDQSGKCKPDLVLKGHSQEGFGLSWNIKNAGVLLSSAVDGTIQLWDINCTPENKNDFKVLNSLSQYLGHEGSVEDVCWHKFSDQLFGSVGVDKNLLIWDRRE---SKPAVKVMAHSDDVVTLDFNPFSEYILATGSEDKTIGLWDLRNMGGSLKYLRGHEGSIGQLQWSLHKETILASGGSDNKVHLWDLKKTGTSKENTYSE----ELAFIHAGHCSRVIDFAWNGNEPLMMASVSYDNILQLWQPSE 1253
            ++Y  WKKNTPFLYDLVMTH L WPSLT QW+PD+T+ + KDYS  R+I+GT   +EQ++LLIASV +P+E   F+  HYD EK EFGG+G V    +I IKINH+G +NRARY+PQ   VIATK+ + +V +FDYT+HPSKP+ SG+C+PDL L+GH +EG+GLSWN    G LLS++ D TI LWDIN TP+   + +V+++ + + GH   VEDV WH   + LFGSV  D+ L+IWD R    SKP+  V AH+ +V  L FNP+SE+ILATGS DKT+ LWDLRN+   L     H+  I Q+QWS H ETILAS G+D ++H+WDL K G  +    +E    EL FIH GH +++ DF+WN NEP ++ SVS DNI+Q+WQ +E
Sbjct:   22 EEYKIWKKNTPFLYDLVMTHALEWPSLTAQWLPDVTKQDGKDYSVHRLILGTHTSDEQNHLLIASVQLPSEDAQFDGSHYDNEKGEFGGFGSVCGKIEIEIKINHEGEVNRARYMPQNACVIATKTPSSDVLVFDYTKHPSKPEPSGECQPDLRLRGHQKEGYGLSWNPNLNGYLLSASDDHTICLWDINATPK---EHRVIDAKNIFTGHTAVVEDVAWHLLHESLFGSVADDQKLMIWDTRNNNTSKPSHTVDAHTAEVNCLSFNPYSEFILATGSADKTVALWDLRNLKLKLHSFESHKDEIFQVQWSPHNETILASSGTDRRLHVWDLSKIGEEQSTEDAEDGPPELLFIHGGHTAKISDFSWNPNEPWIICSVSEDNIMQVWQMAE 409          
BLAST of retinoblastoma binding protein-1 vs. Ensembl Fly
Match: Caf1-55 (gene:FBgn0263979 transcript:FBtr0083052)

HSP 1 Score: 437.958 bits (1125), Expect = 6.057e-152
Identity = 211/391 (53.96%), Postives = 278/391 (71.10%), Query Frame = 3
Query:  102 KDYIRWKKNTPFLYDLVMTHNLTWPSLTVQWMPDITRLEDKDYSTQRIIVGTQAEEEQDYLLIASVTVPNEYKCFESKHYDAEKDEFGGYGLVTAHTDISIKINHDGCINRARYLPQCPNVIATKSSNGNVYLFDYTRHPSKPDQSGKCKPDLVLKGHSQEGFGLSWNIKNAGVLLSSAVDGTIQLWDINCTPENKNDFKVLNSLSQYLGHEGSVEDVCWHKFSDQLFGSVGVDKNLLIWDRRE---SKPAVKVMAHSDDVVTLDFNPFSEYILATGSEDKTIGLWDLRNMGGSLKYLRGHEGSIGQLQWSLHKETILASGGSDNKVHLWDLKKTGTSKENTYSE----ELAFIHAGHCSRVIDFAWNGNEPLMMASVSYDNILQLWQPSE 1253
            ++Y  WKKNTPFLYDLVMTH L WPSLT QW+PD+T+ + KDYS  R+I+GT   +EQ++LLIASV +P+E   F+  HYD EK EFGG+G V    +I IKINH+G +NRARY+PQ   VIATK+ + +V +FDYT+HPSKP+ SG+C+PDL L+GH +EG+GLSWN    G LLS++ D TI LWDIN TP+   + +V+++ + + GH   VEDV WH   + LFGSV  D+ L+IWD R    SKP+  V AH+ +V  L FNP+SE+ILATGS DKT+ LWDLRN+   L     H+  I Q+QWS H ETILAS G+D ++H+WDL K G  +    +E    EL FIH GH +++ DF+WN NEP ++ SVS DNI+Q+WQ +E
Sbjct:   23 EEYKIWKKNTPFLYDLVMTHALEWPSLTAQWLPDVTKQDGKDYSVHRLILGTHTSDEQNHLLIASVQLPSEDAQFDGSHYDNEKGEFGGFGSVCGKIEIEIKINHEGEVNRARYMPQNACVIATKTPSSDVLVFDYTKHPSKPEPSGECQPDLRLRGHQKEGYGLSWNPNLNGYLLSASDDHTICLWDINATPK---EHRVIDAKNIFTGHTAVVEDVAWHLLHESLFGSVADDQKLMIWDTRNNNTSKPSHTVDAHTAEVNCLSFNPYSEFILATGSADKTVALWDLRNLKLKLHSFESHKDEIFQVQWSPHNETILASSGTDRRLHVWDLSKIGEEQSTEDAEDGPPELLFIHGGHTAKISDFSWNPNEPWIICSVSEDNIMQVWQMAE 410          
BLAST of retinoblastoma binding protein-1 vs. Ensembl Fly
Match: l(2)09851 (gene:FBgn0022288 transcript:FBtr0335269)

HSP 1 Score: 113.235 bits (282), Expect = 3.780e-27
Identity = 84/297 (28.28%), Postives = 130/297 (43.77%), Query Frame = 3
Query:  408 INHDGCINRARYLPQCPNVIATK-SSNGNVYLFDYTR--------HPSKPDQSGKCKPDLVLKGHSQEGFGLSWNIKNAGVLLSSAVDGTIQLWDINCTPENKNDFKVLNSLSQYLGHEGSVEDVCWHKFSDQLFGSVGVDKNLLIWDRRESKPAVKVM----AHSDDVVTLDFNPFSEYILATGSEDKTIGLWDLRNMGGS--LKYLRGHEGSIGQLQWSLHKETILASGGSDNKVHLWDLKKTGTSKE-----------NTYSEELAFIHAGHCSRVIDFAWNGNEPLMMASVSY 1220
            + H GC+NR R      +V A   S  G V ++D T+          +K  +  + +P     GH QEGF + W+    GVL +      I +W    TP     +KV        GH  SVED+ W      +  S  VDK + IWD R S     ++    AH  DV  + +N  +E  +A+G +D  + +WDLR       +   + H   I  ++WS  + T+LASGG D+++ LWDL       +           N    +L FIH G    + +  W+   P ++ S ++
Sbjct:  157 VKHQGCVNRVRARRLGNSVYAASWSELGRVNIWDLTQPLQAVENAQLAKQYEQSEARPVFTFGGHQQEGFAIDWSPSADGVLATGDCRRDIHVW----TPVEDGTWKV--DQRPLAGHSQSVEDLQWSPNERSVLASCSVDKTIRIWDCRASPQKACMLTCEDAHQSDVNVISWN-RNEPFIASGGDDGYLHIWDLRQFQSKKPIATFKHHTDHITTVEWSPAEATVLASGGDDDQIALWDLAVEKDIDQAVDPAQNEDVLNKLPPQLLFIHQGQ-KEIKELHWHPQLPGVLLSTAH 445          
BLAST of retinoblastoma binding protein-1 vs. Ensembl Fly
Match: l(2)09851 (gene:FBgn0022288 transcript:FBtr0086043)

HSP 1 Score: 113.235 bits (282), Expect = 3.780e-27
Identity = 84/297 (28.28%), Postives = 130/297 (43.77%), Query Frame = 3
Query:  408 INHDGCINRARYLPQCPNVIATK-SSNGNVYLFDYTR--------HPSKPDQSGKCKPDLVLKGHSQEGFGLSWNIKNAGVLLSSAVDGTIQLWDINCTPENKNDFKVLNSLSQYLGHEGSVEDVCWHKFSDQLFGSVGVDKNLLIWDRRESKPAVKVM----AHSDDVVTLDFNPFSEYILATGSEDKTIGLWDLRNMGGS--LKYLRGHEGSIGQLQWSLHKETILASGGSDNKVHLWDLKKTGTSKE-----------NTYSEELAFIHAGHCSRVIDFAWNGNEPLMMASVSY 1220
            + H GC+NR R      +V A   S  G V ++D T+          +K  +  + +P     GH QEGF + W+    GVL +      I +W    TP     +KV        GH  SVED+ W      +  S  VDK + IWD R S     ++    AH  DV  + +N  +E  +A+G +D  + +WDLR       +   + H   I  ++WS  + T+LASGG D+++ LWDL       +           N    +L FIH G    + +  W+   P ++ S ++
Sbjct:  157 VKHQGCVNRVRARRLGNSVYAASWSELGRVNIWDLTQPLQAVENAQLAKQYEQSEARPVFTFGGHQQEGFAIDWSPSADGVLATGDCRRDIHVW----TPVEDGTWKV--DQRPLAGHSQSVEDLQWSPNERSVLASCSVDKTIRIWDCRASPQKACMLTCEDAHQSDVNVISWN-RNEPFIASGGDDGYLHIWDLRQFQSKKPIATFKHHTDHITTVEWSPAEATVLASGGDDDQIALWDLAVEKDIDQAVDPAQNEDVLNKLPPQLLFIHQGQ-KEIKELHWHPQLPGVLLSTAH 445          
BLAST of retinoblastoma binding protein-1 vs. Ensembl Fly
Match: Pex7 (gene:FBgn0035922 transcript:FBtr0076568)

HSP 1 Score: 103.99 bits (258), Expect = 1.776e-24
Identity = 74/280 (26.43%), Postives = 130/280 (46.43%), Query Frame = 3
Query:  417 DGCINRARYLPQCPNVIATKSSNGNVYLFDYTRHPSKPDQSGKCKPDLVLKGHSQEGFGLSWNIK-NAGVLLSSAVDGTIQLWDINCTPENKNDFKVLNSLSQYLGHEGSVEDVCWHKFSDQLFGSVGVDKNLLIWDRRE--SKPAVKVMAHSDDVVTLDFNPFSEYILATGSEDKTIGLWDLRNMGGSLKYLRGHEGSIGQLQWSLHKETILASGGSDNKVHLWDLKKTGTSKENTYSEELAFIHAGHCSRVIDFAWNGNEPLMMASVSYDNILQLWQP 1247
            DG  + A + P   ++ AT S +G++ ++      S  +Q    +P + L+ H  E + L W  K N   LLS + D T++LWD N            NS++ ++GH   +    +      LF SV  D +L +W+  +   KP + + AH+ + +  D++ F   +L TG  D  I  WDLR M   +  L   E ++ +L  S H   +LAS   D    +W+L++  +++E         ++A H   V    WN +    +A   +D++  ++ P
Sbjct:   71 DGLFDVA-WCPYAADIAATASGDGSLQIWCGLDGESASNQLTPKQPLICLQEHKNEVYSLDWGEKWNYHTLLSGSWDCTLKLWDCN----------RQNSITTFVGHNDLIYGAKFSPLIANLFASVSTDGHLNLWNSLDFAGKPLMSIEAHASEALCCDWSHFDRNVLVTGGSDGLIRGWDLRKMRTHVFELYSGEFAVRRLACSPHSAAVLASANYDFTTRIWNLERGESAQE---------VNARHTEFVCGLDWNPHRTHQLADCGWDSLANVYTP 330          
BLAST of retinoblastoma binding protein-1 vs. Ensembl Zebrafish
Match: rbbp4 (retinoblastoma binding protein 4 [Source:NCBI gene;Acc:321726])

HSP 1 Score: 436.802 bits (1122), Expect = 1.711e-151
Identity = 208/391 (53.20%), Postives = 280/391 (71.61%), Query Frame = 3
Query:  102 KDYIRWKKNTPFLYDLVMTHNLTWPSLTVQWMPDITRLEDKDYSTQRIIVGTQAEEEQDYLLIASVTVPNEYKCFESKHYDAEKDEFGGYGLVTAHTDISIKINHDGCINRARYLPQCPNVIATKSSNGNVYLFDYTRHPSKPDQSGKCKPDLVLKGHSQEGFGLSWNIKNAGVLLSSAVDGTIQLWDINCTPENKNDFKVLNSLSQYLGHEGSVEDVCWHKFSDQLFGSVGVDKNLLIWDRRE---SKPAVKVMAHSDDVVTLDFNPFSEYILATGSEDKTIGLWDLRNMGGSLKYLRGHEGSIGQLQWSLHKETILASGGSDNKVHLWDLKKTGTSKENTYSE----ELAFIHAGHCSRVIDFAWNGNEPLMMASVSYDNILQLWQPSE 1253
            ++Y  WKKNTPFLYDLVMTH L WPSLT QW+PD+TR E KD+S  R+++GT   +EQ++L+IASV +PN+   F++ HYD+EK EFGG+G V+   +I IKINH+G +NRARY+PQ P +IATK+   +V +FDYT+HPSKPD SG+C PDL L+GH +EG+GLSWN   +G LLS++ D TI LWDI+  P+   + K++++ + + GH   VEDV WH   + LFGSV  D+ L+IWD R    SKP+  V AH+ +V  L FNP+SE+ILATGS DKT+ LWDLRN+   L     H+  I Q+QWS H ETILAS G+D ++++WDL K G  +    +E    EL FIH GH +++ DF+WN NEP ++ SVS DNI+Q+WQ +E
Sbjct:   19 EEYKIWKKNTPFLYDLVMTHALEWPSLTAQWLPDVTRPEGKDFSVHRLVLGTHTSDEQNHLVIASVQLPNDDAQFDASHYDSEKGEFGGFGSVSGKIEIEIKINHEGEVNRARYMPQNPCIIATKTPTSDVLVFDYTKHPSKPDPSGECTPDLRLRGHQKEGYGLSWNPNLSGCLLSASDDHTICLWDISTVPK---EGKIVDAKTIFTGHTAVVEDVSWHLLHESLFGSVADDQKLMIWDTRSNNTSKPSHAVDAHTAEVNCLSFNPYSEFILATGSADKTVALWDLRNLKLKLHSFESHKDEIFQVQWSPHNETILASSGTDRRLNVWDLSKIGEEQSPEDAEDGPPELLFIHGGHTAKISDFSWNPNEPWVICSVSEDNIMQVWQMAE 406          
BLAST of retinoblastoma binding protein-1 vs. Ensembl Zebrafish
Match: rbb4l (retinoblastoma binding protein 4, like [Source:NCBI gene;Acc:322129])

HSP 1 Score: 434.491 bits (1116), Expect = 1.345e-150
Identity = 208/391 (53.20%), Postives = 278/391 (71.10%), Query Frame = 3
Query:  102 KDYIRWKKNTPFLYDLVMTHNLTWPSLTVQWMPDITRLEDKDYSTQRIIVGTQAEEEQDYLLIASVTVPNEYKCFESKHYDAEKDEFGGYGLVTAHTDISIKINHDGCINRARYLPQCPNVIATKSSNGNVYLFDYTRHPSKPDQSGKCKPDLVLKGHSQEGFGLSWNIKNAGVLLSSAVDGTIQLWDINCTPENKNDFKVLNSLSQYLGHEGSVEDVCWHKFSDQLFGSVGVDKNLLIWDRRE---SKPAVKVMAHSDDVVTLDFNPFSEYILATGSEDKTIGLWDLRNMGGSLKYLRGHEGSIGQLQWSLHKETILASGGSDNKVHLWDLKKTGTSKENTYSE----ELAFIHAGHCSRVIDFAWNGNEPLMMASVSYDNILQLWQPSE 1253
            ++Y  WKKNTPFLYDLVMTH L WPSLTVQW+PD+ R E KDY   R+++GT   +EQ++L+IASV +PN+   F++ HYD+EK EFGG+G V+   +I IKINH+G +NRARY+PQ P +IATK+   +V +FDYT+HPSKPD SG C PDL L+GH +EG+GLSWN   +G LLS++ D TI LWDI+  P+   + K++++ + + GH   VEDV WH   + LFGSV  D+ L+IWD R    SKP+  V AH+ +V  L FNP+SE+ILATGS DKT+ LWDLRN+   L     H+  I Q+QWS H ETILAS G+D ++++WDL K G  +    +E    EL FIH GH +++ DF+WN NEP ++ SVS DNI+Q+WQ +E
Sbjct:   18 EEYKIWKKNTPFLYDLVMTHALEWPSLTVQWLPDVNRPEGKDYVVHRLVLGTHTSDEQNHLVIASVQIPNDDAQFDASHYDSEKGEFGGFGSVSGKIEIEIKINHEGEVNRARYMPQNPCIIATKTPTSDVLVFDYTKHPSKPDPSGDCSPDLRLRGHQKEGYGLSWNPNLSGNLLSASDDHTICLWDISGAPK---EGKIVDAKTIFTGHTAVVEDVSWHLLHESLFGSVADDQKLMIWDTRSNNTSKPSHSVDAHTAEVNCLSFNPYSEFILATGSADKTVALWDLRNLKLKLHSFESHKDEIFQVQWSPHNETILASSGTDRRLNVWDLSKIGEEQSAEDAEDGPPELLFIHGGHTAKISDFSWNPNEPWVICSVSEDNIMQVWQMAE 405          
BLAST of retinoblastoma binding protein-1 vs. Ensembl Zebrafish
Match: rbb4l (retinoblastoma binding protein 4, like [Source:NCBI gene;Acc:322129])

HSP 1 Score: 430.254 bits (1105), Expect = 8.031e-149
Identity = 208/392 (53.06%), Postives = 278/392 (70.92%), Query Frame = 3
Query:  102 KDYIRWKKNTPFLYDLVMTHNLTWPSLTVQWMPDITRLEDKDYSTQRIIVGTQAEEEQDYLLIASVTVPNEYKCFESKHYDAEKD-EFGGYGLVTAHTDISIKINHDGCINRARYLPQCPNVIATKSSNGNVYLFDYTRHPSKPDQSGKCKPDLVLKGHSQEGFGLSWNIKNAGVLLSSAVDGTIQLWDINCTPENKNDFKVLNSLSQYLGHEGSVEDVCWHKFSDQLFGSVGVDKNLLIWDRRE---SKPAVKVMAHSDDVVTLDFNPFSEYILATGSEDKTIGLWDLRNMGGSLKYLRGHEGSIGQLQWSLHKETILASGGSDNKVHLWDLKKTGTSKENTYSE----ELAFIHAGHCSRVIDFAWNGNEPLMMASVSYDNILQLWQPSE 1253
            ++Y  WKKNTPFLYDLVMTH L WPSLTVQW+PD+ R E KDY   R+++GT   +EQ++L+IASV +PN+   F++ HYD+EK  EFGG+G V+   +I IKINH+G +NRARY+PQ P +IATK+   +V +FDYT+HPSKPD SG C PDL L+GH +EG+GLSWN   +G LLS++ D TI LWDI+  P+   + K++++ + + GH   VEDV WH   + LFGSV  D+ L+IWD R    SKP+  V AH+ +V  L FNP+SE+ILATGS DKT+ LWDLRN+   L     H+  I Q+QWS H ETILAS G+D ++++WDL K G  +    +E    EL FIH GH +++ DF+WN NEP ++ SVS DNI+Q+WQ +E
Sbjct:   18 EEYKIWKKNTPFLYDLVMTHALEWPSLTVQWLPDVNRPEGKDYVVHRLVLGTHTSDEQNHLVIASVQIPNDDAQFDASHYDSEKGAEFGGFGSVSGKIEIEIKINHEGEVNRARYMPQNPCIIATKTPTSDVLVFDYTKHPSKPDPSGDCSPDLRLRGHQKEGYGLSWNPNLSGNLLSASDDHTICLWDISGAPK---EGKIVDAKTIFTGHTAVVEDVSWHLLHESLFGSVADDQKLMIWDTRSNNTSKPSHSVDAHTAEVNCLSFNPYSEFILATGSADKTVALWDLRNLKLKLHSFESHKDEIFQVQWSPHNETILASSGTDRRLNVWDLSKIGEEQSAEDAEDGPPELLFIHGGHTAKISDFSWNPNEPWVICSVSEDNIMQVWQMAE 406          
BLAST of retinoblastoma binding protein-1 vs. Ensembl Zebrafish
Match: rbb4l (retinoblastoma binding protein 4, like [Source:NCBI gene;Acc:322129])

HSP 1 Score: 430.254 bits (1105), Expect = 8.031e-149
Identity = 208/392 (53.06%), Postives = 278/392 (70.92%), Query Frame = 3
Query:  102 KDYIRWKKNTPFLYDLVMTHNLTWPSLTVQWMPDITRLEDKDYSTQRIIVGTQAEEEQDYLLIASVTVPNEYKCFESKHYDAEKD-EFGGYGLVTAHTDISIKINHDGCINRARYLPQCPNVIATKSSNGNVYLFDYTRHPSKPDQSGKCKPDLVLKGHSQEGFGLSWNIKNAGVLLSSAVDGTIQLWDINCTPENKNDFKVLNSLSQYLGHEGSVEDVCWHKFSDQLFGSVGVDKNLLIWDRRE---SKPAVKVMAHSDDVVTLDFNPFSEYILATGSEDKTIGLWDLRNMGGSLKYLRGHEGSIGQLQWSLHKETILASGGSDNKVHLWDLKKTGTSKENTYSE----ELAFIHAGHCSRVIDFAWNGNEPLMMASVSYDNILQLWQPSE 1253
            ++Y  WKKNTPFLYDLVMTH L WPSLTVQW+PD+ R E KDY   R+++GT   +EQ++L+IASV +PN+   F++ HYD+EK  EFGG+G V+   +I IKINH+G +NRARY+PQ P +IATK+   +V +FDYT+HPSKPD SG C PDL L+GH +EG+GLSWN   +G LLS++ D TI LWDI+  P+   + K++++ + + GH   VEDV WH   + LFGSV  D+ L+IWD R    SKP+  V AH+ +V  L FNP+SE+ILATGS DKT+ LWDLRN+   L     H+  I Q+QWS H ETILAS G+D ++++WDL K G  +    +E    EL FIH GH +++ DF+WN NEP ++ SVS DNI+Q+WQ +E
Sbjct:   18 EEYKIWKKNTPFLYDLVMTHALEWPSLTVQWLPDVNRPEGKDYVVHRLVLGTHTSDEQNHLVIASVQIPNDDAQFDASHYDSEKGAEFGGFGSVSGKIEIEIKINHEGEVNRARYMPQNPCIIATKTPTSDVLVFDYTKHPSKPDPSGDCSPDLRLRGHQKEGYGLSWNPNLSGNLLSASDDHTICLWDISGAPK---EGKIVDAKTIFTGHTAVVEDVSWHLLHESLFGSVADDQKLMIWDTRSNNTSKPSHSVDAHTAEVNCLSFNPYSEFILATGSADKTVALWDLRNLKLKLHSFESHKDEIFQVQWSPHNETILASSGTDRRLNVWDLSKIGEEQSAEDAEDGPPELLFIHGGHTAKISDFSWNPNEPWVICSVSEDNIMQVWQMAE 406          
BLAST of retinoblastoma binding protein-1 vs. Ensembl Zebrafish
Match: CR450764.7 (pep chromosome:GRCz11:CHR_ALT_CTG11_3_1:12801933:12802332:1 gene:ENSDARG00000110109.1 transcript:ENSDART00000179997.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:CR450764.7)

HSP 1 Score: 115.931 bits (289), Expect = 3.709e-31
Identity = 50/84 (59.52%), Postives = 66/84 (78.57%), Query Frame = 3
Query:  102 KDYIRWKKNTPFLYDLVMTHNLTWPSLTVQWMPDITRLEDKDYSTQRIIVGTQAEEEQDYLLIASVTVPNEYKCFESKHYDAEK 353
            ++Y  WKKNTPFLYDLVMTH L WPSLTVQW+PD+ R E KDY   R+++GT   +EQ++L+IASV +PN+   F++ HYD+EK
Sbjct:   18 EEYKIWKKNTPFLYDLVMTHALEWPSLTVQWLPDVNRPEGKDYVVHRLVLGTHTSDEQNHLVIASVQIPNDDAQFDASHYDSEK 101          
BLAST of retinoblastoma binding protein-1 vs. Ensembl Xenopus
Match: rbbp4 (retinoblastoma binding protein 4 [Source:NCBI gene;Acc:496866])

HSP 1 Score: 440.269 bits (1131), Expect = 3.713e-152
Identity = 214/416 (51.44%), Postives = 290/416 (69.71%), Query Frame = 3
Query:   27 SKFLCFTAVKYTMIEELSNDSNSFCKDYIRWKKNTPFLYDLVMTHNLTWPSLTVQWMPDITRLEDKDYSTQRIIVGTQAEEEQDYLLIASVTVPNEYKCFESKHYDAEKDEFGGYGLVTAHTDISIKINHDGCINRARYLPQCPNVIATKSSNGNVYLFDYTRHPSKPDQSGKCKPDLVLKGHSQEGFGLSWNIKNAGVLLSSAVDGTIQLWDINCTPENKNDFKVLNSLSQYLGHEGSVEDVCWHKFSDQLFGSVGVDKNLLIWDRRE---SKPAVKVMAHSDDVVTLDFNPFSEYILATGSEDKTIGLWDLRNMGGSLKYLRGHEGSIGQLQWSLHKETILASGGSDNKVHLWDLKKTGTSKENTYSE----ELAFIHAGHCSRVIDFAWNGNEPLMMASVSYDNILQLWQPSE 1253
            S F+C  A    + E + N+      +Y  WKKNTPFLYDLVMTH L WPSLT QW+PD+TR + KD+S  R+++GT   +EQ++L+IASV +PN+   F++ HYD+EK EFGG+G V+   +I IKINH+G +NRARY+PQ P +IATK+ + +V +FDYT+HPSKPD SG+C PDL L+GH +EG+GLSWN   +G LLS++ D TI LWDI+  P+   + KV+++ + + GH   VEDV WH   + LFGSV  D+ L+IWD R    SKP+  V AH+ +V  L FNP+SE+ILATGS DKT+ LWDLRN+   L     H+  I Q+QWS H ETILAS G+D ++++WDL K G  +    +E    EL FIH GH +++ DF+WN NEP ++ SVS DNI+Q+WQ +E
Sbjct:   30 SVFMCAAAFDDAVEERVINE------EYKIWKKNTPFLYDLVMTHALEWPSLTAQWLPDVTRPDGKDFSIHRLVLGTHTSDEQNHLVIASVQLPNDDAQFDASHYDSEKGEFGGFGSVSGKIEIEIKINHEGEVNRARYMPQNPCIIATKTPSSDVLVFDYTKHPSKPDPSGECNPDLRLRGHQKEGYGLSWNPNLSGNLLSASDDHTICLWDISAVPK---EGKVVDAKTIFTGHTAVVEDVSWHLLHESLFGSVADDQKLMIWDTRSNNTSKPSHSVDAHTAEVNCLSFNPYSEFILATGSADKTVALWDLRNLKLKLHSFESHKDEIFQVQWSPHNETILASSGTDRRLNVWDLSKIGEEQSPEDAEDGPPELLFIHGGHTAKISDFSWNPNEPWVICSVSEDNIMQVWQMAE 436          
BLAST of retinoblastoma binding protein-1 vs. Ensembl Xenopus
Match: rbbp4 (retinoblastoma binding protein 4 [Source:NCBI gene;Acc:496866])

HSP 1 Score: 435.261 bits (1118), Expect = 1.291e-150
Identity = 208/391 (53.20%), Postives = 281/391 (71.87%), Query Frame = 3
Query:  102 KDYIRWKKNTPFLYDLVMTHNLTWPSLTVQWMPDITRLEDKDYSTQRIIVGTQAEEEQDYLLIASVTVPNEYKCFESKHYDAEKDEFGGYGLVTAHTDISIKINHDGCINRARYLPQCPNVIATKSSNGNVYLFDYTRHPSKPDQSGKCKPDLVLKGHSQEGFGLSWNIKNAGVLLSSAVDGTIQLWDINCTPENKNDFKVLNSLSQYLGHEGSVEDVCWHKFSDQLFGSVGVDKNLLIWDRRE---SKPAVKVMAHSDDVVTLDFNPFSEYILATGSEDKTIGLWDLRNMGGSLKYLRGHEGSIGQLQWSLHKETILASGGSDNKVHLWDLKKTGTSKENTYSE----ELAFIHAGHCSRVIDFAWNGNEPLMMASVSYDNILQLWQPSE 1253
            ++Y  WKKNTPFLYDLVMTH L WPSLT QW+PD+TR + KD+S  R+++GT   +EQ++L+IASV +PN+   F++ HYD+EK EFGG+G V+   +I IKINH+G +NRARY+PQ P +IATK+ + +V +FDYT+HPSKPD SG+C PDL L+GH +EG+GLSWN   +G LLS++ D TI LWDI+  P+   + KV+++ + + GH   VEDV WH   + LFGSV  D+ L+IWD R    SKP+  V AH+ +V  L FNP+SE+ILATGS DKT+ LWDLRN+   L     H+  I Q+QWS H ETILAS G+D ++++WDL K G  +    +E    EL FIH GH +++ DF+WN NEP ++ SVS DNI+Q+WQ +E
Sbjct:   25 EEYKIWKKNTPFLYDLVMTHALEWPSLTAQWLPDVTRPDGKDFSIHRLVLGTHTSDEQNHLVIASVQLPNDDAQFDASHYDSEKGEFGGFGSVSGKIEIEIKINHEGEVNRARYMPQNPCIIATKTPSSDVLVFDYTKHPSKPDPSGECNPDLRLRGHQKEGYGLSWNPNLSGNLLSASDDHTICLWDISAVPK---EGKVVDAKTIFTGHTAVVEDVSWHLLHESLFGSVADDQKLMIWDTRSNNTSKPSHSVDAHTAEVNCLSFNPYSEFILATGSADKTVALWDLRNLKLKLHSFESHKDEIFQVQWSPHNETILASSGTDRRLNVWDLSKIGEEQSPEDAEDGPPELLFIHGGHTAKISDFSWNPNEPWVICSVSEDNIMQVWQMAE 412          
BLAST of retinoblastoma binding protein-1 vs. Ensembl Xenopus
Match: rbbp4 (retinoblastoma binding protein 4 [Source:NCBI gene;Acc:496866])

HSP 1 Score: 434.491 bits (1116), Expect = 1.712e-150
Identity = 211/410 (51.46%), Postives = 286/410 (69.76%), Query Frame = 3
Query:   36 LCFTAVKYTMIEELSNDSNSFCKDYIRWKKNTPFLYDLVMTHNLTWPSLTVQWMPDITRLEDKDYSTQRIIVGTQAEEEQDYLLIASVTVPNEYKCFESKHYDAEKDEFGGYGLVTAHTDISIKINHDGCINRARYLPQCPNVIATKSSNGNVYLFDYTRHPSKPDQSGKCKPDLVLKGHSQEGFGLSWNIKNAGVLLSSAVDGTIQLWDINCTPENKNDFKVLNSLSQYLGHEGSVEDVCWHKFSDQLFGSVGVDKNLLIWDRRE---SKPAVKVMAHSDDVVTLDFNPFSEYILATGSEDKTIGLWDLRNMGGSLKYLRGHEGSIGQLQWSLHKETILASGGSDNKVHLWDLKKTGTSKENTYSE----ELAFIHAGHCSRVIDFAWNGNEPLMMASVSYDNILQLWQ 1244
            +C  A    + E + N+      +Y  WKKNTPFLYDLVMTH L WPSLT QW+PD+TR + KD+S  R+++GT   +EQ++L+IASV +PN+   F++ HYD+EK EFGG+G V+   +I IKINH+G +NRARY+PQ P +IATK+ + +V +FDYT+HPSKPD SG+C PDL L+GH +EG+GLSWN   +G LLS++ D TI LWDI+  P+   + KV+++ + + GH   VEDV WH   + LFGSV  D+ L+IWD R    SKP+  V AH+ +V  L FNP+SE+ILATGS DKT+ LWDLRN+   L     H+  I Q+QWS H ETILAS G+D ++++WDL K G  +    +E    EL FIH GH +++ DF+WN NEP ++ SVS DNI+Q+WQ
Sbjct:    1 MCAAAFDDAVEERVINE------EYKIWKKNTPFLYDLVMTHALEWPSLTAQWLPDVTRPDGKDFSIHRLVLGTHTSDEQNHLVIASVQLPNDDAQFDASHYDSEKGEFGGFGSVSGKIEIEIKINHEGEVNRARYMPQNPCIIATKTPSSDVLVFDYTKHPSKPDPSGECNPDLRLRGHQKEGYGLSWNPNLSGNLLSASDDHTICLWDISAVPK---EGKVVDAKTIFTGHTAVVEDVSWHLLHESLFGSVADDQKLMIWDTRSNNTSKPSHSVDAHTAEVNCLSFNPYSEFILATGSADKTVALWDLRNLKLKLHSFESHKDEIFQVQWSPHNETILASSGTDRRLNVWDLSKIGEEQSPEDAEDGPPELLFIHGGHTAKISDFSWNPNEPWVICSVSEDNIMQVWQ 401          
BLAST of retinoblastoma binding protein-1 vs. Ensembl Xenopus
Match: rbbp7 (retinoblastoma binding protein 7 [Source:NCBI gene;Acc:394900])

HSP 1 Score: 430.254 bits (1105), Expect = 2.006e-148
Identity = 205/406 (50.49%), Postives = 284/406 (69.95%), Query Frame = 3
Query:   57 YTMIEELSNDSNSFCKDYIRWKKNTPFLYDLVMTHNLTWPSLTVQWMPDITRLEDKDYSTQRIIVGTQAEEEQDYLLIASVTVPNEYKCFESKHYDAEKDEFGGYGLVTAHTDISIKINHDGCINRARYLPQCPNVIATKSSNGNVYLFDYTRHPSKPDQSGKCKPDLVLKGHSQEGFGLSWNIKNAGVLLSSAVDGTIQLWDINCTPENKNDFKVLNSLSQYLGHEGSVEDVCWHKFSDQLFGSVGVDKNLLIWDRRE---SKPAVKVMAHSDDVVTLDFNPFSEYILATGSEDKTIGLWDLRNMGGSLKYLRGHEGSIGQLQWSLHKETILASGGSDNKVHLWDLKKTGTSKENTYSE----ELAFIHAGHCSRVIDFAWNGNEPLMMASVSYDNILQLWQPSE 1253
            ++++ E + +     ++Y  WKKNTPFLYDLVMTH L WPSLTVQW+PD+TR E KDY+   +++GT   +EQ++L++A V +PN+   F++ HYD+EK EFGG+G V+   +  IKINH+G +NRARY+PQ P +IATK+ + +V +FDYT+HPSKPD SG C PDL L+GH +EG+GLSWN   +G LLS++ D T+ LWDI+  P+   + KV+++ + + GH   VEDV WH   + LFGSV  D+ L+IWD R    SKP+  V AH+ +V  L FNP+SE+ILATGS DKT+ LWDLRN+   L     H+  I Q+ WS H ETILAS G+D ++++WDL K G  +    +E    EL FIH GH +++ DF+WN NEP ++ SVS DNI+Q+WQ +E
Sbjct:   19 FSLVFEDTVEERVINEEYKIWKKNTPFLYDLVMTHALEWPSLTVQWLPDVTRPEGKDYALHWLVLGTHTSDEQNHLVVARVQIPNDDAQFDASHYDSEKGEFGGFGSVSGKIETEIKINHEGEVNRARYMPQNPCIIATKTPSADVLVFDYTKHPSKPDPSGDCSPDLRLRGHQKEGYGLSWNSNLSGHLLSASDDHTVCLWDISAGPK---EGKVVDAKAIFTGHSAVVEDVAWHLLHESLFGSVADDQKLMIWDTRSNTTSKPSHSVDAHTAEVNCLSFNPYSEFILATGSADKTVALWDLRNLKLKLHSFESHKDEIFQVHWSPHNETILASSGTDRRLNVWDLSKIGEEQSAEDAEDGPPELLFIHGGHTAKISDFSWNPNEPWVICSVSEDNIMQIWQMAE 421          
BLAST of retinoblastoma binding protein-1 vs. Ensembl Xenopus
Match: rbbp7 (retinoblastoma binding protein 7 [Source:NCBI gene;Acc:394900])

HSP 1 Score: 429.098 bits (1102), Expect = 2.589e-148
Identity = 204/391 (52.17%), Postives = 277/391 (70.84%), Query Frame = 3
Query:  102 KDYIRWKKNTPFLYDLVMTHNLTWPSLTVQWMPDITRLEDKDYSTQRIIVGTQAEEEQDYLLIASVTVPNEYKCFESKHYDAEKDEFGGYGLVTAHTDISIKINHDGCINRARYLPQCPNVIATKSSNGNVYLFDYTRHPSKPDQSGKCKPDLVLKGHSQEGFGLSWNIKNAGVLLSSAVDGTIQLWDINCTPENKNDFKVLNSLSQYLGHEGSVEDVCWHKFSDQLFGSVGVDKNLLIWDRRE---SKPAVKVMAHSDDVVTLDFNPFSEYILATGSEDKTIGLWDLRNMGGSLKYLRGHEGSIGQLQWSLHKETILASGGSDNKVHLWDLKKTGTSKENTYSE----ELAFIHAGHCSRVIDFAWNGNEPLMMASVSYDNILQLWQPSE 1253
            ++Y  WKKNTPFLYDLVMTH L WPSLTVQW+PD+TR E KDY+   +++GT   +EQ++L++A V +PN+   F++ HYD+EK EFGG+G V+   +  IKINH+G +NRARY+PQ P +IATK+ + +V +FDYT+HPSKPD SG C PDL L+GH +EG+GLSWN   +G LLS++ D T+ LWDI+  P+   + KV+++ + + GH   VEDV WH   + LFGSV  D+ L+IWD R    SKP+  V AH+ +V  L FNP+SE+ILATGS DKT+ LWDLRN+   L     H+  I Q+ WS H ETILAS G+D ++++WDL K G  +    +E    EL FIH GH +++ DF+WN NEP ++ SVS DNI+Q+WQ +E
Sbjct:   18 EEYKIWKKNTPFLYDLVMTHALEWPSLTVQWLPDVTRPEGKDYALHWLVLGTHTSDEQNHLVVARVQIPNDDAQFDASHYDSEKGEFGGFGSVSGKIETEIKINHEGEVNRARYMPQNPCIIATKTPSADVLVFDYTKHPSKPDPSGDCSPDLRLRGHQKEGYGLSWNSNLSGHLLSASDDHTVCLWDISAGPK---EGKVVDAKAIFTGHSAVVEDVAWHLLHESLFGSVADDQKLMIWDTRSNTTSKPSHSVDAHTAEVNCLSFNPYSEFILATGSADKTVALWDLRNLKLKLHSFESHKDEIFQVHWSPHNETILASSGTDRRLNVWDLSKIGEEQSAEDAEDGPPELLFIHGGHTAKISDFSWNPNEPWVICSVSEDNIMQIWQMAE 405          
BLAST of retinoblastoma binding protein-1 vs. Ensembl Mouse
Match: Rbbp4 (retinoblastoma binding protein 4, chromatin remodeling factor [Source:MGI Symbol;Acc:MGI:1194912])

HSP 1 Score: 437.187 bits (1123), Expect = 1.537e-151
Identity = 209/391 (53.45%), Postives = 281/391 (71.87%), Query Frame = 3
Query:  102 KDYIRWKKNTPFLYDLVMTHNLTWPSLTVQWMPDITRLEDKDYSTQRIIVGTQAEEEQDYLLIASVTVPNEYKCFESKHYDAEKDEFGGYGLVTAHTDISIKINHDGCINRARYLPQCPNVIATKSSNGNVYLFDYTRHPSKPDQSGKCKPDLVLKGHSQEGFGLSWNIKNAGVLLSSAVDGTIQLWDINCTPENKNDFKVLNSLSQYLGHEGSVEDVCWHKFSDQLFGSVGVDKNLLIWDRRE---SKPAVKVMAHSDDVVTLDFNPFSEYILATGSEDKTIGLWDLRNMGGSLKYLRGHEGSIGQLQWSLHKETILASGGSDNKVHLWDLKKTGTSKENTYSE----ELAFIHAGHCSRVIDFAWNGNEPLMMASVSYDNILQLWQPSE 1253
            ++Y  WKKNTPFLYDLVMTH L WPSLT QW+PD+TR E KD+S  R+++GT   +EQ++L+IASV +PN+   F++ HYD+EK EFGG+G V+   +I IKINH+G +NRARY+PQ P +IATK+ + +V +FDYT+HPSKPD SG+C PDL L+GH +EG+GLSWN   +G LLS++ D TI LWDI+  P+   + KV+++ + + GH   VEDV WH   + LFGSV  D+ L+IWD R    SKP+  V AH+ +V  L FNP+SE+ILATGS DKT+ LWDLRN+   L     H+  I Q+QWS H ETILAS G+D ++++WDL K G  +    +E    EL FIH GH +++ DF+WN NEP ++ SVS DNI+Q+WQ +E
Sbjct:   19 EEYKIWKKNTPFLYDLVMTHALEWPSLTAQWLPDVTRPEGKDFSIHRLVLGTHTSDEQNHLVIASVQLPNDDAQFDASHYDSEKGEFGGFGSVSGKIEIEIKINHEGEVNRARYMPQNPCIIATKTPSSDVLVFDYTKHPSKPDPSGECNPDLRLRGHQKEGYGLSWNPNLSGHLLSASDDHTICLWDISAVPK---EGKVVDAKTIFTGHTAVVEDVSWHLLHESLFGSVADDQKLMIWDTRSNNTSKPSHSVDAHTAEVNCLSFNPYSEFILATGSADKTVALWDLRNLKLKLHSFESHKDEIFQVQWSPHNETILASSGTDRRLNVWDLSKIGEEQSPEDAEDGPPELLFIHGGHTAKISDFSWNPNEPWVICSVSEDNIMQVWQMAE 406          
BLAST of retinoblastoma binding protein-1 vs. Ensembl Mouse
Match: Rbbp7 (retinoblastoma binding protein 7, chromatin remodeling factor [Source:MGI Symbol;Acc:MGI:1194910])

HSP 1 Score: 422.935 bits (1086), Expect = 5.029e-146
Identity = 200/391 (51.15%), Postives = 278/391 (71.10%), Query Frame = 3
Query:  102 KDYIRWKKNTPFLYDLVMTHNLTWPSLTVQWMPDITRLEDKDYSTQRIIVGTQAEEEQDYLLIASVTVPNEYKCFESKHYDAEKDEFGGYGLVTAHTDISIKINHDGCINRARYLPQCPNVIATKSSNGNVYLFDYTRHPSKPDQSGKCKPDLVLKGHSQEGFGLSWNIKNAGVLLSSAVDGTIQLWDINCTPENKNDFKVLNSLSQYLGHEGSVEDVCWHKFSDQLFGSVGVDKNLLIWDRRE---SKPAVKVMAHSDDVVTLDFNPFSEYILATGSEDKTIGLWDLRNMGGSLKYLRGHEGSIGQLQWSLHKETILASGGSDNKVHLWDLKKTGTSKENTYSE----ELAFIHAGHCSRVIDFAWNGNEPLMMASVSYDNILQLWQPSE 1253
            ++Y  WKKNTPFLYDLVMTH L WPSLTVQW+P++T+ E KDY+   +++GT   +EQ++L++A V +PN+   F++ H D++K EFGG+G VT   +  IKINH+G +NRARY+PQ P++IATK+ + +V +FDYT+HP+KPD SG+C PDL L+GH +EG+GLSWN   +G LLS++ D T+ LWDIN  P+   + K++++ + + GH   VEDV WH   + LFGSV  D+ L+IWD R    SKP+  V AH+ +V  L FNP+SE+ILATGS DKT+ LWDLRN+   L     H+  I Q+ WS H ETILAS G+D ++++WDL K G  +    +E    EL FIH GH +++ DF+WN NEP ++ SVS DNI+Q+WQ +E
Sbjct:   18 EEYKIWKKNTPFLYDLVMTHALQWPSLTVQWLPEVTKPEGKDYALHWLVLGTHTSDEQNHLVVARVHIPNDDAQFDASHCDSDKGEFGGFGSVTGKIECEIKINHEGEVNRARYMPQNPHIIATKTPSSDVLVFDYTKHPAKPDPSGECNPDLRLRGHQKEGYGLSWNSNLSGHLLSASDDHTVCLWDINAGPK---EGKIVDAKAIFTGHSAVVEDVAWHLLHESLFGSVADDQKLMIWDTRSNTTSKPSHLVDAHTAEVNCLSFNPYSEFILATGSADKTVALWDLRNLKLKLHTFESHKDEIFQVHWSPHNETILASSGTDRRLNVWDLSKIGEEQSAEDAEDGPPELLFIHGGHTAKISDFSWNPNEPWVICSVSEDNIMQIWQMAE 405          
BLAST of retinoblastoma binding protein-1 vs. Ensembl Mouse
Match: Rbbp7 (retinoblastoma binding protein 7, chromatin remodeling factor [Source:MGI Symbol;Acc:MGI:1194910])

HSP 1 Score: 401.364 bits (1030), Expect = 1.140e-137
Identity = 195/391 (49.87%), Postives = 272/391 (69.57%), Query Frame = 3
Query:  102 KDYIRWKKNTPFLYDLVMTHNLTWPSLTVQWMPDITRLEDKDYSTQRIIVGTQAEEEQDYLLIASVTVPNEYKCFESKHYDAEKDEFGGYGLVTAHTDISIKINHDGCINRARYLPQCPNVIATKSSNGNVYLFDYTRHPSKPDQSGKCKPDLVLKGHSQEGFGLSWNIKNAGVLLSSAVDGTIQLWDINCTPENKNDFKVLNSLSQYLGHEGSVEDVCWHKFSDQLFGSVGVDKNLLIWDRRE---SKPAVKVMAHSDDVVTLDFNPFSEYILATGSEDKTIGLWDLRNMGGSLKYLRGHEGSIGQLQWSLHKETILASGGSDNKVHLWDLKKTGTSKENTYSE----ELAFIHAGHCSRVIDFAWNGNEPLMMASVSYDNILQLWQPSE 1253
            ++Y  WKKNTPFLYDLVMTH L WPSLTVQW+P++T+ E KDY+   +++GT   +EQ++L++A V +PN+   F++ H D++K   GG        +  IKINH+G +NRARY+PQ P++IATK+ + +V +FDYT+HP+KPD SG+C PDL L+GH +EG+GLSWN   +G LLS++ D T+ LWDIN  P+   + K++++ + + GH   VEDV WH   + LFGSV  D+ L+IWD R    SKP+  V AH+ +V  L FNP+SE+ILATGS DKT+ LWDLRN+   L     H+  I Q+ WS H ETILAS G+D ++++WDL K G  +    +E    EL FIH GH +++ DF+WN NEP ++ SVS DNI+Q+WQ +E
Sbjct:   18 EEYKIWKKNTPFLYDLVMTHALQWPSLTVQWLPEVTKPEGKDYALHWLVLGTHTSDEQNHLVVARVHIPNDDAQFDASHCDSDK---GGK------IECEIKINHEGEVNRARYMPQNPHIIATKTPSSDVLVFDYTKHPAKPDPSGECNPDLRLRGHQKEGYGLSWNSNLSGHLLSASDDHTVCLWDINAGPK---EGKIVDAKAIFTGHSAVVEDVAWHLLHESLFGSVADDQKLMIWDTRSNTTSKPSHLVDAHTAEVNCLSFNPYSEFILATGSADKTVALWDLRNLKLKLHTFESHKDEIFQVHWSPHNETILASSGTDRRLNVWDLSKIGEEQSAEDAEDGPPELLFIHGGHTAKISDFSWNPNEPWVICSVSEDNIMQIWQMAE 396          
BLAST of retinoblastoma binding protein-1 vs. Ensembl Mouse
Match: Rbbp7 (retinoblastoma binding protein 7, chromatin remodeling factor [Source:MGI Symbol;Acc:MGI:1194910])

HSP 1 Score: 374.015 bits (959), Expect = 2.653e-127
Identity = 176/346 (50.87%), Postives = 246/346 (71.10%), Query Frame = 3
Query:  102 KDYIRWKKNTPFLYDLVMTHNLTWPSLTVQWMPDITRLEDKDYSTQRIIVGTQAEEEQDYLLIASVTVPNEYKCFESKHYDAEKDEFGGYGLVTAHTDISIKINHDGCINRARYLPQCPNVIATKSSNGNVYLFDYTRHPSKPDQSGKCKPDLVLKGHSQEGFGLSWNIKNAGVLLSSAVDGTIQLWDINCTPENKNDFKVLNSLSQYLGHEGSVEDVCWHKFSDQLFGSVGVDKNLLIWDRRE---SKPAVKVMAHSDDVVTLDFNPFSEYILATGSEDKTIGLWDLRNMGGSLKYLRGHEGSIGQLQWSLHKETILASGGSDNKVHLWDLKKTGTSKENTYSEE 1130
            ++Y  WKKNTPFLYDLVMTH L WPSLTVQW+P++T+ E KDY+   +++GT   +EQ++L++A V +PN+   F++ H D++K EFGG+G VT   +  IKINH+G +NRARY+PQ P++IATK+ + +V +FDYT+HP+KPD SG+C PDL L+GH +EG+GLSWN   +G LLS++ D T+ LWDIN  P+   + K++++ + + GH   VEDV WH   + LFGSV  D+ L+IWD R    SKP+  V AH+ +V  L FNP+SE+ILATGS DKT+ LWDLRN+   L     H+  I Q+ WS H ETILAS G+D ++++WDL K G  +    +E+
Sbjct:   18 EEYKIWKKNTPFLYDLVMTHALQWPSLTVQWLPEVTKPEGKDYALHWLVLGTHTSDEQNHLVVARVHIPNDDAQFDASHCDSDKGEFGGFGSVTGKIECEIKINHEGEVNRARYMPQNPHIIATKTPSSDVLVFDYTKHPAKPDPSGECNPDLRLRGHQKEGYGLSWNSNLSGHLLSASDDHTVCLWDINAGPK---EGKIVDAKAIFTGHSAVVEDVAWHLLHESLFGSVADDQKLMIWDTRSNTTSKPSHLVDAHTAEVNCLSFNPYSEFILATGSADKTVALWDLRNLKLKLHTFESHKDEIFQVHWSPHNETILASSGTDRRLNVWDLSKIGEEQSAEDAED 360          
BLAST of retinoblastoma binding protein-1 vs. Ensembl Mouse
Match: Rbbp7 (retinoblastoma binding protein 7, chromatin remodeling factor [Source:MGI Symbol;Acc:MGI:1194910])

HSP 1 Score: 239.58 bits (610), Expect = 8.120e-77
Identity = 112/218 (51.38%), Postives = 159/218 (72.94%), Query Frame = 3
Query:   18 FVCSKFLCFTAVKYTMIEELSNDSNSFCKDYIRWKKNTPFLYDLVMTHNLTWPSLTVQWMPDITRLEDKDYSTQRIIVGTQAEEEQDYLLIASVTVPNEYKCFESKHYDAEKDEFGGYGLVTAHTDISIKINHDGCINRARYLPQCPNVIATKSSNGNVYLFDYTRHPSKPDQSGKCKPDLVLKGHSQEGFGLSWNIKNAGVLLSSAVDGTIQLWDIN 671
            + C  +L F   + T+ E + N+      +Y  WKKNTPFLYDLVMTH L WPSLTVQW+P++T+ E KDY+   +++GT   +EQ++L++A V +PN+   F++ H D++K EFGG+G VT   +  IKINH+G +NRARY+PQ P++IATK+ + +V +FDYT+HP+KPD SG+C PDL L+GH +EG+GLSWN   +G LLS++ D T+ LWDIN
Sbjct:   27 YGCRSWLVF---EDTVEERVINE------EYKIWKKNTPFLYDLVMTHALQWPSLTVQWLPEVTKPEGKDYALHWLVLGTHTSDEQNHLVVARVHIPNDDAQFDASHCDSDKGEFGGFGSVTGKIECEIKINHEGEVNRARYMPQNPHIIATKTPSSDVLVFDYTKHPAKPDPSGECNPDLRLRGHQKEGYGLSWNSNLSGHLLSASDDHTVCLWDIN 235          
BLAST of retinoblastoma binding protein-1 vs. UniProt/SwissProt
Match: sp|Q24572|CAF1_DROME (Probable histone-binding protein Caf1 OS=Drosophila melanogaster OX=7227 GN=Caf1 PE=1 SV=1)

HSP 1 Score: 437.958 bits (1125), Expect = 6.071e-151
Identity = 211/391 (53.96%), Postives = 278/391 (71.10%), Query Frame = 3
Query:  102 KDYIRWKKNTPFLYDLVMTHNLTWPSLTVQWMPDITRLEDKDYSTQRIIVGTQAEEEQDYLLIASVTVPNEYKCFESKHYDAEKDEFGGYGLVTAHTDISIKINHDGCINRARYLPQCPNVIATKSSNGNVYLFDYTRHPSKPDQSGKCKPDLVLKGHSQEGFGLSWNIKNAGVLLSSAVDGTIQLWDINCTPENKNDFKVLNSLSQYLGHEGSVEDVCWHKFSDQLFGSVGVDKNLLIWDRRE---SKPAVKVMAHSDDVVTLDFNPFSEYILATGSEDKTIGLWDLRNMGGSLKYLRGHEGSIGQLQWSLHKETILASGGSDNKVHLWDLKKTGTSKENTYSE----ELAFIHAGHCSRVIDFAWNGNEPLMMASVSYDNILQLWQPSE 1253
            ++Y  WKKNTPFLYDLVMTH L WPSLT QW+PD+T+ + KDYS  R+I+GT   +EQ++LLIASV +P+E   F+  HYD EK EFGG+G V    +I IKINH+G +NRARY+PQ   VIATK+ + +V +FDYT+HPSKP+ SG+C+PDL L+GH +EG+GLSWN    G LLS++ D TI LWDIN TP+   + +V+++ + + GH   VEDV WH   + LFGSV  D+ L+IWD R    SKP+  V AH+ +V  L FNP+SE+ILATGS DKT+ LWDLRN+   L     H+  I Q+QWS H ETILAS G+D ++H+WDL K G  +    +E    EL FIH GH +++ DF+WN NEP ++ SVS DNI+Q+WQ +E
Sbjct:   23 EEYKIWKKNTPFLYDLVMTHALEWPSLTAQWLPDVTKQDGKDYSVHRLILGTHTSDEQNHLLIASVQLPSEDAQFDGSHYDNEKGEFGGFGSVCGKIEIEIKINHEGEVNRARYMPQNACVIATKTPSSDVLVFDYTKHPSKPEPSGECQPDLRLRGHQKEGYGLSWNPNLNGYLLSASDDHTICLWDINATPK---EHRVIDAKNIFTGHTAVVEDVAWHLLHESLFGSVADDQKLMIWDTRNNNTSKPSHTVDAHTAEVNCLSFNPYSEFILATGSADKTVALWDLRNLKLKLHSFESHKDEIFQVQWSPHNETILASSGTDRRLHVWDLSKIGEEQSTEDAEDGPPELLFIHGGHTAKISDFSWNPNEPWIICSVSEDNIMQVWQMAE 410          
BLAST of retinoblastoma binding protein-1 vs. UniProt/SwissProt
Match: sp|Q60972|RBBP4_MOUSE (Histone-binding protein RBBP4 OS=Mus musculus OX=10090 GN=Rbbp4 PE=1 SV=5)

HSP 1 Score: 437.187 bits (1123), Expect = 1.075e-150
Identity = 209/391 (53.45%), Postives = 281/391 (71.87%), Query Frame = 3
Query:  102 KDYIRWKKNTPFLYDLVMTHNLTWPSLTVQWMPDITRLEDKDYSTQRIIVGTQAEEEQDYLLIASVTVPNEYKCFESKHYDAEKDEFGGYGLVTAHTDISIKINHDGCINRARYLPQCPNVIATKSSNGNVYLFDYTRHPSKPDQSGKCKPDLVLKGHSQEGFGLSWNIKNAGVLLSSAVDGTIQLWDINCTPENKNDFKVLNSLSQYLGHEGSVEDVCWHKFSDQLFGSVGVDKNLLIWDRRE---SKPAVKVMAHSDDVVTLDFNPFSEYILATGSEDKTIGLWDLRNMGGSLKYLRGHEGSIGQLQWSLHKETILASGGSDNKVHLWDLKKTGTSKENTYSE----ELAFIHAGHCSRVIDFAWNGNEPLMMASVSYDNILQLWQPSE 1253
            ++Y  WKKNTPFLYDLVMTH L WPSLT QW+PD+TR E KD+S  R+++GT   +EQ++L+IASV +PN+   F++ HYD+EK EFGG+G V+   +I IKINH+G +NRARY+PQ P +IATK+ + +V +FDYT+HPSKPD SG+C PDL L+GH +EG+GLSWN   +G LLS++ D TI LWDI+  P+   + KV+++ + + GH   VEDV WH   + LFGSV  D+ L+IWD R    SKP+  V AH+ +V  L FNP+SE+ILATGS DKT+ LWDLRN+   L     H+  I Q+QWS H ETILAS G+D ++++WDL K G  +    +E    EL FIH GH +++ DF+WN NEP ++ SVS DNI+Q+WQ +E
Sbjct:   19 EEYKIWKKNTPFLYDLVMTHALEWPSLTAQWLPDVTRPEGKDFSIHRLVLGTHTSDEQNHLVIASVQLPNDDAQFDASHYDSEKGEFGGFGSVSGKIEIEIKINHEGEVNRARYMPQNPCIIATKTPSSDVLVFDYTKHPSKPDPSGECNPDLRLRGHQKEGYGLSWNPNLSGHLLSASDDHTICLWDISAVPK---EGKVVDAKTIFTGHTAVVEDVSWHLLHESLFGSVADDQKLMIWDTRSNNTSKPSHSVDAHTAEVNCLSFNPYSEFILATGSADKTVALWDLRNLKLKLHSFESHKDEIFQVQWSPHNETILASSGTDRRLNVWDLSKIGEEQSPEDAEDGPPELLFIHGGHTAKISDFSWNPNEPWVICSVSEDNIMQVWQMAE 406          
BLAST of retinoblastoma binding protein-1 vs. UniProt/SwissProt
Match: sp|Q09028|RBBP4_HUMAN (Histone-binding protein RBBP4 OS=Homo sapiens OX=9606 GN=RBBP4 PE=1 SV=3)

HSP 1 Score: 437.187 bits (1123), Expect = 1.075e-150
Identity = 209/391 (53.45%), Postives = 281/391 (71.87%), Query Frame = 3
Query:  102 KDYIRWKKNTPFLYDLVMTHNLTWPSLTVQWMPDITRLEDKDYSTQRIIVGTQAEEEQDYLLIASVTVPNEYKCFESKHYDAEKDEFGGYGLVTAHTDISIKINHDGCINRARYLPQCPNVIATKSSNGNVYLFDYTRHPSKPDQSGKCKPDLVLKGHSQEGFGLSWNIKNAGVLLSSAVDGTIQLWDINCTPENKNDFKVLNSLSQYLGHEGSVEDVCWHKFSDQLFGSVGVDKNLLIWDRRE---SKPAVKVMAHSDDVVTLDFNPFSEYILATGSEDKTIGLWDLRNMGGSLKYLRGHEGSIGQLQWSLHKETILASGGSDNKVHLWDLKKTGTSKENTYSE----ELAFIHAGHCSRVIDFAWNGNEPLMMASVSYDNILQLWQPSE 1253
            ++Y  WKKNTPFLYDLVMTH L WPSLT QW+PD+TR E KD+S  R+++GT   +EQ++L+IASV +PN+   F++ HYD+EK EFGG+G V+   +I IKINH+G +NRARY+PQ P +IATK+ + +V +FDYT+HPSKPD SG+C PDL L+GH +EG+GLSWN   +G LLS++ D TI LWDI+  P+   + KV+++ + + GH   VEDV WH   + LFGSV  D+ L+IWD R    SKP+  V AH+ +V  L FNP+SE+ILATGS DKT+ LWDLRN+   L     H+  I Q+QWS H ETILAS G+D ++++WDL K G  +    +E    EL FIH GH +++ DF+WN NEP ++ SVS DNI+Q+WQ +E
Sbjct:   19 EEYKIWKKNTPFLYDLVMTHALEWPSLTAQWLPDVTRPEGKDFSIHRLVLGTHTSDEQNHLVIASVQLPNDDAQFDASHYDSEKGEFGGFGSVSGKIEIEIKINHEGEVNRARYMPQNPCIIATKTPSSDVLVFDYTKHPSKPDPSGECNPDLRLRGHQKEGYGLSWNPNLSGHLLSASDDHTICLWDISAVPK---EGKVVDAKTIFTGHTAVVEDVSWHLLHESLFGSVADDQKLMIWDTRSNNTSKPSHSVDAHTAEVNCLSFNPYSEFILATGSADKTVALWDLRNLKLKLHSFESHKDEIFQVQWSPHNETILASSGTDRRLNVWDLSKIGEEQSPEDAEDGPPELLFIHGGHTAKISDFSWNPNEPWVICSVSEDNIMQVWQMAE 406          
BLAST of retinoblastoma binding protein-1 vs. UniProt/SwissProt
Match: sp|Q3MHL3|RBBP4_BOVIN (Histone-binding protein RBBP4 OS=Bos taurus OX=9913 GN=RBBP4 PE=1 SV=3)

HSP 1 Score: 437.187 bits (1123), Expect = 1.075e-150
Identity = 209/391 (53.45%), Postives = 281/391 (71.87%), Query Frame = 3
Query:  102 KDYIRWKKNTPFLYDLVMTHNLTWPSLTVQWMPDITRLEDKDYSTQRIIVGTQAEEEQDYLLIASVTVPNEYKCFESKHYDAEKDEFGGYGLVTAHTDISIKINHDGCINRARYLPQCPNVIATKSSNGNVYLFDYTRHPSKPDQSGKCKPDLVLKGHSQEGFGLSWNIKNAGVLLSSAVDGTIQLWDINCTPENKNDFKVLNSLSQYLGHEGSVEDVCWHKFSDQLFGSVGVDKNLLIWDRRE---SKPAVKVMAHSDDVVTLDFNPFSEYILATGSEDKTIGLWDLRNMGGSLKYLRGHEGSIGQLQWSLHKETILASGGSDNKVHLWDLKKTGTSKENTYSE----ELAFIHAGHCSRVIDFAWNGNEPLMMASVSYDNILQLWQPSE 1253
            ++Y  WKKNTPFLYDLVMTH L WPSLT QW+PD+TR E KD+S  R+++GT   +EQ++L+IASV +PN+   F++ HYD+EK EFGG+G V+   +I IKINH+G +NRARY+PQ P +IATK+ + +V +FDYT+HPSKPD SG+C PDL L+GH +EG+GLSWN   +G LLS++ D TI LWDI+  P+   + KV+++ + + GH   VEDV WH   + LFGSV  D+ L+IWD R    SKP+  V AH+ +V  L FNP+SE+ILATGS DKT+ LWDLRN+   L     H+  I Q+QWS H ETILAS G+D ++++WDL K G  +    +E    EL FIH GH +++ DF+WN NEP ++ SVS DNI+Q+WQ +E
Sbjct:   19 EEYKIWKKNTPFLYDLVMTHALEWPSLTAQWLPDVTRPEGKDFSIHRLVLGTHTSDEQNHLVIASVQLPNDDAQFDASHYDSEKGEFGGFGSVSGKIEIEIKINHEGEVNRARYMPQNPCIIATKTPSSDVLVFDYTKHPSKPDPSGECNPDLRLRGHQKEGYGLSWNPNLSGHLLSASDDHTICLWDISAVPK---EGKVVDAKTIFTGHTAVVEDVSWHLLHESLFGSVADDQKLMIWDTRSNNTSKPSHSVDAHTAEVNCLSFNPYSEFILATGSADKTVALWDLRNLKLKLHSFESHKDEIFQVQWSPHNETILASSGTDRRLNVWDLSKIGEEQSPEDAEDGPPELLFIHGGHTAKISDFSWNPNEPWVICSVSEDNIMQVWQMAE 406          
BLAST of retinoblastoma binding protein-1 vs. UniProt/SwissProt
Match: sp|Q9W7I5|RBBP4_CHICK (Histone-binding protein RBBP4 OS=Gallus gallus OX=9031 GN=RBBP4 PE=1 SV=3)

HSP 1 Score: 437.187 bits (1123), Expect = 1.199e-150
Identity = 209/391 (53.45%), Postives = 281/391 (71.87%), Query Frame = 3
Query:  102 KDYIRWKKNTPFLYDLVMTHNLTWPSLTVQWMPDITRLEDKDYSTQRIIVGTQAEEEQDYLLIASVTVPNEYKCFESKHYDAEKDEFGGYGLVTAHTDISIKINHDGCINRARYLPQCPNVIATKSSNGNVYLFDYTRHPSKPDQSGKCKPDLVLKGHSQEGFGLSWNIKNAGVLLSSAVDGTIQLWDINCTPENKNDFKVLNSLSQYLGHEGSVEDVCWHKFSDQLFGSVGVDKNLLIWDRRE---SKPAVKVMAHSDDVVTLDFNPFSEYILATGSEDKTIGLWDLRNMGGSLKYLRGHEGSIGQLQWSLHKETILASGGSDNKVHLWDLKKTGTSKENTYSE----ELAFIHAGHCSRVIDFAWNGNEPLMMASVSYDNILQLWQPSE 1253
            ++Y  WKKNTPFLYDLVMTH L WPSLT QW+PD+TR E KD+S  R+++GT   +EQ++L+IASV +PN+   F++ HYD+EK EFGG+G V+   +I IKINH+G +NRARY+PQ P +IATK+ + +V +FDYT+HPSKPD SG+C PDL L+GH +EG+GLSWN   +G LLS++ D TI LWDI+  P+   + KV+++ + + GH   VEDV WH   + LFGSV  D+ L+IWD R    SKP+  V AH+ +V  L FNP+SE+ILATGS DKT+ LWDLRN+   L     H+  I Q+QWS H ETILAS G+D ++++WDL K G  +    +E    EL FIH GH +++ DF+WN NEP ++ SVS DNI+Q+WQ +E
Sbjct:   19 EEYKIWKKNTPFLYDLVMTHALEWPSLTAQWLPDVTRPEGKDFSIHRLVLGTHTSDEQNHLVIASVQLPNDDAQFDASHYDSEKGEFGGFGSVSGKIEIEIKINHEGEVNRARYMPQNPCIIATKTPSSDVLVFDYTKHPSKPDPSGECNPDLRLRGHQKEGYGLSWNPNLSGHLLSASDDHTICLWDISAVPK---EGKVVDAKTIFTGHTAVVEDVSWHLLHESLFGSVADDQKLMIWDTRSNNTSKPSHSVDAHTAEVNCLSFNPYSEFILATGSADKTVALWDLRNLKLKLHSFESHKDEIFQVQWSPHNETILASSGTDRRLNVWDLSKIGEEQSPEDAEDGPPELLFIHGGHTAKISDFSWNPNEPWVICSVSEDNIMQVWQMAE 406          
BLAST of retinoblastoma binding protein-1 vs. TrEMBL
Match: I1ZIK2 (Retinoblastoma binding protein-1 OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 806.979 bits (2083), Expect = 0.000e+0
Identity = 388/401 (96.76%), Postives = 392/401 (97.76%), Query Frame = 3
Query:   63 MIEELSNDSNSFCKDYIRWKKNTPFLYDLVMTHNLTWPSLTVQWMPDITRLEDKDYSTQRIIVGTQAEEEQDYLLIASVTVPNEYKCFESKHYDAEKDEFGGYGLVTAHTDISIKINHDGCINRARYLPQCPNVIATKSSNGNVYLFDYTRHPSKPDQSGKCKPDLVLKGHSQEGFGLSWNIKNAGVLLSSAVDGTIQLWDINCTPENKNDFKVLNSLSQYLGHEGSVEDVCWHKFSDQLFGSVGVDKNLLIWDRRESKPAVKVMAHSDDVVTLDFNPFSEYILATGSEDKTIGLWDLRNMGGSLKYLRGHEGSIGQLQWSLHKETILASGGSDNKVHLWDLKKTGTSKENTYSEELAFIHAGHCSRVIDFAWNGNEPLMMASVSYDNILQLWQPSEFLKL 1265
            MIE++SN SNSFCKD IRWKKN  FLYD V T+NLTWPSLTVQWMPDIT+LEDKDY  QRIIVGTQ EEEQDYLLIASVTVPNEYKCFESKHYDAEKDEFGGYGLVTAHTDISIKINHDGCINRARYLPQCPNVIATKSSNGNVYLFDYTRHPSKPDQSGKCKPDLVLKGHSQEGFGLSWNIKNAGVLLSSAVDGTIQLWDINCTPENKNDFKVLNSLSQYLGHEGSVEDVCWHKFSDQLFGSVGVDKNLLIWDRRESKPAVKVMAHSDDVVTLDFNPFSEYILATGSEDKTIGLWDLRNMGGSLKYLRGHEGSIGQLQWSLHKETILASGGSDNKVHLWDLKKTGTSKENTYSEELAFIHAGHCSRVIDFAWNGNEPLMMASVSYDNILQLWQPSEFLKL
Sbjct:    1 MIEDISNYSNSFCKDNIRWKKNISFLYDFVKTNNLTWPSLTVQWMPDITKLEDKDYVIQRIIVGTQTEEEQDYLLIASVTVPNEYKCFESKHYDAEKDEFGGYGLVTAHTDISIKINHDGCINRARYLPQCPNVIATKSSNGNVYLFDYTRHPSKPDQSGKCKPDLVLKGHSQEGFGLSWNIKNAGVLLSSAVDGTIQLWDINCTPENKNDFKVLNSLSQYLGHEGSVEDVCWHKFSDQLFGSVGVDKNLLIWDRRESKPAVKVMAHSDDVVTLDFNPFSEYILATGSEDKTIGLWDLRNMGGSLKYLRGHEGSIGQLQWSLHKETILASGGSDNKVHLWDLKKTGTSKENTYSEELAFIHAGHCSRVIDFAWNGNEPLMMASVSYDNILQLWQPSEFLKL 401          
BLAST of retinoblastoma binding protein-1 vs. TrEMBL
Match: A0A2P2IAN4 (Histone-binding protein Caf1 OS=Hirondellea gigas OX=1518452 PE=2 SV=1)

HSP 1 Score: 447.588 bits (1150), Expect = 2.982e-152
Identity = 216/391 (55.24%), Postives = 279/391 (71.36%), Query Frame = 3
Query:  102 KDYIRWKKNTPFLYDLVMTHNLTWPSLTVQWMPDITRLEDKDYSTQRIIVGTQAEEEQDYLLIASVTVPNEYKCFESKHYDAEKDEFGGYGLVTAHTDISIKINHDGCINRARYLPQCPNVIATKSSNGNVYLFDYTRHPSKPDQSGKCKPDLVLKGHSQEGFGLSWNIKNAGVLLSSAVDGTIQLWDINCTPENKNDFKVLNSLSQYLGHEGSVEDVCWHKFSDQLFGSVGVDKNLLIWDRRE---SKPAVKVMAHSDDVVTLDFNPFSEYILATGSEDKTIGLWDLRNMGGSLKYLRGHEGSIGQLQWSLHKETILASGGSDNKVHLWDLKKTGTSKENTYSE----ELAFIHAGHCSRVIDFAWNGNEPLMMASVSYDNILQLWQPSE 1253
            ++Y  WKKNTPFLYDLVMTH L WPSLT QW+PD+TR E KDYS  R+I+GT   +EQ++LLIASV +PNE   F++ HYD EK EFGG+G V+   +I IKINH+G +NRARY+PQ P VIATK+ + +V +FDYT+HPSKPD SG+C PDL L+GH +EG+GLSWN    G LLS++ D TI LWDIN TP+     +V+++ + + GH   VEDV WH   D LFGSV  D+ L+IWD R    +KP+  V AH+ +V  L FNP+SE+ILATGS DKT+ LWDLRN+   L     H+  I Q+QWS H ETILAS G+D ++H+WDL K G  +    +E    EL FIH GH +++ DF+WN NEP ++ SVS DNI+Q+WQ +E
Sbjct:   28 EEYKIWKKNTPFLYDLVMTHALEWPSLTAQWLPDVTRPEGKDYSIHRLILGTHTSDEQNHLLIASVQLPNEDAQFDAAHYDNEKGEFGGFGSVSGKIEIEIKINHEGEVNRARYMPQNPCVIATKTPSSDVLVFDYTKHPSKPDPSGECHPDLRLRGHQKEGYGLSWNPNLNGYLLSASDDHTICLWDINATPKEN---RVIDARTIFTGHTAVVEDVAWHLLHDSLFGSVADDQKLMIWDTRSNNTNKPSHTVDAHTAEVNCLSFNPYSEFILATGSADKTVALWDLRNLKLKLHSFESHKDEIFQVQWSPHNETILASSGTDRRLHVWDLSKIGEDQSTEDAEDGPPELLFIHGGHTAKISDFSWNPNEPWVVCSVSEDNIMQVWQMAE 415          
BLAST of retinoblastoma binding protein-1 vs. TrEMBL
Match: A0A1B6J9A2 (WD_REPEATS_REGION domain-containing protein OS=Homalodisca liturata OX=320908 GN=g.10913 PE=4 SV=1)

HSP 1 Score: 447.203 bits (1149), Expect = 4.133e-152
Identity = 215/391 (54.99%), Postives = 279/391 (71.36%), Query Frame = 3
Query:  102 KDYIRWKKNTPFLYDLVMTHNLTWPSLTVQWMPDITRLEDKDYSTQRIIVGTQAEEEQDYLLIASVTVPNEYKCFESKHYDAEKDEFGGYGLVTAHTDISIKINHDGCINRARYLPQCPNVIATKSSNGNVYLFDYTRHPSKPDQSGKCKPDLVLKGHSQEGFGLSWNIKNAGVLLSSAVDGTIQLWDINCTPENKNDFKVLNSLSQYLGHEGSVEDVCWHKFSDQLFGSVGVDKNLLIWDRRE---SKPAVKVMAHSDDVVTLDFNPFSEYILATGSEDKTIGLWDLRNMGGSLKYLRGHEGSIGQLQWSLHKETILASGGSDNKVHLWDLKKTGTSKENTYSE----ELAFIHAGHCSRVIDFAWNGNEPLMMASVSYDNILQLWQPSE 1253
            ++Y  WKKNTPFLYDLVMTH L WPSLT QW+PD+TR E KDYS  R+I+GT   +EQ++LLIASV +PNE   F++ HYD EK EFGG+G V+   +I IKINH+G +NRARY+PQ P VIATK+ + +V +FDYT+HPSKPD SG+C PDL L+GH +EG+GLSWN    G LLS++ D TI LWDIN TP+     +++++ + + GH   VEDV WH   + LFGSV  D+ L+IWD R    SKP+  V AH+ +V  L FNP+SE+ILATGS DKT+ LWDLRN+   L     H+  I Q+QWS H ETILAS G+D ++H+WDL K G  +    +E    EL FIH GH +++ DF+WN NEP ++ SVS DNI+Q+WQ +E
Sbjct:   20 EEYKIWKKNTPFLYDLVMTHALEWPSLTAQWLPDVTRPEGKDYSVHRLILGTHTSDEQNHLLIASVQLPNEDAQFDASHYDNEKGEFGGFGSVSGKIEIEIKINHEGEVNRARYMPQNPCVIATKTPSSDVLVFDYTKHPSKPDPSGECHPDLRLRGHQKEGYGLSWNPNLNGYLLSASDDHTICLWDINATPKEN---RIIDAKTIFTGHTAVVEDVAWHLLHESLFGSVADDQKLMIWDTRSNNTSKPSHTVDAHTAEVNCLSFNPYSEFILATGSADKTVALWDLRNLKLKLHSFESHKDEIFQVQWSPHNETILASSGTDRRLHVWDLSKIGEEQSTEDAEDGPPELLFIHGGHTAKISDFSWNPNEPWVICSVSEDNIMQVWQMAE 407          
BLAST of retinoblastoma binding protein-1 vs. TrEMBL
Match: A0A1B6LW56 (WD_REPEATS_REGION domain-containing protein OS=Graphocephala atropunctata OX=36148 GN=g.8743 PE=4 SV=1)

HSP 1 Score: 447.203 bits (1149), Expect = 4.133e-152
Identity = 215/391 (54.99%), Postives = 279/391 (71.36%), Query Frame = 3
Query:  102 KDYIRWKKNTPFLYDLVMTHNLTWPSLTVQWMPDITRLEDKDYSTQRIIVGTQAEEEQDYLLIASVTVPNEYKCFESKHYDAEKDEFGGYGLVTAHTDISIKINHDGCINRARYLPQCPNVIATKSSNGNVYLFDYTRHPSKPDQSGKCKPDLVLKGHSQEGFGLSWNIKNAGVLLSSAVDGTIQLWDINCTPENKNDFKVLNSLSQYLGHEGSVEDVCWHKFSDQLFGSVGVDKNLLIWDRRE---SKPAVKVMAHSDDVVTLDFNPFSEYILATGSEDKTIGLWDLRNMGGSLKYLRGHEGSIGQLQWSLHKETILASGGSDNKVHLWDLKKTGTSKENTYSE----ELAFIHAGHCSRVIDFAWNGNEPLMMASVSYDNILQLWQPSE 1253
            ++Y  WKKNTPFLYDLVMTH L WPSLT QW+PD+TR E KDYS  R+I+GT   +EQ++LLIASV +PNE   F++ HYD EK EFGG+G V+   +I IKINH+G +NRARY+PQ P VIATK+ + +V +FDYT+HPSKPD SG+C PDL L+GH +EG+GLSWN    G LLS++ D TI LWDIN TP+     +++++ + + GH   VEDV WH   + LFGSV  D+ L+IWD R    SKP+  V AH+ +V  L FNP+SE+ILATGS DKT+ LWDLRN+   L     H+  I Q+QWS H ETILAS G+D ++H+WDL K G  +    +E    EL FIH GH +++ DF+WN NEP ++ SVS DNI+Q+WQ +E
Sbjct:   20 EEYKIWKKNTPFLYDLVMTHALEWPSLTAQWLPDVTRPEGKDYSVHRLILGTHTSDEQNHLLIASVQLPNEDAQFDASHYDNEKGEFGGFGSVSGKIEIEIKINHEGEVNRARYMPQNPCVIATKTPSSDVLVFDYTKHPSKPDPSGECHPDLRLRGHQKEGYGLSWNPNLNGYLLSASDDHTICLWDINATPKEN---RIIDAKTIFTGHTAVVEDVAWHLLHESLFGSVADDQKLMIWDTRSNNTSKPSHTVDAHTAEVNCLSFNPYSEFILATGSADKTVALWDLRNLKLKLHSFESHKDEIFQVQWSPHNETILASSGTDRRLHVWDLSKIGEEQSTEDAEDGPPELLFIHGGHTAKISDFSWNPNEPWVICSVSEDNIMQVWQMAE 407          
BLAST of retinoblastoma binding protein-1 vs. TrEMBL
Match: A0A1B6F3K3 (WD_REPEATS_REGION domain-containing protein OS=Cuerna arida OX=1464854 GN=g.21480 PE=4 SV=1)

HSP 1 Score: 447.203 bits (1149), Expect = 4.133e-152
Identity = 215/391 (54.99%), Postives = 279/391 (71.36%), Query Frame = 3
Query:  102 KDYIRWKKNTPFLYDLVMTHNLTWPSLTVQWMPDITRLEDKDYSTQRIIVGTQAEEEQDYLLIASVTVPNEYKCFESKHYDAEKDEFGGYGLVTAHTDISIKINHDGCINRARYLPQCPNVIATKSSNGNVYLFDYTRHPSKPDQSGKCKPDLVLKGHSQEGFGLSWNIKNAGVLLSSAVDGTIQLWDINCTPENKNDFKVLNSLSQYLGHEGSVEDVCWHKFSDQLFGSVGVDKNLLIWDRRE---SKPAVKVMAHSDDVVTLDFNPFSEYILATGSEDKTIGLWDLRNMGGSLKYLRGHEGSIGQLQWSLHKETILASGGSDNKVHLWDLKKTGTSKENTYSE----ELAFIHAGHCSRVIDFAWNGNEPLMMASVSYDNILQLWQPSE 1253
            ++Y  WKKNTPFLYDLVMTH L WPSLT QW+PD+TR E KDYS  R+I+GT   +EQ++LLIASV +PNE   F++ HYD EK EFGG+G V+   +I IKINH+G +NRARY+PQ P VIATK+ + +V +FDYT+HPSKPD SG+C PDL L+GH +EG+GLSWN    G LLS++ D TI LWDIN TP+     +++++ + + GH   VEDV WH   + LFGSV  D+ L+IWD R    SKP+  V AH+ +V  L FNP+SE+ILATGS DKT+ LWDLRN+   L     H+  I Q+QWS H ETILAS G+D ++H+WDL K G  +    +E    EL FIH GH +++ DF+WN NEP ++ SVS DNI+Q+WQ +E
Sbjct:   20 EEYKIWKKNTPFLYDLVMTHALEWPSLTAQWLPDVTRPEGKDYSVHRLILGTHTSDEQNHLLIASVQLPNEDAQFDASHYDNEKGEFGGFGSVSGKIEIEIKINHEGEVNRARYMPQNPCVIATKTPSSDVLVFDYTKHPSKPDPSGECHPDLRLRGHQKEGYGLSWNPNLNGYLLSASDDHTICLWDINATPKEN---RIIDAKTIFTGHTAVVEDVAWHLLHESLFGSVADDQKLMIWDTRSNNTSKPSHTVDAHTAEVNCLSFNPYSEFILATGSADKTVALWDLRNLKLKLHSFESHKDEIFQVQWSPHNETILASSGTDRRLHVWDLSKIGEEQSTEDAEDGPPELLFIHGGHTAKISDFSWNPNEPWVICSVSEDNIMQVWQMAE 407          
BLAST of retinoblastoma binding protein-1 vs. Ensembl Cavefish
Match: rbbp4 (RB binding protein 4, chromatin remodeling factor [Source:NCBI gene;Acc:103039809])

HSP 1 Score: 437.958 bits (1125), Expect = 5.868e-152
Identity = 209/391 (53.45%), Postives = 280/391 (71.61%), Query Frame = 3
Query:  102 KDYIRWKKNTPFLYDLVMTHNLTWPSLTVQWMPDITRLEDKDYSTQRIIVGTQAEEEQDYLLIASVTVPNEYKCFESKHYDAEKDEFGGYGLVTAHTDISIKINHDGCINRARYLPQCPNVIATKSSNGNVYLFDYTRHPSKPDQSGKCKPDLVLKGHSQEGFGLSWNIKNAGVLLSSAVDGTIQLWDINCTPENKNDFKVLNSLSQYLGHEGSVEDVCWHKFSDQLFGSVGVDKNLLIWDRRE---SKPAVKVMAHSDDVVTLDFNPFSEYILATGSEDKTIGLWDLRNMGGSLKYLRGHEGSIGQLQWSLHKETILASGGSDNKVHLWDLKKTGTSKENTYSE----ELAFIHAGHCSRVIDFAWNGNEPLMMASVSYDNILQLWQPSE 1253
            ++Y  WKKNTPFLYDLVMTH L WPSLT QW+PD+TR E KDYS  R+++GT   +EQ++L+IASV +PN+   F++ HYD+EK EFGG+G V+   +I IKINH+G +NRARY+PQ P +IATK+   +V +FDYT+HPSKPD SG+C PDL L+GH +EG+GLSWN   +G LLS++ D TI LWDI+  P+   + K++++ + + GH   VEDV WH   + LFGSV  D+ L+IWD R    SKP+  V AH+ +V  L FNP+SE+ILATGS DKT+ LWDLRN+   L     H+  I Q+QWS H ETILAS G+D ++++WDL K G  +    +E    EL FIH GH +++ DF+WN NEP ++ SVS DNI+Q+WQ +E
Sbjct:   19 EEYKIWKKNTPFLYDLVMTHALEWPSLTAQWLPDVTRPEGKDYSVHRLVLGTHTSDEQNHLVIASVQLPNDDAQFDASHYDSEKGEFGGFGSVSGKIEIEIKINHEGEVNRARYMPQNPCIIATKTPTSDVLVFDYTKHPSKPDPSGECTPDLRLRGHQKEGYGLSWNPNLSGCLLSASDDHTICLWDISTVPK---EGKIVDAKTIFTGHTAVVEDVSWHLLHESLFGSVADDQKLMIWDTRSNNTSKPSHAVDAHTAEVNCLSFNPYSEFILATGSADKTVALWDLRNLKLKLHSFESHKDEIFQVQWSPHNETILASSGTDRRLNVWDLSKIGEEQSPEDAEDGPPELLFIHGGHTAKISDFSWNPNEPWVICSVSEDNIMQVWQMAE 406          
BLAST of retinoblastoma binding protein-1 vs. Ensembl Cavefish
Match: rbb4l (histone-binding protein RBBP7 [Source:NCBI gene;Acc:103023991])

HSP 1 Score: 432.565 bits (1111), Expect = 8.961e-150
Identity = 207/392 (52.81%), Postives = 281/392 (71.68%), Query Frame = 3
Query:  102 KDYIRWKKNTPFLYDLVMTHNLTWPSLTVQWMPDITRLEDKDYSTQRIIVGTQAEEEQDYLLIASVTVPNEYKCFESKHYDAEKD-EFGGYGLVTAHTDISIKINHDGCINRARYLPQCPNVIATKSSNGNVYLFDYTRHPSKPDQSGKCKPDLVLKGHSQEGFGLSWNIKNAGVLLSSAVDGTIQLWDINCTPENKNDFKVLNSLSQYLGHEGSVEDVCWHKFSDQLFGSVGVDKNLLIWDRRE---SKPAVKVMAHSDDVVTLDFNPFSEYILATGSEDKTIGLWDLRNMGGSLKYLRGHEGSIGQLQWSLHKETILASGGSDNKVHLWDLKKTGTSKENTYSE----ELAFIHAGHCSRVIDFAWNGNEPLMMASVSYDNILQLWQPSE 1253
            ++Y  WKKNTPFLYDLVMTH L WPSLTVQW+PD+ R E KDY+  R+++GT   +EQ++L+IASV +PN+   F++ HYD+EK  EFGG+G V+   +I IKINH+G +NRARY+PQ P +IATK+   +V +FDYT+HPSKPD SG+C PDL L+GH +EG+GLSWN   +G LLS++ D TI LWDI+ +P+   + K++++ + + GH   VEDV WH   + LFGSV  D+ L+IWD R    +KP+  V AH+ +V  L FNP+SE+ILATGS DKT+ LWDLRN+   L     H+  I Q+QWS H ETILAS G+D ++++WDL K G  +    +E    EL FIH GH +++ DF+WN NEP ++ SVS DNI+Q+WQ +E
Sbjct:   18 EEYKIWKKNTPFLYDLVMTHALEWPSLTVQWLPDVNRPEGKDYAVHRLVLGTHTSDEQNHLVIASVQIPNDDAQFDASHYDSEKGAEFGGFGSVSGKIEIEIKINHEGEVNRARYMPQNPCIIATKTPTSDVLVFDYTKHPSKPDPSGECSPDLRLRGHQKEGYGLSWNPNLSGNLLSASDDHTICLWDISGSPK---EGKIVDAKTIFTGHTAVVEDVSWHLLHESLFGSVADDQKLMIWDTRSNNTAKPSHAVDAHTAEVNCLSFNPYSEFILATGSADKTVALWDLRNLKLKLHSFESHKDEIFQVQWSPHNETILASSGTDRRLNVWDLSKIGEEQSAEDAEDGPPELLFIHGGHTAKISDFSWNPNEPWVICSVSEDNIMQVWQMAE 406          
BLAST of retinoblastoma binding protein-1 vs. Ensembl Cavefish
Match: pex7 (peroxisomal biogenesis factor 7 [Source:NCBI gene;Acc:103024267])

HSP 1 Score: 98.9821 bits (245), Expect = 8.685e-23
Identity = 83/346 (23.99%), Postives = 149/346 (43.06%), Query Frame = 3
Query:  252 GTQAEEEQDYLLIASVTVPNEYKCFESKHYDAEKDEFGGYG----LVTAHTDISIKIN---HDGCINRARYLPQCPNVIATKSSNGNVYLFDYTRHPSKPDQSGKCKPDLVLKGHSQEGFGLSWN-IKNAGVLLSSAVDGTIQLWDINCTPENKNDFKVLNSLSQYLGHEGSVEDVCWHKFSDQLFGSVGVDKNLLIWDRRESKPAVKVMAHSDDVVTLDFNPFSEYILATGSEDKTIGLWDLRNMGGSLKYLRGHEGSIGQLQWSLHKETILASGGSDNKVHLWDLKKTGTSKENTYSEELAFIHAGHCSRVIDFAWNGNEPLMMASVSYDNILQLWQPSEFLKL 1265
            G +      Y +  S  +PN   C  +++Y        G G    L    TD+ +  +   +DG  +   +     +V+ T   +G++ ++D T +P  P Q        VLK H+QE + + W+  +   +++S + D T ++WD    PE         S+    GHEG +    W       F S   D  L +WD +     + + AH  ++++ D+  + + IL TGS D ++ +WDLR +   +  +  H  +I ++++S   +T+LAS   D  V  WD  +         S  L      H   V    +N + P  +   S+D  ++++ P  F  L
Sbjct:    3 GFRCSARHGYAVEVSPFLPNRLACATAQYYG-----IAGCGTLFVLEQRETDVQLLRSFDWNDGLFD-VTWSESNEHVLVTGGGDGSLQIWD-TANPKGPIQ--------VLKEHTQEVYSVDWSQTRGENLVVSGSWDHTAKVWD----PER------FQSVCTLQGHEGVLYSTIWSPHISSCFASASGDGTLRVWDVKSGSCRMAIPAHKTEILSCDWCKYDQNILVTGSVDCSLCVWDLRTVRQPVAQMLSHTYAIRRVKFSPFYKTVLASCSYDFTVRFWDYSR---------SPMLLDAMEHHSEFVCGLDFNLHIPNQVVDCSWDETIKIYTPPCFAAL 314          
BLAST of retinoblastoma binding protein-1 vs. Ensembl Cavefish
Match: grwd1 (glutamate rich WD repeat containing 1 [Source:NCBI gene;Acc:103032799])

HSP 1 Score: 89.7373 bits (221), Expect = 3.914e-19
Identity = 74/299 (24.75%), Postives = 130/299 (43.48%), Query Frame = 3
Query:  408 INHDGCINRARYLPQCPNVIATK-SSNGNVYLFDYTRH----------PSKPDQSGKCKPDLVLKGHSQEGFGLSWNIKNAGVLLSSAVDGTIQLWDINCTPENKNDFKVLNSLSQYLGHEGSVEDVCWHKFSDQLFGSVGVDKNLLIWDRRESKPAVKVM--AHSDDVVTLDFNPFSEYILATGSEDKTIGLWDLRNM--GGSLKYLRGHEGSIGQLQWSLHKETILASGGSDNKVHLWDLKKTGTSKENTYSE------ELAFIHAGHCSRVIDFAWNGNEP--LMMASVSYDNILQ 1235
            + H G INR R   +    +A   S  G V +FD               +   Q+ +  P     GH  EGF + W+ K  G L+S      I +W+     E    +++      +  H  SVED+ W      +F S  VD+++ +WD R    ++  +  AHS DV  + +N  +E  L +G +D  + +WDLR    G ++   + H   +  ++W+    ++ A+ G+D+ V  WDL           ++      +L F+H G  + V +  W+   P  L+  ++S  N+ +
Sbjct:  160 VPHYGGINRVRVTRRGEQSLAAVWSEKGQVEIFDLRPQLEAVYNSSVMAAFIKQNKEITPLFSFSGHMAEGFAVDWSPKVPGRLVSGDCKKNIHVWEPR---EGGVSWQI--DQRPFSSHTKSVEDLQWSPTEATVFASCSVDQSIRVWDIRAPPNSMLSVNEAHSSDVNVISWN-RTEPFLLSGGDDGLLKVWDLRQFKSGRAVASFKQHSAPVTSVEWNPVDSSVFAAAGADDVVSQWDLSVESCDMGERANDVKDLPPQLLFLHQGQ-TEVKELHWHPQLPGTLISTALSGFNVFR 451          

HSP 2 Score: 55.8398 bits (133), Expect = 4.111e-8
Identity = 39/152 (25.66%), Postives = 65/152 (42.76%), Query Frame = 3
Query:  813 LIWDRRESKPAVKVMAHSDDVVTLDFNPFSEYILATGSEDKTIGLWDLRNMGGS----LKYLRGHEGSIGQLQWSLHKETILASGGSDNKVHLWDLKKTGTSKENTYSEELAFIHAGHCSRVIDFAWNGNEPLMMASVSYDNILQLWQPSEF 1256
             I   +E  P      H  +   +D++P     L +G   K I +W+ R  G S     +    H  S+  LQWS  + T+ AS   D  + +WD++    S        +  ++  H S V   +WN  EP ++ S   D +L++W   +F
Sbjct:  210 FIKQNKEITPLFSFSGHMAEGFAVDWSPKVPGRLVSGDCKKNIHVWEPREGGVSWQIDQRPFSSHTKSVEDLQWSPTEATVFASCSVDQSIRVWDIRAPPNS--------MLSVNEAHSSDVNVISWNRTEPFLL-SGGDDGLLKVWDLRQF 352          
BLAST of retinoblastoma binding protein-1 vs. Ensembl Cavefish
Match: taf5 (TATA-box binding protein associated factor 5 [Source:NCBI gene;Acc:103038729])

HSP 1 Score: 89.7373 bits (221), Expect = 7.856e-19
Identity = 76/237 (32.07%), Postives = 115/237 (48.52%), Query Frame = 3
Query:  537 SGKCKPDLVLKGHSQEGFGLSWNIKNAGVLLSSAVDGTIQLWDINCTPENKNDFKVLNSLSQYLGHEGSVEDVCWHKFSDQLFGSVGVDKNLLIWDRRESKPAVKVMAHSDDVVTLDFNPFSEYILATGSEDKTIGLWDLRNMGGSLKYLRGHEGSIGQLQWSLHKETILASGGSDNKVHLWDLKKTGTSKENTYSEELAFIHAGHCSRV--IDFAWNGNEPLMMASVSYDNILQLW 1241
            + +CK   +L GHS   +G+S++  +   LLSS+ DGTI+LW +          +    L  Y GH   V D  +  +    F S G D+   +W     +P      H  D+    F+P S Y+ ATGS D+TI LWD+ N G  ++ L GH+G I  L +S + +  LASG +D +V LWD+       E            GH   +  + F+ +G    ++AS S DN ++LW
Sbjct:  461 ASECK---ILYGHSGPVYGVSFS-PDRNYLLSSSEDGTIRLWSL----------QTFTCLVAYKGHNYPVWDTQFSPYG-YYFVSGGHDRVARLWATDHYQPLRMFAGHLADITCTRFHPNSNYV-ATGSADRTIRLWDVLN-GHCVRVLTGHKGPIHSLAFSPNGK-YLASGSTDGRVLLWDIGHGLMIGE----------LKGHTDTIYALRFSRDGE---ILASGSMDNTVRLW 666          
BLAST of retinoblastoma binding protein-1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008002.1 (pep scaffold:Pmarinus_7.0:GL477852:421:9512:1 gene:ENSPMAG00000007189.1 transcript:ENSPMAT00000008002.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 431.409 bits (1108), Expect = 5.003e-150
Identity = 207/391 (52.94%), Postives = 274/391 (70.08%), Query Frame = 3
Query:  102 KDYIRWKKNTPFLYDLVMTHNLTWPSLTVQWMPDITRLEDKDYSTQRIIVGTQAEEEQDYLLIASVTVPNEYKCFESKHYDAEKDEFGGYGLVTAHTDISIKINHDGCINRARYLPQCPNVIATKSSNGNVYLFDYTRHPSKPDQSGKCKPDLVLKGHSQEGFGLSWNIKNAGVLLSSAVDGTIQLWDINCTPENKNDFKVLNSLSQYLGHEGSVEDVCWHKFSDQLFGSVGVDKNLLIWDRRE---SKPAVKVMAHSDDVVTLDFNPFSEYILATGSEDKTIGLWDLRNMGGSLKYLRGHEGSIGQLQWSLHKETILASGGSDNKVHLWDLKKTGTSKENTYSE----ELAFIHAGHCSRVIDFAWNGNEPLMMASVSYDNILQLWQPSE 1253
            ++Y  WKKNTPFLYDLVMTH L WPSLT QW+PD+TR E KDYS  R+I+GT   +EQ++L+IASV +PN+   F++ HYD+EK EFGG+G V    ++ IKINH+G +NRARY+PQ P +IATK+    V +FDYT+HPS PD SG+C PDL L+GH +EG+GLSWN   +G LLS++ D T+ LWDI+ TP    + KV+ + + + GH   VEDV WH   + LFGSV  D+ L+IWD R    SKP+  V AH+ +V  L FNP+SE+ILATGS D+T+ LWDLRN+   L     H   I Q+QWS H ETILAS G+D ++++WDL K G  +     E    EL F+H GH +++ DF+WN NEP ++ SVS DNI+Q+WQ +E
Sbjct:   19 EEYKIWKKNTPFLYDLVMTHALEWPSLTAQWLPDVTRPEGKDYSVHRLILGTHTSDEQNHLVIASVQLPNDDAQFDASHYDSEKGEFGGFGSVGTKIEVEIKINHEGEVNRARYMPQNPYIIATKTPTSEVLVFDYTKHPSVPDPSGECNPDLRLRGHQKEGYGLSWNPNLSGHLLSASDDHTVCLWDISGTPR---EGKVVEAKTIFTGHTAVVEDVSWHLLHESLFGSVADDQKLMIWDTRSNNTSKPSHSVDAHTAEVNCLSFNPYSEFILATGSADQTVALWDLRNLKLKLHSFESHRDEIFQVQWSPHNETILASSGTDRRLNVWDLSKIGEEQAAEDVEDGPPELLFVHGGHTAKISDFSWNPNEPWVICSVSEDNIMQVWQMAE 406          
BLAST of retinoblastoma binding protein-1 vs. Ensembl Sea Lamprey
Match: pex7 (peroxisomal biogenesis factor 7 [Source:ZFIN;Acc:ZDB-GENE-050320-105])

HSP 1 Score: 95.5153 bits (236), Expect = 2.796e-22
Identity = 61/213 (28.64%), Postives = 109/213 (51.17%), Query Frame = 3
Query:  459 NVIATKSSNGNVYLFDYTRHPSKPDQSGKCKPDLVLKGHSQEGFGLSWN-IKNAGVLLSSAVDGTIQLWDINCTPENKNDFKVLNSLSQYLGHEGSVEDVCWHKFSDQLFGSVGVDKNLLIWDRRESKPA-VKVMAHSDDVVTLDFNPFSEYILATGSEDKTIGLWDLRNMGGSLKYLRGHEGSIGQLQWSLHKETILASGGSDNKVHLWDLK 1091
            +V+ T S +G++ L+D     S+P+      P  V +GH++E + + W+  +   +++S + D T ++WD             L+SL++Y GHEG V    W       F S   D+ L +WD +    A + + AH ++V++ D+  + + +L + + D  I  WDLRN+   +  L GH  +I +++ S  + T+LAS   D  V  WD +
Sbjct:   81 HVLVTGSGDGSLQLWD----ASQPE-----GPLRVYQGHTKEVYSVDWSQTRGENLVVSGSWDHTARVWDP----------AFLSSLAEYRGHEGVVYSTVWSPHIPSCFASASGDQTLRVWDVKSPHAARIVIPAHQEEVLSCDWCKYDQNLLVSAAVDCGIRGWDLRNIRQPVFSLLGHSYAIRRVRCSPFQPTVLASCSYDFSVRFWDFQ 274          

HSP 2 Score: 59.3066 bits (142), Expect = 4.540e-10
Identity = 40/158 (25.32%), Postives = 70/158 (44.30%), Query Frame = 3
Query:  771 SDQLFGSVGVDKNLLIWDRRESKPAVKVMAHSDDVVTLDFNPFSEYILATGSEDKTIGLWDLRNMGGSLKYLRGHEGSIGQLQWSLHK-ETILASGGSDNKVHLWDLKKTGTSKENTYSEELAFIHAGHCSRVIDFAWNGNEPLMMASVSYDNILQLW 1241
            + Q FG  G    L++    E    ++    +D +  + ++  +E++L TGS D ++ LWD     G L+  +GH   +  + WS  + E ++ SG  D+   +WD     +  E          + GH   V    W+ + P   AS S D  L++W
Sbjct:   36 ASQYFGIAGSGSLLILHQTPEGITELRRFEWNDSLFDVAWSEDNEHVLVTGSGDGSLQLWDASQPEGPLRVYQGHTKEVYSVDWSQTRGENLVVSGSWDHTARVWDPAFLSSLAE----------YRGHEGVVYSTVWSPHIPSCFASASGDQTLRVW 183          

HSP 3 Score: 58.9214 bits (141), Expect = 5.490e-10
Identity = 41/169 (24.26%), Postives = 79/169 (46.75%), Query Frame = 3
Query:  741 SVEDVCWHKFSDQLFGSVGVDKNLLIWDRRESKPAVKV-MAHSDDVVTLDFNPF-SEYILATGSEDKTIGLWDLRNMGGSLKYLRGHEGSIGQLQWSLHKETILASGGSDNKVHLWDLKKTGTSKENTYSEELAFIHAGHCSRVIDFAWNGNEPLMMASVSYDNILQLW 1241
            S+ DV W + ++ +  +   D +L +WD  + +  ++V   H+ +V ++D++    E ++ +GS D T  +WD   +  SL   RGHEG +    WS H  +  AS   D  + +WD+K    ++          +   H   V+   W   +  ++ S + D  ++ W
Sbjct:   69 SLFDVAWSEDNEHVLVTGSGDGSLQLWDASQPEGPLRVYQGHTKEVYSVDWSQTRGENLVVSGSWDHTARVWDPAFL-SSLAEYRGHEGVVYSTVWSPHIPSCFASASGDQTLRVWDVKSPHAAR---------IVIPAHQEEVLSCDWCKYDQNLLVSAAVDCGIRGW 227          
BLAST of retinoblastoma binding protein-1 vs. Ensembl Sea Lamprey
Match: pwp1 (PWP1 homolog, endonuclein [Source:ZFIN;Acc:ZDB-GENE-040426-1049])

HSP 1 Score: 72.7886 bits (177), Expect = 1.262e-14
Identity = 56/211 (26.54%), Postives = 97/211 (45.97%), Query Frame = 3
Query:  567 KGHSQEGFGLSWNIKNAGVLLSSAVDGTIQLWDINCTPENKNDFKVLNSLSQYLGHEGSVEDVCWHKFSDQLFGSVGVDKNLLIWDRRESKPAVKVMAHSDDVVTLDFNPFSEYILATGSEDKTIGLWDLRNMGGSLKYLRGHEGSIGQLQWSLHKETILASGGSDNKVHLWDLKKTGTSKENTYSEELAFIHAGHCS--RVIDFAWNGNE 1193
            +GH+     LSWN     VL S++ D T+ LWD+          KV  +L Q+     +VE   WH F  Q   S   DK+++++D R    + ++   S +V  + +N FS +     ++D  +   D R+   S+  L+ HE ++  L  S   +  L +  +D  V +WD+     S  ++   ++  I+ G CS      FA+ G +
Sbjct:   59 EGHTDAVLDLSWNHNARNVLASASADHTVILWDL-------VQGKVATTLEQHTDKAQTVE---WHPFEAQTLISGSYDKSVVLYDCRSPSDSHRMWRFSGEVERVTWNHFSPFHFLASTDDGFVYCLDARS-DKSVFTLQAHEEAVTGLVLSSQVKGCLVTSSADKHVKVWDILANKPSLVHSRDMKMGIIYCGSCSPDSPFTFAFGGQK 258          

HSP 2 Score: 52.7582 bits (125), Expect = 5.304e-8
Identity = 54/229 (23.58%), Postives = 93/229 (40.61%), Query Frame = 3
Query:  459 NVIATKSSNGNVYLFDYTRHPSKPDQSGKCKPDLVLKGHSQEGFGLSWNIKNAGVLLSSAVDGTIQLWDINCTPENKNDFKVLNSLSQYLGHEGSVEDVCWHKFSDQLFGSVGVDKNLLIWDRRESKPAVKVMAHSDDVVTLDFNPFSEYILATGSEDKTIGLWDLRNMGGSLKYLRGHE-GSIGQLQWSLHKETILASGGSDNKVHLWDLKKTGTSKENTYSEELAFI 1142
            NV+A+ S++  V L+D  +        GK      L+ H+ +   + W+   A  L+S + D ++ L+D     ++   ++            G VE V W+ FS   F +   D  +   D R  K    + AH + V  L  +   +  L T S DK + +WD+     SL + R  + G I     S       A GG  + + +WD+    + +    S E   +
Sbjct:   76 NVLASASADHTVILWDLVQ--------GKVA--TTLEQHTDKAQTVEWHPFEAQTLISGSYDKSVVLYDCRSPSDSHRMWRF----------SGEVERVTWNHFSPFHFLASTDDGFVYCLDARSDKSVFTLQAHEEAVTGLVLSSQVKGCLVTSSADKHVKVWDILANKPSLVHSRDMKMGIIYCGSCSPDSPFTFAFGGQKDGLRVWDITNVKSVQTAFGSRERLLV 284          
BLAST of retinoblastoma binding protein-1 vs. Ensembl Sea Lamprey
Match: taf5l (TAF5-like RNA polymerase II, p300/CBP-associated factor (PCAF)-associated factor [Source:ZFIN;Acc:ZDB-GENE-030131-5987])

HSP 1 Score: 71.2478 bits (173), Expect = 1.223e-13
Identity = 62/227 (27.31%), Postives = 102/227 (44.93%), Query Frame = 3
Query:  564 LKGHSQEGFGLSWNIKNAGVLLSSAVDGTIQLWDINCTPENKNDFKVLNSLSQYLGHEGSVEDVCWHKFSDQLFGSVGVDKNLLIWDRRESKPAVKVMAHSDDVVTLDFNPFSEYILATGSEDKTIGLWDLRNMGGSLKYLRGHEGSIGQLQWSLHKETILASGGSDNKVHLWDLKKTGTSKE-NTYSEELAFIHAGHCSRVIDFAWNGNEPLMMASVSYDNILQLW 1241
            L+ HS   + + +    AG LLS + D +++ WD           +   + + Y GH   V DV         F S   D+   +W    + P      H  DV  + F+P   Y+ ATGS D+T+ LW  +  G + +   GH G++  L +S     +LASGG D +V LWD+      KE   +S+++           + F+ +G+    +AS S D  +++W
Sbjct:  339 LRAHSGPVYAVRFLPGGAG-LLSCSEDASVRFWDP----------RTFTNTAVYQGHAYPVWDVDVSALG-LYFCSGSHDRTARLWVPERAFPLRVYAGHVSDVNVVRFHPNGSYV-ATGSADRTVRLWSAQQ-GSAARLFTGHRGAVLALAFSPGGR-LLASGGEDQRVRLWDIGSGAIVKELRGHSDDIT---------CLSFSPDGSA---LASGSSDGSVRVW 538          

HSP 2 Score: 68.1662 bits (165), Expect = 1.426e-12
Identity = 64/241 (26.56%), Postives = 105/241 (43.57%), Query Frame = 3
Query:  390 TDISIKINHDGCINRARYLPQCPNVIATKSSNGNVYLFDYTRHPSKPDQSGKCKPDLVLKGHSQEGFGLSWNIKNAGVLL---SSAVDGTIQLWDINCTPENKNDFKVLNSLSQYLGHEGSVEDVCWHKFSDQLFGSVGVDKNLLIWDRRESKPAVKVMAHSDDVVTLDFNPFSEYILATGSEDKTIGLWDLRNMGGSLKYLRGHEGSIGQLQWSLHKETILASGGSDNKVHLWDLKKTGT 1103
            +D+     H G +   R+LP    +++  S + +V  +D    P     +       V +GH+       W++  + + L   S + D T +LW     PE     +V      Y GH   V  V +H  +     +   D+ + +W  ++   A     H   V+ L F+P    +LA+G ED+ + LWD+   G  +K LRGH   I  L +S    + LASG SD  V +WD++   T
Sbjct:  334 SDVKTLRAHSGPVYAVRFLPGGAGLLSC-SEDASVRFWD----PRTFTNTA------VYQGHAYP----VWDVDVSALGLYFCSGSHDRTARLW----VPERAFPLRV------YAGHVSDVNVVRFHP-NGSYVATGSADRTVRLWSAQQGSAARLFTGHRGAVLALAFSPGGR-LLASGGEDQRVRLWDI-GSGAIVKELRGHSDDITCLSFS-PDGSALASGSSDGSVRVWDVRGAST 545          
BLAST of retinoblastoma binding protein-1 vs. Ensembl Sea Lamprey
Match: snrnp40 (small nuclear ribonucleoprotein 40 (U5) [Source:ZFIN;Acc:ZDB-GENE-040426-978])

HSP 1 Score: 69.707 bits (169), Expect = 2.170e-13
Identity = 52/221 (23.53%), Postives = 103/221 (46.61%), Query Frame = 3
Query:  564 LKGHSQEGFGLSWNIKNAGVLLSSAVDGTIQLWDINCTPENKNDFKVLNSLSQYLGHEGSVEDVCWHKFSDQLFGSVGVDKNLLIWDRRESKPAVKVMAHSDDVVTLDFNPFSEYILATGSEDKTIGLWDLRNMGGSLKYLRGHEGSIGQLQWSL------HKETILASGGSDNKVHLWDLKKTGTSKENTYSEELAFIHAGHCSRVIDFAWNGNEPLMMA 1208
            LKGH+          +   ++ +++ DGT++LWD       K       +  Q L        V ++  SDQ+  S G+D  + +WD R++K    +  H+D V  L  +P   Y+L+  + D ++ +WD+R      + ++  +G++   + +L      H  + +++G +D  V++WD          T S  + +   GH   V D A++  EP++++
Sbjct:  138 LKGHTSFVNACFPARRGPQMVCTASDDGTVKLWDT----RKKGSVHSFQNTYQCL-------SVTFNDTSDQIL-SGGIDNVIKVWDLRQNKLIYTMKGHNDSVTGLSLSPDGSYLLSN-AMDNSVRIWDIRPFAPMERCVKIFQGNVHNFEKNLLKCSWSHDGSKVSAGSADRFVYIWD----------TTSRRILYKLPGHAGSVNDVAFHPEEPIVLS 335          

HSP 2 Score: 54.6842 bits (130), Expect = 1.436e-8
Identity = 40/143 (27.97%), Postives = 67/143 (46.85%), Query Frame = 3
Query:  702 VLNSLSQYLGHEGSVEDVCWHKFSDQLFGSVGVDKNLLIWD-RRESKPAVKVMAHSDDVVTLDFNPFSEYILATGSEDKTIGLWDLRNMGGSLKYLRGHEGSIGQLQWSLHKETILASGGSDNKVHLWDLKKTGT--SKENTY 1121
            +L  +    GHEG V    +H   + L  S G D+ +L+W+   +      +  H+  ++ + ++     I  T S DKT+GLWD    G  +K L+GH   +     +     ++ +   D  V LWD +K G+  S +NTY
Sbjct:   46 LLAPIMLLTGHEGEVYCCKFHPNGNTL-ASAGFDRTILMWNVYGDCDNYAHLKGHTGAILDIHYSTDGSTIF-TSSTDKTVGLWD-SETGERIKRLKGHTSFVNACFPARRGPQMVCTASDDGTVKLWDTRKKGSVHSFQNTY 185          

HSP 3 Score: 46.595 bits (109), Expect = 7.090e-6
Identity = 36/134 (26.87%), Postives = 62/134 (46.27%), Query Frame = 3
Query:  840 PAVKVMAHSDDVVTLDFNPFSEYILATGSEDKTIGLWDLRNMGGSLKYLRGHEGSIGQLQWSLHKETILASGGSDNKVHLWDLKKTGTSKENTYSEELAFIHAGHCSRVIDFAWNGNEPLMMASVSYDNILQLW 1241
            P + +  H  +V    F+P     LA+   D+TI +W++     +  +L+GH G+I  + +S    TI  S  +D  V LWD  +TG  +        +F++A   +R          P M+ + S D  ++LW
Sbjct:   49 PIMLLTGHEGEVYCCKFHPNGN-TLASAGFDRTILMWNVYGDCDNYAHLKGHTGAILDIHYSTDGSTIFTS-STDKTVGLWD-SETG-ERIKRLKGHTSFVNACFPAR--------RGPQMVCTASDDGTVKLW 170          
BLAST of retinoblastoma binding protein-1 vs. Ensembl Yeast
Match: HAT2 (Subunit of the Hat1p-Hat2p histone acetyltransferase complex; required for high affinity binding of the complex to free histone H4, thereby enhancing Hat1p activity; similar to human RbAp46 and 48; has a role in telomeric silencing [Source:SGD;Acc:S000000782])

HSP 1 Score: 224.942 bits (572), Expect = 4.472e-70
Identity = 138/396 (34.85%), Postives = 205/396 (51.77%), Query Frame = 3
Query:   93 SFCKDYIRWKKNTPFLYDLVMTHNLTWPSLTVQWMPDITRLEDKDYSTQRIIVGTQAE-EEQDYLLIASVTVPNEYKCFESKHYDAEKDEFGGYGLVTAHTDISIKINHDGCINRARYLPQCPNVIATKSSNGNVYLFDYTRHPSKPDQSGKCKPDLVLKGHSQEGFGLSWNIKNAGVLLSSAVDGTIQLWDINCTPENKNDFKVLNSLSQYLGHEGSVEDVCWHKFSDQLFGSVGVDKNLLIWDRRESKPAVKVMAHSDDVVTLDFNPFSEYILATGSEDKTIGLWDLRNMGGSLKYLRGHEGSIGQLQWSLHKETILASGGSDNKVHLWDLKKTGTSKENTYSE----ELAFIHAGHCSRVIDFAWNGNEPLMMASVSYDNILQLWQPSEFLKL 1265
            S  ++Y  WK N P +YD V    LTWPSLTVQW+P   +  D  +  Q +I+GT    EE++YL  A + +P E    E    +A ++         ++  I+ K  H+  I RARY+PQ PN++AT +  G V+L  Y+R  S+  QS        LK H   G+ LS++    G LLS + D T+ LW++    +     +  N L     H   + D  WH F+  LFG+V  D  L I D R +   +  +       TL F+  S  +LA    D  + L+DLRNM   L ++ GHE ++  L++S H + ++ S GSDN++ +WDLK+ G  +    +E    EL  +HAGH S V DF  N   P ++AS   +NILQ+W+ S  L +
Sbjct:    9 SVDEEYDLWKSNVPLMYDFVSETRLTWPSLTVQWLPTPVQELDGGFIKQELIIGTHTSGEEENYLKFAEINLPKEILSNEDPQEEAGEEYQSSLPAPRSNIRITAKYEHEEEITRARYMPQDPNIVATINGQGTVFL--YSR--SEGLQS-------TLKFHKDNGYALSFSTLVKGRLLSGSDDHTVALWEVGSGGDPTKPVRTWNDL-----HSDIINDNKWHNFNKDLFGTVSEDSLLKINDVRANNTTIDTVKCPQPFNTLAFSHHSSNLLAAAGMDSYVYLYDLRNMKEPLHHMSGHEDAVNNLEFSTHVDGVVVSSGSDNRLMMWDLKQIGAEQTPDDAEDGVPELIMVHAGHRSSVNDFDLNPQIPWLVASAEEENILQVWKCSHSLPI 388          
BLAST of retinoblastoma binding protein-1 vs. Ensembl Yeast
Match: MSI1 (Subunit of chromatin assembly factor I (CAF-1); chromatin assembly by CAF-1 affects multiple processes including silencing at telomeres, mating type loci, and rDNA; maintenance of kinetochore structure; deactivation of DNA damage checkpoint after DNA repair; chromatin dynamics during transcription; and repression of divergent noncoding transcription; Msi1p localizes to nucleus and cytoplasm and independently regulates the RAS/cAMP pathway via sequestration of Npr1p kinase [Source:SGD;Acc:S000000399])

HSP 1 Score: 176.792 bits (447), Expect = 2.017e-51
Identity = 125/411 (30.41%), Postives = 196/411 (47.69%), Query Frame = 3
Query:  108 YIRWKKNTPFLYDLVMTHNLTWPSLTVQWMPDITRLEDKDYSTQRIIVG---TQAEEEQDYLLIASVTVPNEYKCFESKHYDAEKDEF---GGYGLVTAH--TDISIKINHDGCINRARYLPQCPNVIATKSSNGNVYLFDYTRHPSKPDQSGKCKPDLVLK------------------GHSQEGFGLSWNIKNAGVLLSSAVDGTIQLWDINCTPENKNDFKVLNSLSQYLGHEGS-VEDVCWHKFSDQLFGSVGVDKNLLIWDRRESKPAVKV--MAHSDDVVTLDFNPFSEYILATGSEDKTIGLWDLRNMGGSLKYLRGHEGSIGQLQWSLHKETILASGGS-DNKVHLWDLKKTGTSKENTYSEELAFIHAGHCSRVIDFAWNGNEPLMMASVSYDNILQLWQPS 1250
            Y  WKKNT  LYD + T++  WPSLT Q+ PD+    D+     RI++    +  + E + + I+ ++     K     ++D ++ EF         + H   DISI   +  C NRARYLPQ P++IA  SS+G +Y+FD T+H S   +  K       K                      E   L+WN++   +LLSS  +G +Q+WDI    +  ++  +++     +  +G+ V DV W    D LF +      + + D R  K  ++     H   V +  FN  +  ILA+   +  + LWD+RNM  S      H  S+  L+WS + +T+LA+ G  D  V LWD          T  EE  F H GH   V D +W+ ++P +M SV+ DN + +W+P+
Sbjct:   23 YSHWKKNTKLLYDYLNTNSTKWPSLTCQFFPDLDTTSDE----HRILLSSFTSSQKPEDETIYISKISTLGHIKWSSLNNFDMDEMEFKPENSTRFPSKHLVNDISIFFPNGEC-NRARYLPQNPDIIAGASSDGAIYIFDRTKHGSTRIRQSKISHPFETKLFGSHGVIQDVEAMDTSSADINEATSLAWNLQQEALLLSSHSNGQVQVWDIK---QYSHENPIIDLPLVSINSDGTAVNDVTWMPTHDSLFAACTEGNAVSLLDLRTKKEKLQSNREKHDGGVNSCRFNYKNSLILASADSNGRLNLWDIRNMNKSPIATMEHGTSVSTLEWSPNFDTVLATAGQEDGLVKLWD----------TSCEETIFTHGGHMLGVNDISWDAHDPWLMCSVANDNSVHIWKPA 415          
BLAST of retinoblastoma binding protein-1 vs. Ensembl Yeast
Match: RRB1 (Specific chaperone for ribosomal protein Rpl3p; binds to nascent Rpl3p during translation; essential gene [Source:SGD;Acc:S000004738])

HSP 1 Score: 104.76 bits (260), Expect = 7.145e-25
Identity = 106/409 (25.92%), Postives = 182/409 (44.50%), Query Frame = 3
Query:  132 PFLYDLVMTHNLTWPSLTVQWMPDITRLEDKDYSTQRIIVGTQAE----EEQDYLLIASVTVPNEYKCFESKHYDAEKDEFGGYGLVTAHTDISIKINHDGCINRARYLPQCPN----VIATKSSNGNVYLFDYTRH------PSKPDQSGKCKPDLVLKGHSQ-EGFGLSWN-IKNAGVLLSSAVDGTIQLWDINCTP--ENKNDFKVLNSLSQYLGHEGSVEDVCWHKFSDQLFGSVGVDKNLLIWDRRESK--PAVKVMAHSDDVVTLDFNPFSEYILATGSEDKTIGLWDLRNMGGS-------LKYLRGHEGSIGQLQWSLHKETILASGGSDNKVHLWDL----------KKTGTSKE-NTYSEELAFIHAGHCSRVIDFAWNGNEPLMMASVSYDNILQLWQ 1244
            P +Y+++   N+ WP LT+  +PD    E ++Y  Q I++ T  +    +E + +++A   +       +++  D E+D+      V  + +I ++       NR +  P   +    + AT S NG+VY+++          P         +P   +K H   EG+GL W+ +   G LLS    G I     + +    +K  F V N+         S+ED+ W +    +F + G D  + IWD R  K  PA+ V A + DV  + ++    Y+LA+G ++ T G+WDLR    S       +     H+G+I  + ++   E+I+A G  DN V LWDL          ++   +KE      +L F+H      V D  W+   P  + S   D  L +W+
Sbjct:  115 PTVYEMLHNVNMPWPCLTLDVIPDTLGSERRNYP-QSILLTTATQSSRKKENELMVLALSNLAKTLLKDDNEGEDDEEDDEDDVDPVIENENIPLR----DTTNRLKVSPFAISNQEVLTATMSENGDVYIYNLAPQSKAFSTPGYQIPKSAKRPIHTVKNHGNVEGYGLDWSPLIKTGALLSGDCSGQIYFTQRHTSRWVTDKQPFTVSNN--------KSIEDIQWSRTESTVFATAGCDGYIRIWDTRSKKHKPAISVKASNTDVNVISWSDKIGYLLASGDDNGTWGVWDLRQFTPSNADAVQPVAQYDFHKGAITSIAFNPLDESIVAVGSEDNTVTLWDLSVEADDEEIKQQAAETKELQEIPPQLLFVHWQK--EVKDVKWHKQIPGCLVSTGTDG-LNVWK 507          
BLAST of retinoblastoma binding protein-1 vs. Ensembl Yeast
Match: YPL247C_mRNA (Putative protein of unknown function; green fluorescent protein (GFP)-fusion protein localizes to the cytoplasm and nucleus; similar to the petunia WD repeat protein an11; overexpression causes a cell cycle delay or arrest [Source:SGD;Acc:S000006168])

HSP 1 Score: 74.7146 bits (182), Expect = 5.069e-15
Identity = 60/224 (26.79%), Postives = 100/224 (44.64%), Query Frame = 3
Query:  489 NVYLFDYTR-HPSKPDQSGKCKPDLVLKGHSQEGFGLSWNIKNAGVLLSSAVDGTIQLWDINCTPENKNDFKVLNSLSQYLGHEGSVEDVCWHKFSDQLFGSVGVDKNLLIWDRRE--------SKPAVKVMAH-----------SDDVVTLDFNPFSEYILATGSEDKT-IGLWDLRNMGGSLKYLRGHEGSIGQLQWSLHKETILASGGSDNKVHLWDLKKT 1097
            N+ L  Y R HP+ P  +     D+ + G         WN  +  +++SS++D T  +WD+  +   K         +Q + H+  V DV +   S QLF S G D ++ ++D R           P+  V              SD ++ L+ +P+   +LAT + D   I + D+RN    +  L+GH  S+  ++W   K  +L S G D +V  WDL  +
Sbjct:  217 NLSLCKYNRQHPANPAAAD----DMKVIGTFPPITSFDWNTVDTNLIISSSIDTTCIVWDLQSSHYVK---------TQLIAHDSEVFDVRFLTKSTQLFASCGGDGSVRVFDLRSLAHSTIIYEPPSSSVSGATAGTITPSSKGSDALLRLEPSPYDPNVLATFAADSNKIIILDMRNPESPILNLQGHGSSVNGIKWHPTKRNVLLSCGDDCQVLYWDLNSS 427          
BLAST of retinoblastoma binding protein-1 vs. Ensembl Yeast
Match: SEC31 (Component of the Sec13p-Sec31p complex of the COPII vesicle coat; COPII coat is required for vesicle formation in ER to Golgi transport; mutant has increased aneuploidy tolerance [Source:SGD;Acc:S000002354])

HSP 1 Score: 71.633 bits (174), Expect = 7.744e-14
Identity = 64/236 (27.12%), Postives = 107/236 (45.34%), Query Frame = 3
Query:  564 LKGHSQEGFGLSWNIKNAGVLLSSAVDGTIQLWDINCTPENKNDFKVLNSLSQYLGHEGSVEDVCWHKFSDQLFGSVGVDKNLLIWDRRESKPAVKVMAHSDD------VVTLDFNP--FSEYILATGSE-DKTIGLWDLRNMGGSLKYL-RGHEGSIGQLQWSLHKETILASGGSDNKVHLWDLKKTGTSKENTYSEELA-FIHAGHCSRVIDFAWNGNEPLMMASVSYDNILQL 1238
               HS     + +N K   VL S   +G I +WD+N   E+ +++  L +  Q +     V  + W++    +F S G      IWD +  K  + +   S +      +  ++++P   +    ATGS+ D +I +WDLRN    L+ L +GH+  I  L W    E +L S G DN V LW+ +          +E+L+ F   G+      FA     P + A  S+DN +++
Sbjct:  104 FSNHSSSVKTVKFNAKQDNVLASGGNNGEIFIWDMNKCTESPSNYTPL-TPGQSMSSVDEVISLAWNQSLAHVFASAGSSNFASIWDLKAKKEVIHLSYTSPNSGIKQQLSVVEWHPKNSTRVATATGSDNDPSILIWDLRNANTPLQTLNQGHQKGILSLDWCHQDEHLLLSSGRDNTVLLWNPES---------AEQLSQFPARGNWCFKTKFAPEA--PDLFACASFDNKIEV 327          

HSP 2 Score: 61.6178 bits (148), Expect = 1.331e-10
Identity = 58/242 (23.97%), Postives = 107/242 (44.21%), Query Frame = 3
Query:  594 LSWNIKNAGVLLSSAVD-GTIQLWDINCTPENKNDFKVLNSLSQYLGHEGSVEDVCWHKFSDQLFGSVGVDKNLLIWDRRESKPAV---------KVMAHSDDVVTLDFNPFSEYILATGSEDKTIGLWDLRNMGGS--LKYLRGHEGSIGQL---QWSLHKETILASG-GSDN--KVHLWDLKKTGTSKENTYSEELAFIHAGHCSRVIDFAWNGNEPLMMASVSYDNILQLWQPSEFLKL 1265
            L W+  N   +++ A+D G+++L+  N   E  N    +NS++++  H  SV+ V ++   D +  S G +  + IWD  +   +          + M+  D+V++L +N    ++ A+        +WDL+       L Y   + G   QL   +W     T +A+  GSDN   + +WDL+   T         L  ++ GH   ++   W   +  ++ S   DN + LW P    +L
Sbjct:   68 LDWSHNNK--IIAGALDNGSLELYSTN---EANN---AINSMARFSNHSSSVKTVKFNAKQDNVLASGGNNGEIFIWDMNKCTESPSNYTPLTPGQSMSSVDEVISLAWNQSLAHVFASAGSSNFASIWDLKAKKEVIHLSYTSPNSGIKQQLSVVEWHPKNSTRVATATGSDNDPSILIWDLRNANT--------PLQTLNQGHQKGILSLDWCHQDEHLLLSSGRDNTVLLWNPESAEQL 293          

HSP 3 Score: 54.6842 bits (130), Expect = 1.726e-8
Identity = 50/232 (21.55%), Postives = 98/232 (42.24%), Query Frame = 3
Query:  411 NHDGCINRARYLPQCPNVIATKSSNGNVYLFDYTRHPSKPDQSGKCKPDLVLKGHSQEGFGLSWNIKNAGVLLSSAVDGTIQLWDINCTPENKNDFKVLNSLSQYLGHEGSVEDVCWH-KFSDQLFGSVGV--DKNLLIWDRRESKPAVKVM--AHSDDVVTLDFNPFSEYILATGSEDKTIGLWDLRNMGGSLKYLRGHEGSIGQLQWSLHKETILASGGSDNKVHLWDLK 1091
            NH   +   ++  +  NV+A+  +NG ++++D  +    P       P   +     E   L+WN   A V  S+       +WD+      K +   L+  S   G +  +  V WH K S ++  + G   D ++LIWD R +   ++ +   H   +++LD+    E++L +   D T+ LW+  +    L           + +++     + A    DNK+ +  L+
Sbjct:  106 NHSSSVKTVKFNAKQDNVLASGGNNGEIFIWDMNKCTESPSNYTPLTPGQSMSS-VDEVISLAWNQSLAHVFASAGSSNFASIWDLKA----KKEVIHLSYTSPNSGIKQQLSVVEWHPKNSTRVATATGSDNDPSILIWDLRNANTPLQTLNQGHQKGILSLDWCHQDEHLLLSSGRDNTVLLWNPES-AEQLSQFPARGNWCFKTKFAPEAPDLFACASFDNKIEVQTLQ 331          
BLAST of retinoblastoma binding protein-1 vs. Ensembl Nematostella
Match: EDO42058 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S2K4])

HSP 1 Score: 429.869 bits (1104), Expect = 2.167e-149
Identity = 206/391 (52.69%), Postives = 276/391 (70.59%), Query Frame = 3
Query:  102 KDYIRWKKNTPFLYDLVMTHNLTWPSLTVQWMPDITRLEDKDYSTQRIIVGTQAEEEQDYLLIASVTVPNEYKCFESKHYDAEKDEFGGYGLVTAHTDISIKINHDGCINRARYLPQCPNVIATKSSNGNVYLFDYTRHPSKPDQSGKCKPDLVLKGHSQEGFGLSWNIKNAGVLLSSAVDGTIQLWDINCTPENKNDFKVLNSLSQYLGHEGSVEDVCWHKFSDQLFGSVGVDKNLLIWDRRES---KPAVKVMAHSDDVVTLDFNPFSEYILATGSEDKTIGLWDLRNMGGSLKYLRGHEGSIGQLQWSLHKETILASGGSDNKVHLWDLKKTGTSKENTYSE----ELAFIHAGHCSRVIDFAWNGNEPLMMASVSYDNILQLWQPSE 1253
            ++Y  WKKNTPFLYDLVMTH L WPSLTVQW+PD+T+ E KDYS  R+I+GT   +EQ++++IASV +PN+   F++ HYD +K EFGG+  V+   DI IKINH+G +NRAR++PQ P +IATK+ + +V +FDYT+HPSKPD +G+C PDL LKGH++EG+GLSWN    G LLS++ D TI LWDI+     +   K ++++  + GH   VEDV WH   + LFGSV  D  L+IWD R++   K A  V AH+ +V  L FNP+SE+ILATGS DKT+ LWDLRN+   L     H+  I Q+QWS H ETILAS G+D ++H+WDL K G  +    +E    EL FIH GH +++ DF+WN NEP ++ SVS DNI+Q+WQ +E
Sbjct:    4 EEYKIWKKNTPFLYDLVMTHALEWPSLTVQWLPDVTKPEGKDYSVHRLILGTHTSDEQNHVVIASVQLPNDEAQFDASHYDNDKGEFGGFASVSGKIDIEIKINHEGEVNRARFMPQNPCIIATKTPSADVLVFDYTKHPSKPDPNGECSPDLRLKGHTKEGYGLSWNPNVNGNLLSASDDHTICLWDISSGISKEQ--KTVDAMRIFTGHSAVVEDVSWHLLHESLFGSVADDHKLMIWDTRQTNSNKAAHTVDAHTAEVNCLSFNPYSEFILATGSADKTVALWDLRNLKLKLHSFESHKDEIFQVQWSPHNETILASSGTDRRLHVWDLSKIGEEQSAEDAEDGPPELLFIHGGHTAKISDFSWNPNEPWVLCSVSEDNIMQVWQMAE 392          
BLAST of retinoblastoma binding protein-1 vs. Ensembl Nematostella
Match: EDO34980 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SMS9])

HSP 1 Score: 112.464 bits (280), Expect = 1.845e-27
Identity = 105/425 (24.71%), Postives = 188/425 (44.24%), Query Frame = 3
Query:   15 LFVCSK-FLCFTAVKYTMIEELSNDSNSFCKDYIRWKKNTPFLYDLVMTHNLTWPSLTVQWMPDITRLEDKDYS-TQRIIVGTQAEEEQ-DYLLIASVTVPNEYKCFESKHYDAEKDEFGGYGLVTAHTDISIKINHDGCINRARYLPQCPN--VIATKSSNGNVYLFDY------TRHPSKPDQSGKCKPDLVLKGHSQEGFGLSWNIKNAGVLLSSAVDGTIQLWDINCTPENKNDFKVLNSLSQYLGHEGSVEDVCWHKFSDQLFGSVGVDKNLLIWDRRESKPAVKVM----AHSDDVVTLDFNPFSEYILATGSEDKTIGLWDLRNM---GGSLKYLRGHEGSIGQLQWSLHKETILASGGSDNKVHLWDL------KKTGTSKENTYSEELAFIHAGHCSRVIDFAWNGNEPLMMASVS 1217
            +FVCS+ FL   A++    EEL+ DS ++             +Y    T     P L+   +PD       +Y  T  I+ GTQ+E  + +++++  ++     +   +   + + DE     +       ++ + H+G +NR R+    PN  ++A+ S  G+V+++D       + +P    Q  +  P     GH+ EGF + W+    G LL+      + LW+    P+    + V      +  H  SVEDV W    + +F S  VDK + IWD R + P+   M    AH  DV  + +N  +E  + +G +D  + +WDLR +   G  +   +   G I  ++W     ++ A+  +DN++ LWDL         G  +      +L FIH G    + +  W+   P ++ S +
Sbjct:   13 VFVCSQVFLPGDAMEQD--EELTYDSTAY------------HMYHAAQTGA---PCLSFDVIPDNLGEARTEYPMTAYILAGTQSERSRANHIIVMKMS-----ELHRTHDEEKDSDEEEDDYIDEDPELETVMLKHNGGVNRIRH-GHIPNRHIVASWSERGSVHIWDVEAQIIASDNPGSSSQPRESSPLFTFSGHASEGFAMDWSRNTHGRLLTGDCKHNVHLWN----PQEGGSWHV--DQRPFNAHTDSVEDVQWSPNENNVFASCSVDKTIRIWDAR-AMPSKACMISTNAHDADVNVISWN-RNEPFIVSGGDDGILKVWDLRQLQKQGQPVALFKHSTGPITSVEWHPTDGSVFAASSADNQITLWDLAVERDEAAEGPGRHLDVPPQLLFIHMGQ-KDIKELHWHPQLPGVLISTA 405          
BLAST of retinoblastoma binding protein-1 vs. Ensembl Nematostella
Match: EDO38818 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SBS0])

HSP 1 Score: 95.9005 bits (237), Expect = 3.058e-22
Identity = 66/264 (25.00%), Postives = 125/264 (47.35%), Query Frame = 3
Query:  459 NVIATKSSNGNVYLFDYTRHPSKPDQSGKCKPDLVLKGHSQEGFGLSWNIKNAGVLLSSAVDGTIQLWDINCTPENKNDFKVLNSLSQYLGHEGSVEDVCWHKFSDQLFGSVGVDKNLLIWDRR-ESKPAVKVMAHSDDVVTLDFNPFSEYILATGSEDKTIGLWDLRNMGGSLKYLRGHEGSIGQLQWSLHKETILASGGSDNKVHLWDLKKTGTSKENTYSEELAFIHAGHCSRVIDFAWNGNEPLMMASVSYDNILQLWQP 1247
            +V+ + S +G++ L++      +P +        V KGH+ E +G+ W  +    +LS++ D TI+LWD   T         + +++ + GH+  V    W     + F S   D+++ IWD     +P   + AH  +V+T D+  + ++++ +GS D  I  WD+RN    +   + H  ++ +L+ S H+  I+AS   D  +  WD   T    E          H    +  +DF  N ++P  +A  S+D ++ ++ P
Sbjct:   74 DVVISASGDGSLQLWNLALPEPQPVR--------VFKGHTAEVYGVDW-CREQDFVLSASWDHTIRLWDPLRTE--------IPTVAMFTGHQNVVYSSIWSPHIPRTFASASGDQHIGIWDMACPGRPQQLIRAHEGEVLTCDWAKYDQHLVVSGSVDTLIKGWDVRNTNAPVFSFKAHPYAVRRLKCSPHQGNIIASCSYDFTIKTWDTTSTLAPLETIE-------HHSEFATGLDF--NIHQPGQIADCSFDGMVTVYSP 311          

HSP 2 Score: 46.9802 bits (110), Expect = 7.059e-6
Identity = 52/252 (20.63%), Postives = 94/252 (37.30%), Query Frame = 3
Query:  240 RIIVGTQAE-------EEQDYLLIASVTVPNEYKCFESKHYDAEKDEFGGYGLVTAHTDISIKINHDGCINRARYLPQCPNVIATKSSNGNVYLFDYTRHPSKPDQSGKCKPDLVLKGHSQEGFGLSWNIKNAGVLLSSAVDGTIQLWDINCTPENKNDFKVLNSLSQYLGHEGSVEDVCWHKFSDQLFGSVGVDKNLLIWDRRES-KPAVKVMAHSDDVVTLDFNPFSEYILATGSEDKTIGLWDLRNMGG 971
            R+  G  AE        EQD++L AS            + +D  + E     + T H ++         +  + + P  P   A+ S + ++ ++D    P +P Q        +++ H  E     W   +  +++S +VD  I+ WD+  T      FK          H  +V  +        +  S   D  +  WD   +  P   +  HS+    LDFN      +A  S D  + ++  R++G 
Sbjct:   99 RVFKGHTAEVYGVDWCREQDFVLSASWD-------HTIRLWDPLRTEIPTVAMFTGHQNV---------VYSSIWSPHIPRTFASASGDQHIGIWDMAC-PGRPQQ--------LIRAHEGEVLTCDWAKYDQHLVVSGSVDTLIKGWDVRNTNAPVFSFK---------AHPYAVRRLKCSPHQGNIIASCSYDFTIKTWDTTSTLAPLETIEHHSEFATGLDFNIHQPGQIADCSFDGMVTVYSPRSLGA 316          
BLAST of retinoblastoma binding protein-1 vs. Ensembl Nematostella
Match: EDO29288 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T426])

HSP 1 Score: 85.1149 bits (209), Expect = 3.418e-19
Identity = 74/254 (29.13%), Postives = 114/254 (44.88%), Query Frame = 3
Query:  486 GNVYLFDYTRHPSKPDQSGKCKPDLVLKGHSQEGFGLSWNIKNAGVLLSSAVDGTIQLWDINCTPENKNDFKVLNSLSQYLGHEGSVEDVCWHKFSDQ--LFGSVGVDKNLLIWDRRESKPAVKVMAHSDDVVTLDFNPFSEYILATGSEDKTIGLWDLRNMGGSLKYLRGHEGSIGQLQWSLHKETILASGGSDNKVHLWDLKKTGTSKENTYSEELAFIHAGHCSRVIDFAWNGNEPLMMASVSYDNILQLW 1241
            G+ + FD T   S+            L GHS   F +S +  N   LLS + D TI+LW +              +L  Y GH   V DV   +F  +   F S   D+   +W     +P      H  DV  + F+P   YI ATGS D+T+ LWD++  G S++   GH+ ++  L +S +   +++S G D ++ +WDL       E T   EL     GH   V    ++  +  ++AS   DN ++LW
Sbjct:    2 GDAFCFDRTASESRR-----------LVGHSGPVFAVSIDHDNK-FLLSCSEDKTIRLWSL----------FTFTTLVAYRGHNYPVWDV---QFCPRGHYFASTSHDRTARLWSTDHQQPLRIFAGHVSDVNKVAFHPNCNYI-ATGSSDRTVRLWDIQT-GSSVRLFTGHKAAVQSLAFSRNGRHLISS-GVDTRLLVWDL------AEGTLVAEL----KGHTDTVYSLCFS-RDGTILASAGLDNCIKLW 216          
BLAST of retinoblastoma binding protein-1 vs. Ensembl Nematostella
Match: EDO33060 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7ST98])

HSP 1 Score: 87.8113 bits (216), Expect = 1.171e-18
Identity = 70/231 (30.30%), Postives = 106/231 (45.89%), Query Frame = 3
Query:  564 LKGHSQEGFGLSWNIKNAGVLLSSAVDGTIQLWDINCTPENKNDFKVLNSLSQYLGHEGSVEDVCWHKFSDQLFGSVGVDKNLLIWDRRESKPAVKVMAHSDDVVTLDFNPFSEYILATGSEDKTIGLWDLRNMGGSLKYLRGHEGSIGQLQWSLHKETILASGGSDNKVHLWDLKKTGTSKENTYSEELAFIHAGHCSRVIDFAWNGNEPLMMASVSYDNILQLWQPSEF 1256
            L GHS   F +S +  N   LLS + D TI+LW +              +L  Y GH   V DV +       F S   D+   +W     +P      H  DV  + F+P   YI ATGS D+T+ LWD++  G S++   GH+ ++  L +S +   +++S G D ++ +WDL       E T   EL     GH   V    ++  +  ++AS   DN ++LW  S F
Sbjct:  343 LVGHSGPVFAVSIDHDNK-FLLSCSEDKTIRLWSLF----------TFTTLVAYRGHNYPVWDVQFCP-RGHYFASTSHDRTARLWSTDHQQPLRIFAGHVSDVNVIAFHPNCNYI-ATGSSDRTVRLWDIQT-GSSVRLFTGHKAAVQSLAFSRNGRHLISS-GVDTRLLVWDL------AEGTLVAEL----KGHTDTVYSLCFS-RDGTILASAGLDNCIKLWNTSVF 547          

HSP 2 Score: 53.5286 bits (127), Expect = 1.153e-7
Identity = 36/135 (26.67%), Postives = 65/135 (48.15%), Query Frame = 3
Query:  549 KPDLVLKGHSQEGFGLSWNIKNAGVLLSSAVDGTIQLWDINCTPENKNDFKVLNSLSQYLGHEGSVEDVCWHKFSDQLFGSVGVDKNLLIWDRRESKPAVKVMAHSDDVVTLDFNPFSEYILATGSEDKTIGLWD 953
            +P  +  GH  +   ++++  N   + + + D T++LWDI             +S+  + GH+ +V+ + + +    L  S GVD  LL+WD  E     ++  H+D V +L F+     ILA+   D  I LW+
Sbjct:  422 QPLRIFAGHVSDVNVIAFH-PNCNYIATGSSDRTVRLWDIQTG----------SSVRLFTGHKAAVQSLAFSRNGRHLISS-GVDTRLLVWDLAEGTLVAELKGHTDTVYSLCFSR-DGTILASAGLDNCIKLWN 543          
BLAST of retinoblastoma binding protein-1 vs. Ensembl Medaka
Match: rbbp4 (RB binding protein 4, chromatin remodeling factor [Source:NCBI gene;Acc:101155071])

HSP 1 Score: 438.728 bits (1127), Expect = 2.778e-152
Identity = 209/391 (53.45%), Postives = 280/391 (71.61%), Query Frame = 3
Query:  102 KDYIRWKKNTPFLYDLVMTHNLTWPSLTVQWMPDITRLEDKDYSTQRIIVGTQAEEEQDYLLIASVTVPNEYKCFESKHYDAEKDEFGGYGLVTAHTDISIKINHDGCINRARYLPQCPNVIATKSSNGNVYLFDYTRHPSKPDQSGKCKPDLVLKGHSQEGFGLSWNIKNAGVLLSSAVDGTIQLWDINCTPENKNDFKVLNSLSQYLGHEGSVEDVCWHKFSDQLFGSVGVDKNLLIWDRRE---SKPAVKVMAHSDDVVTLDFNPFSEYILATGSEDKTIGLWDLRNMGGSLKYLRGHEGSIGQLQWSLHKETILASGGSDNKVHLWDLKKTGTSKENTYSE----ELAFIHAGHCSRVIDFAWNGNEPLMMASVSYDNILQLWQPSE 1253
            ++Y  WKKNTPFLYDLVMTH L WPSLT QW+PD+TR E KDYS  R+++GT   +EQ++L+IASV +PN+   F++ HYD+EK EFGG+G V+   +I IKINH+G +NRARY+PQ P +IATK+   +V +FDYT+HPSKPD SG+C PDL L+GH +EG+GLSWN   +G LLS++ D TI LWDI+  P+   + K++++ + + GH   VEDV WH   + LFGSV  D+ L+IWD R    SKP+  V AH+ +V  L FNP+SE+ILATGS DKT+ LWDLRN+   L     H+  I Q+QWS H ETILAS G+D ++++WDL K G  +    +E    EL FIH GH +++ DF+WN NEP ++ SVS DNI+Q+WQ +E
Sbjct:   19 EEYKIWKKNTPFLYDLVMTHALEWPSLTAQWLPDVTRPEGKDYSVHRLVLGTHTSDEQNHLVIASVQLPNDDAQFDASHYDSEKGEFGGFGSVSGKIEIEIKINHEGEVNRARYMPQNPCIIATKTPTSDVLVFDYTKHPSKPDPSGECTPDLRLRGHQKEGYGLSWNPNLSGCLLSASDDHTICLWDISTVPK---EGKIVDAKTIFTGHTAVVEDVSWHLLHESLFGSVADDQKLMIWDTRSNNTSKPSHAVDAHTAEVNCLSFNPYSEFILATGSADKTVALWDLRNLKLKLHSFESHKDEIFQVQWSPHNETILASSGTDRRLNVWDLSKIGEEQSPEDAEDGPPELLFIHGGHTAKISDFSWNPNEPWVICSVSEDNIMQVWQMAE 406          
BLAST of retinoblastoma binding protein-1 vs. Ensembl Medaka
Match: rbb4l (histone-binding protein RBBP7 [Source:NCBI gene;Acc:101156710])

HSP 1 Score: 429.098 bits (1102), Expect = 5.430e-148
Identity = 209/392 (53.32%), Postives = 278/392 (70.92%), Query Frame = 3
Query:  102 KDYIRWKKNTPFLYDLVMTHNLTWPSLTVQWMPDITRLEDKDYSTQRIIVGTQAEEEQDYLLIASVTVPNEYKCFESKHYDAEKD-EFGGYGLVTAHTDISIKINHDGCINRARYLPQCPNVIATKSSNGNVYLFDYTRHPSKPDQSGKCKPDLVLKGHSQEGFGLSWNIKNAGVLLSSAVDGTIQLWDINCTPENKNDFKVLNSLSQYLGHEGSVEDVCWHKFSDQLFGSVGVDKNLLIWDRRE---SKPAVKVMAHSDDVVTLDFNPFSEYILATGSEDKTIGLWDLRNMGGSLKYLRGHEGSIGQLQWSLHKETILASGGSDNKVHLWDLKKTGTSKENTYSE----ELAFIHAGHCSRVIDFAWNGNEPLMMASVSYDNILQLWQPSE 1253
            ++Y  WKKNTPFLYDLVMTH L WPSLTVQW+PD++R E KDY+  R+++GT   +EQ++L+IASV VPN+   F++ HYD+EK  EFGG+G V+   +I IKINHDG +NRARY+PQ P +IATK+   +V +FDYT+HP+KPD SG+C PDL LKGH +EG+GLSWN   +G LLS++ D TI LWDI   P+   + KV+++ + + GH   VEDV WH   + LFGSV  D+ L+IWD R    SK +  V AH+ +V  L FNP+SE+ILATGS DKT+ LWDLRN+   L     H+  I Q+QWS H ETILAS G+D ++++WDL K G  +    +E    EL FIH GH +++ DF+WN  EP ++ SVS DNI+Q+WQ +E
Sbjct:   55 EEYKIWKKNTPFLYDLVMTHALEWPSLTVQWLPDVSRPEGKDYAVHRLVLGTHTSDEQNHLVIASVQVPNDDAQFDASHYDSEKGAEFGGFGSVSGKIEIEIKINHDGEVNRARYMPQNPCIIATKTPTSDVLVFDYTKHPAKPDPSGECSPDLRLKGHQKEGYGLSWNPNLSGNLLSASDDHTICLWDIGAGPK---EGKVVDAKTIFTGHTAVVEDVSWHLLHESLFGSVADDQKLMIWDTRSNNTSKASHSVDAHTAEVNCLSFNPYSEFILATGSADKTVALWDLRNLKLKLHSFESHKDEIFQVQWSPHNETILASSGTDRRLNVWDLSKIGEEQSAEDAEDGPPELLFIHGGHTAKISDFSWNPGEPWIICSVSEDNIMQVWQMAE 443          
BLAST of retinoblastoma binding protein-1 vs. Ensembl Medaka
Match: rbb4l (histone-binding protein RBBP7 [Source:NCBI gene;Acc:101156710])

HSP 1 Score: 414.846 bits (1065), Expect = 5.097e-142
Identity = 208/415 (50.12%), Postives = 277/415 (66.75%), Query Frame = 3
Query:  102 KDYIRWKKNTPFLYDLVMTHNLTWPSLTVQWMPDITRLEDKDYSTQRIIVGTQAEEEQDYLLIASVTVPNEYKCFESKHYDAEKD-EFGGYGLVTAHTDISIKINHDGCINRARYLPQCPNVIATKSSNGNVYLFDYTRHPSKPDQSGKCKPDLVLKGHSQEGFGLSWNIKNAGVLLSSAVDGTIQLWDINCTPENKNDFKVLNSLSQYLGHEGSVEDVCWHKFSDQLFGSVGVDKNLLIWDRRE---SKPAVKVMAHSDDVVTLDFNPFSEYILATGSEDKTIGLWDLRNMGGSLKYLRGHEGSIGQLQWSLHKETILASGGSDNKVHLWDLKKTGTSKENTYSEE---------LA---------------------FIHAGHCSRVIDFAWNGNEPLMMASVSYDNILQLWQ 1244
            ++Y  WKKNTPFLYDLVMTH L WPSLTVQW+PD++R E KDY+  R+++GT   +EQ++L+IASV VPN+   F++ HYD+EK  EFGG+G V+   +I IKINHDG +NRARY+PQ P +IATK+   +V +FDYT+HP+KPD SG+C PDL LKGH +EG+GLSWN   +G LLS++ D TI LWDI   P+   + KV+++ + + GH   VEDV WH   + LFGSV  D+ L+IWD R    SK +  V AH+ +V  L FNP+SE+ILATGS DKT+ LWDLRN+   L     H+  I Q+QWS H ETILAS G+D ++++WDL K G  +    +E+         LA                     FIH GH +++ DF+WN  EP ++ SVS DNI+Q+WQ
Sbjct:   55 EEYKIWKKNTPFLYDLVMTHALEWPSLTVQWLPDVSRPEGKDYAVHRLVLGTHTSDEQNHLVIASVQVPNDDAQFDASHYDSEKGAEFGGFGSVSGKIEIEIKINHDGEVNRARYMPQNPCIIATKTPTSDVLVFDYTKHPAKPDPSGECSPDLRLKGHQKEGYGLSWNPNLSGNLLSASDDHTICLWDIGAGPK---EGKVVDAKTIFTGHTAVVEDVSWHLLHESLFGSVADDQKLMIWDTRSNNTSKASHSVDAHTAEVNCLSFNPYSEFILATGSADKTVALWDLRNLKLKLHSFESHKDEIFQVQWSPHNETILASSGTDRRLNVWDLSKIGEEQSAEDAEDGPPELLVGPLASRLVGGLLKVLMWSFPVVLHQFIHGGHTAKISDFSWNPGEPWIICSVSEDNIMQVWQ 466          
BLAST of retinoblastoma binding protein-1 vs. Ensembl Medaka
Match: grwd1 (glutamate rich WD repeat containing 1 [Source:NCBI gene;Acc:101163517])

HSP 1 Score: 100.138 bits (248), Expect = 1.316e-22
Identity = 79/290 (27.24%), Postives = 130/290 (44.83%), Query Frame = 3
Query:  414 HDGCINRARYLPQC--PNVIATKSSNGNVYLFDY-----TRHPSKP-----DQSGKCKPDLVLKGHSQEGFGLSWNIKNAGVLLSSAVDGTIQLWDINCTPENKNDFKVLNSLSQYLGHEGSVEDVCWHKFSDQLFGSVGVDKNLLIWDRRESKPAVKVM--AHSDDVVTLDFNPFSEYILATGSEDKTIGLWDLRNM--GGSLKYLRGHEGSIGQLQWSLHKETILASGGSDNKVHLWDL----KKTGTSKENT--YSEELAFIHAGHCSRVIDFAWNGNEPLMMASVS 1217
            H G +NR R + QC   ++ A  S  G V +FD        H S        Q  + KP     GH  EGF + W+ K  G L+S      I +W+     E  + +++      +  H  SVED+ W      +F S  VD+++ +WD R    ++  +  AH+ D+  + +N  SE  L +G +D  + +WDLR    G ++   + H   I  ++WS    ++ A+ G+D+ +  WDL       G   E       +L F+H G  S + +  W+   P +M S +
Sbjct:  154 HYGGVNRVR-VTQCGQQSLAAVWSEKGQVEIFDLRPQLEAVHSSAAMSAFLQQQKEAKPLFSFSGHMSEGFAIDWSPKAPGRLVSGDCKKNIHVWEPR---EGGSAWQI--DQRPFSSHSKSVEDLQWSPTEATVFASCSVDQSIRVWDIRAPPNSMLSVDGAHASDINVISWN-RSEPFLLSGGDDGLLKVWDLRQFKTGRAVANFKQHSAPITSVEWSPADSSVFAASGADDVISQWDLSVESSDVGARVEGLKDLPPQLLFLHQGQ-SEIKEIHWHPQIPGVMISTA 435          
BLAST of retinoblastoma binding protein-1 vs. Ensembl Medaka
Match: pex7 (peroxisomal biogenesis factor 7 [Source:NCBI gene;Acc:101156454])

HSP 1 Score: 97.4413 bits (241), Expect = 2.741e-22
Identity = 58/187 (31.02%), Postives = 96/187 (51.34%), Query Frame = 3
Query:  531 DQSGKCKPDLVLKGHSQEGFGLSWN-IKNAGVLLSSAVDGTIQLWDINCTPENKNDFKVLNSLSQYLGHEGSVEDVCWHKFSDQLFGSVGVDKNLLIWDRRESKPAVKVMAHSDDVVTLDFNPFSEYILATGSEDKTIGLWDLRNMGGSLKYLRGHEGSIGQLQWSLHKETILASGGSDNKVHLWDL 1088
            D + +  P  V K H+QE + +SW+  +   +++S + D T+++WD + +           SL+   GHEG V    W         S   D  L IWD + +   + V AH  +++  D+  + + I+ATGS D +I +WDLRN+   + +L GH  +I +L++S   +T+LAS   D  V  WD 
Sbjct:   89 DTANQHAPLKVAKEHTQEVYSVSWSQTRGENLIVSGSWDHTVKVWDPSLS----------RSLTTLRGHEGVVYSTIWSPHIPGCIASASGDGTLRIWDVKAAVCRLAVPAHQAEILACDWCKYDQNIVATGSVDCSINVWDLRNIRQPVNHLLGHTYAIRRLKFSPFSQTVLASCSYDFTVRFWDF 265          

HSP 2 Score: 52.373 bits (124), Expect = 3.410e-7
Identity = 39/158 (24.68%), Postives = 70/158 (44.30%), Query Frame = 3
Query:  771 SDQLFGSVGVDKNLLIWDRRESKPAVKVMAHSDDVVTLDFNPFSEYILATGSEDKTIGLWDLRNMGGSLKYLRGHEGSIGQLQWSLHK-ETILASGGSDNKVHLWDLKKTGTSKENTYSEELAFIHAGHCSRVIDFAWNGNEPLMMASVSYDNILQLW 1241
            + Q +G  G    L++ +      +V+     D +  + ++  +E++L  G  D ++ LWD  N    LK  + H   +  + WS  + E ++ SG  D+ V +WD          + S  L  +  GH   V    W+ + P  +AS S D  L++W
Sbjct:   29 ASQYYGITGCGTLLVLDETPRGLVSVRSWEWGDGLFDVAWSEANEHLLVAGGGDGSLQLWDTANQHAPLKVAKEHTQEVYSVSWSQTRGENLIVSGSWDHTVKVWD---------PSLSRSLTTLR-GHEGVVYSTIWSPHIPGCIASASGDGTLRIW 176          
BLAST of retinoblastoma binding protein-1 vs. Planmine SMEST
Match: SMESG000007931.1 (SMESG000007931.1)

HSP 1 Score: 830.091 bits (2143), Expect = 0.000e+0
Identity = 398/401 (99.25%), Postives = 399/401 (99.50%), Query Frame = 3
Query:   63 MIEELSNDSNSFCKDYIRWKKNTPFLYDLVMTHNLTWPSLTVQWMPDITRLEDKDYSTQRIIVGTQAEEEQDYLLIASVTVPNEYKCFESKHYDAEKDEFGGYGLVTAHTDISIKINHDGCINRARYLPQCPNVIATKSSNGNVYLFDYTRHPSKPDQSGKCKPDLVLKGHSQEGFGLSWNIKNAGVLLSSAVDGTIQLWDINCTPENKNDFKVLNSLSQYLGHEGSVEDVCWHKFSDQLFGSVGVDKNLLIWDRRESKPAVKVMAHSDDVVTLDFNPFSEYILATGSEDKTIGLWDLRNMGGSLKYLRGHEGSIGQLQWSLHKETILASGGSDNKVHLWDLKKTGTSKENTYSEELAFIHAGHCSRVIDFAWNGNEPLMMASVSYDNILQLWQPSEFLKL 1265
            MIEELSNDSNSFCKDYIRWKKNTPFLYDLVMTHNLTWPSLTVQWMPDITRLEDKDYSTQRIIVGTQAEEEQDYLLIASVTVPNEYKCFESKHYDAEKDEFGGYGLVTAHTDISIKINHDGCINRARYLPQCPNVIATKSSNGNVYLFDYTRHPSKPDQSGKCKPDLVLKGHSQEGFGLSWNIKNAGVLLSSAVDGTIQLWD+NCTPENKNDFKVLNSLSQYLGHEGSVEDVCWHKFSDQLFGSVGVDKNLLIWDRRESKPAVKVMAHSDDVVTLDFNPFSEYILATGSEDKTIGLWDLRNMGGSLKYLRGHEGSIGQLQWSLHKETILASGGSDNKVHLWDLKKTGTSKE  YSEELAFIHAGHCSRVIDFAWNGNEPLMMASVSYDNILQLWQPSEFLKL
Sbjct:    1 MIEELSNDSNSFCKDYIRWKKNTPFLYDLVMTHNLTWPSLTVQWMPDITRLEDKDYSTQRIIVGTQAEEEQDYLLIASVTVPNEYKCFESKHYDAEKDEFGGYGLVTAHTDISIKINHDGCINRARYLPQCPNVIATKSSNGNVYLFDYTRHPSKPDQSGKCKPDLVLKGHSQEGFGLSWNIKNAGVLLSSAVDGTIQLWDVNCTPENKNDFKVLNSLSQYLGHEGSVEDVCWHKFSDQLFGSVGVDKNLLIWDRRESKPAVKVMAHSDDVVTLDFNPFSEYILATGSEDKTIGLWDLRNMGGSLKYLRGHEGSIGQLQWSLHKETILASGGSDNKVHLWDLKKTGTSKEKNYSEELAFIHAGHCSRVIDFAWNGNEPLMMASVSYDNILQLWQPSEFLKL 401          
BLAST of retinoblastoma binding protein-1 vs. Planmine SMEST
Match: SMESG000007931.1 (SMESG000007931.1)

HSP 1 Score: 778.474 bits (2009), Expect = 0.000e+0
Identity = 378/401 (94.26%), Postives = 379/401 (94.51%), Query Frame = 3
Query:   63 MIEELSNDSNSFCKDYIRWKKNTPFLYDLVMTHNLTWPSLTVQWMPDITRLEDKDYSTQRIIVGTQAEEEQDYLLIASVTVPNEYKCFESKHYDAEKDEFGGYGLVTAHTDISIKINHDGCINRARYLPQCPNVIATKSSNGNVYLFDYTRHPSKPDQSGKCKPDLVLKGHSQEGFGLSWNIKNAGVLLSSAVDGTIQLWDINCTPENKNDFKVLNSLSQYLGHEGSVEDVCWHKFSDQLFGSVGVDKNLLIWDRRESKPAVKVMAHSDDVVTLDFNPFSEYILATGSEDKTIGLWDLRNMGGSLKYLRGHEGSIGQLQWSLHKETILASGGSDNKVHLWDLKKTGTSKENTYSEELAFIHAGHCSRVIDFAWNGNEPLMMASVSYDNILQLWQPSEFLKL 1265
            MIEELSNDSNSFCKDYIRWKKNTPFLYDLVMTHNLTWPSLTVQWMPDITRLEDKDYSTQRIIVGTQAEEEQDYLLIASVTVPNEYKCFESKHYDAEKDEFGGYGLVTAHTDISIKINHDGCINRARYLPQCPNVIATKSSNGNVYLFDYTRHPSKPDQSGKCKPDLVLKGHSQEGFGLSWNIKNAGVLLSSAVDGTIQLWD+NCTPENKNDFKVLNSLSQYLGHEGSVEDVCWHKFSDQLFGSVGVDKNLLIWDR                    FNPFSEYILATGSEDKTIGLWDLRNMGGSLKYLRGHEGSIGQLQWSLHKETILASGGSDNKVHLWDLKKTGTSKE  YSEELAFIHAGHCSRVIDFAWNGNEPLMMASVSYDNILQLWQPSEFLKL
Sbjct:    1 MIEELSNDSNSFCKDYIRWKKNTPFLYDLVMTHNLTWPSLTVQWMPDITRLEDKDYSTQRIIVGTQAEEEQDYLLIASVTVPNEYKCFESKHYDAEKDEFGGYGLVTAHTDISIKINHDGCINRARYLPQCPNVIATKSSNGNVYLFDYTRHPSKPDQSGKCKPDLVLKGHSQEGFGLSWNIKNAGVLLSSAVDGTIQLWDVNCTPENKNDFKVLNSLSQYLGHEGSVEDVCWHKFSDQLFGSVGVDKNLLIWDRH-------------------FNPFSEYILATGSEDKTIGLWDLRNMGGSLKYLRGHEGSIGQLQWSLHKETILASGGSDNKVHLWDLKKTGTSKEKNYSEELAFIHAGHCSRVIDFAWNGNEPLMMASVSYDNILQLWQPSEFLKL 382          
BLAST of retinoblastoma binding protein-1 vs. Planmine SMEST
Match: SMESG000062893.1 (SMESG000062893.1)

HSP 1 Score: 379.793 bits (974), Expect = 2.724e-129
Identity = 177/393 (45.04%), Postives = 258/393 (65.65%), Query Frame = 3
Query:  102 KDYIRWKKNTPFLYDLVMTHNLTWPSLTVQWMPDITRLEDKDYSTQRIIVGTQAEEEQDYLLIASVTVPNEYKCFESKHYDAEKDEFGGYGLVTAHTDISIKINHDGCINRARYLPQCPNVIATKSSNGNVYLFDYTRHPSKPDQSGKCKPDLVLKGHSQEGFGLSWNIKNAGVLLSSAVDGTIQLWDINCTPENKNDFKVLNSLSQYLGHEGSVEDVCWHKFSDQLFGSVGVDKNLLIWDRRE---SKPAVKVMAHSDDVVTLDFNPFSEYILATGSEDKTIGLWDLRNMGGSLKYLRGHEGSIGQLQWSLHKETILASGGSDNKVHLWDLKKTGTSKENTY----SEELAFIHAGHCSRVIDFAWNGNEPLMMASVSYDNILQLWQPSEFL 1259
            +DY  WK++TPFLYD +M H L WPSLT QW+P I R  DKDY+  R+I+GT   +EQ++LLIAS+ +PN+   F++  YD E+ ++GG+G      +I++ INH+G +NRARY+PQ    +ATK+   +V +F+Y  HP++P    + KP+L LKGH +EG+GLSWN   AG +LS++ D TI +WD N    + ++   +N L Q++GH   VEDV WH     +FGSV  DK L+IWD R    SKP ++V AH+ +V  + FNPF+++++ TGS DKT+ +WD+RN+   L     H+  I Q+QWS H ETI AS G+D ++H+WD  K G  ++         EL FIH GH +++ DF+WN  EP  + SV+ DNILQ+WQ ++ +
Sbjct:   23 EDYKIWKRDTPFLYDCLMVHPLEWPSLTAQWLPTIDRPNDKDYTVHRLILGTHTSDEQNHLLIASINMPNDQTEFDASAYDTERFDYGGFGFPNGKLEITMMINHEGEVNRARYMPQNETFVATKTPTADVLIFNYAIHPARP-FGMEVKPELRLKGHLKEGYGLSWNPIKAGYILSASDDKTICMWDTNTAGNSSSEGPYINPLMQFIGHNTVVEDVAWHLRHGDVFGSVADDKKLMIWDIRSDNTSKPVIEVDAHTAEVNCIAFNPFNQHLVVTGSADKTVAMWDMRNLQLKLHSFEAHQDEIFQVQWSPHNETIFASSGTDRRLHIWDCSKIGLEQQEVEFVDGPPELLFIHPGHTAKISDFSWNQFEPWTICSVAEDNILQVWQMADIM 414          
BLAST of retinoblastoma binding protein-1 vs. Planmine SMEST
Match: SMESG000055161.1 (SMESG000055161.1)

HSP 1 Score: 253.832 bits (647), Expect = 2.208e-82
Identity = 122/142 (85.92%), Postives = 133/142 (93.66%), Query Frame = 3
Query:  234 TQRIIVGTQAEEEQDYLLIASVTVPNEYKCFESKHYDAEKDEFGGYGLVTAHTDISIKINHDGCINRARYLPQCPNVIATKSSNGNVYLFDYTRHPSKPDQSGKCKPDLVLKGHSQEGFGLSWNIKNAGVLLSSAVDGTIQL 659
            T+RIIVGTQ EE QDYLLIASVTVPNEYKCFES+HYDAEKDEFGGYGLVTA+TDI+IKINH G INR+RYL QCPNVIATKS NGNVYLF YTR+PSKPDQ+GKCKP LVL+G+SQEGFG SWNIKNAGVLLSSAV+G+IQL
Sbjct:  116 TRRIIVGTQTEE-QDYLLIASVTVPNEYKCFESRHYDAEKDEFGGYGLVTANTDINIKINHGGYINRSRYLTQCPNVIATKSPNGNVYLFHYTRNPSKPDQNGKCKPYLVLQGYSQEGFGFSWNIKNAGVLLSSAVNGSIQL 256          
BLAST of retinoblastoma binding protein-1 vs. Planmine SMEST
Match: SMESG000037114.1 (SMESG000037114.1)

HSP 1 Score: 229.95 bits (585), Expect = 2.020e-71
Identity = 138/390 (35.38%), Postives = 210/390 (53.85%), Query Frame = 3
Query:  117 WKKNTPFLYDLVMTHNLTWPSLTVQWMPDITRLEDK--DYSTQRIIVGTQAEEEQDYLLIASVTVPNEYKCFESKHYDAE-KDEFGGYGLVTAHTDISIKINHDGCINRARYLPQCPNVIATKSSNGNVYLFDYTRHPSKPDQSGKCKPDLVLKGHSQEGFGLSWNIKNAGVLLSSAVDGTIQLWDINCTPENKNDFKVLNSLSQYLGHEGSVEDVCWHKFSDQLFGSVGVDKNLLIWDRRE------SKPAVKVMAHSDDVVTLDFNPFSEYILATGSEDKTIGLWDLRNMGGSLKYLRGHEGSIGQLQWSLHKETILASGGSDNKVHLWDLKKTGT-----SKENTYSEELAFIHAGHCSRVIDFAWNGNEPLMMASVSYDNILQLWQ 1244
            WK N P +Y+L     L WPS T QW+P     E+K  D++  +I++GT A+EE++ L+ A   + N  +    +   A+ K      G +     I+  +NH G +NRARY+PQ  +++ATKSS  + +++            G C   L L GHS EG+G+SWN +  G LL+ + D TI  +DI+ +         LN      GH+  VEDVCWH     +FGSVG D+ LLIWD R       S P  +V+AH+ D   L ++P +  +L TG  D  + LWD R +  +L ++   E S+ ++ WS  +ET+  S G  +K+H+WD++K G       +E+ +  ELA IH+GH   V D  W+      +ASV+ DN++ +WQ
Sbjct:   12 WKINCPLMYNLAHFDTLDWPSFTCQWLP----FEEKHEDHTIYKILLGTHADEEENKLIYADYIISNSNEADSIQINGADNKSRLPLNGKLV----ITKTVNHKGDVNRARYMPQNSSIVATKSSEKDSFIY----------SDGNCL--LTLSGHSDEGYGISWNQQVEGRLLTCSFDQTICAFDISQSAGGS----TLNPARTITGHQDKVEDVCWHPAEANIFGSVGDDQRLLIWDYRRKEASSSSGPVQQVVAHAGDANCLSWHPVTSCLLLTGGADGLVHLWDQRKLVSAL-HVFDTEASVYRVAWSPLQETLFLSAGLQHKIHIWDVEKIGDDVLSYDEEDRFPAELAMIHSGHADAVTDIDWHPYLKATVASVAEDNMVNVWQ 376          

HSP 2 Score: 61.6178 bits (148), Expect = 3.539e-10
Identity = 45/187 (24.06%), Postives = 78/187 (41.71%), Query Frame = 3
Query:  447 PQCPNVIATKSSNGNVYLFDYTRHPSKPDQSGKCKPDLVLKGHSQEGFGLSWNIKNAGVLLSSAVDGTIQLWDINCTPENKNDFKVLNSLSQYLGHEGSVEDVCWHKFSDQLFGSVGVDKNLLIWD------------RRESKPAVKVMAHS---DDVVTLDFNPFSEYILATGSEDKTIGLWDLRN 962
            P   N+  +   +  + ++DY R     + S    P   +  H+ +   LSW+   + +LL+   DG + LWD           + L S       E SV  V W    + LF S G+   + IWD              +  PA   M HS   D V  +D++P+ +  +A+ +ED  + +W +++
Sbjct:  207 PAEANIFGSVGDDQRLLIWDYRR----KEASSSSGPVQQVVAHAGDANCLSWHPVTSCLLLTGGADGLVHLWDQ----------RKLVSALHVFDTEASVYRVAWSPLQETLFLSAGLQHKIHIWDVEKIGDDVLSYDEEDRFPAELAMIHSGHADAVTDIDWHPYLKATVASVAEDNMVNVWQIKD 379          
The following BLAST results are available for this feature:
BLAST of retinoblastoma binding protein-1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
RBBP42.238e-15153.45RB binding protein 4, chromatin remodeling factor ... [more]
RBBP43.382e-15153.45RB binding protein 4, chromatin remodeling factor ... [more]
RBBP44.961e-15153.61RB binding protein 4, chromatin remodeling factor ... [more]
RBBP78.817e-14651.15RB binding protein 7, chromatin remodeling factor ... [more]
RBBP76.470e-14551.15RB binding protein 7, chromatin remodeling factor ... [more]
back to top
BLAST of retinoblastoma binding protein-1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
lin-532.056e-13550.00Probable histone-binding protein lin-53 [Source:U... [more]
rba-11.247e-11344.16Probable histone-binding protein rba-1 [Source:Un... [more]
Y54H5A.18.336e-1823.53pep chromosome:WBcel235:III:5153543:5155465:1 gene... [more]
Y54H5A.18.336e-1823.53pep chromosome:WBcel235:III:5153464:5155465:1 gene... [more]
Y54H5A.18.336e-1823.53pep chromosome:WBcel235:III:5153406:5155436:1 gene... [more]
back to top
BLAST of retinoblastoma binding protein-1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Caf1-555.728e-15253.96gene:FBgn0263979 transcript:FBtr0301845[more]
Caf1-556.057e-15253.96gene:FBgn0263979 transcript:FBtr0083052[more]
l(2)098513.780e-2728.28gene:FBgn0022288 transcript:FBtr0335269[more]
l(2)098513.780e-2728.28gene:FBgn0022288 transcript:FBtr0086043[more]
Pex71.776e-2426.43gene:FBgn0035922 transcript:FBtr0076568[more]
back to top
BLAST of retinoblastoma binding protein-1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rbbp41.711e-15153.20retinoblastoma binding protein 4 [Source:NCBI gene... [more]
rbb4l1.345e-15053.20retinoblastoma binding protein 4, like [Source:NCB... [more]
rbb4l8.031e-14953.06retinoblastoma binding protein 4, like [Source:NCB... [more]
rbb4l8.031e-14953.06retinoblastoma binding protein 4, like [Source:NCB... [more]
CR450764.73.709e-3159.52pep chromosome:GRCz11:CHR_ALT_CTG11_3_1:12801933:1... [more]
back to top
BLAST of retinoblastoma binding protein-1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rbbp43.713e-15251.44retinoblastoma binding protein 4 [Source:NCBI gene... [more]
rbbp41.291e-15053.20retinoblastoma binding protein 4 [Source:NCBI gene... [more]
rbbp41.712e-15051.46retinoblastoma binding protein 4 [Source:NCBI gene... [more]
rbbp72.006e-14850.49retinoblastoma binding protein 7 [Source:NCBI gene... [more]
rbbp72.589e-14852.17retinoblastoma binding protein 7 [Source:NCBI gene... [more]
back to top
BLAST of retinoblastoma binding protein-1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Rbbp41.537e-15153.45retinoblastoma binding protein 4, chromatin remode... [more]
Rbbp75.029e-14651.15retinoblastoma binding protein 7, chromatin remode... [more]
Rbbp71.140e-13749.87retinoblastoma binding protein 7, chromatin remode... [more]
Rbbp72.653e-12750.87retinoblastoma binding protein 7, chromatin remode... [more]
Rbbp78.120e-7751.38retinoblastoma binding protein 7, chromatin remode... [more]
back to top
BLAST of retinoblastoma binding protein-1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q24572|CAF1_DROME6.071e-15153.96Probable histone-binding protein Caf1 OS=Drosophil... [more]
sp|Q60972|RBBP4_MOUSE1.075e-15053.45Histone-binding protein RBBP4 OS=Mus musculus OX=1... [more]
sp|Q09028|RBBP4_HUMAN1.075e-15053.45Histone-binding protein RBBP4 OS=Homo sapiens OX=9... [more]
sp|Q3MHL3|RBBP4_BOVIN1.075e-15053.45Histone-binding protein RBBP4 OS=Bos taurus OX=991... [more]
sp|Q9W7I5|RBBP4_CHICK1.199e-15053.45Histone-binding protein RBBP4 OS=Gallus gallus OX=... [more]
back to top
BLAST of retinoblastoma binding protein-1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
I1ZIK20.000e+096.76Retinoblastoma binding protein-1 OS=Schmidtea medi... [more]
A0A2P2IAN42.982e-15255.24Histone-binding protein Caf1 OS=Hirondellea gigas ... [more]
A0A1B6J9A24.133e-15254.99WD_REPEATS_REGION domain-containing protein OS=Hom... [more]
A0A1B6LW564.133e-15254.99WD_REPEATS_REGION domain-containing protein OS=Gra... [more]
A0A1B6F3K34.133e-15254.99WD_REPEATS_REGION domain-containing protein OS=Cue... [more]
back to top
BLAST of retinoblastoma binding protein-1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rbbp45.868e-15253.45RB binding protein 4, chromatin remodeling factor ... [more]
rbb4l8.961e-15052.81histone-binding protein RBBP7 [Source:NCBI gene;Ac... [more]
pex78.685e-2323.99peroxisomal biogenesis factor 7 [Source:NCBI gene;... [more]
grwd13.914e-1924.75glutamate rich WD repeat containing 1 [Source:NCBI... [more]
taf57.856e-1932.07TATA-box binding protein associated factor 5 [Sour... [more]
back to top
BLAST of retinoblastoma binding protein-1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000008002.15.003e-15052.94pep scaffold:Pmarinus_7.0:GL477852:421:9512:1 gene... [more]
pex72.796e-2228.64peroxisomal biogenesis factor 7 [Source:ZFIN;Acc:Z... [more]
pwp11.262e-1426.54PWP1 homolog, endonuclein [Source:ZFIN;Acc:ZDB-GEN... [more]
taf5l1.223e-1327.31TAF5-like RNA polymerase II, p300/CBP-associated f... [more]
snrnp402.170e-1323.53small nuclear ribonucleoprotein 40 (U5) [Source:ZF... [more]
back to top
BLAST of retinoblastoma binding protein-1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
HAT24.472e-7034.85Subunit of the Hat1p-Hat2p histone acetyltransfera... [more]
MSI12.017e-5130.41Subunit of chromatin assembly factor I (CAF-1); ch... [more]
RRB17.145e-2525.92Specific chaperone for ribosomal protein Rpl3p; bi... [more]
YPL247C_mRNA5.069e-1526.79Putative protein of unknown function; green fluore... [more]
SEC317.744e-1427.12Component of the Sec13p-Sec31p complex of the COPI... [more]
back to top
BLAST of retinoblastoma binding protein-1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO420582.167e-14952.69Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO349801.845e-2724.71Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO388183.058e-2225.00Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO292883.418e-1929.13Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO330601.171e-1830.30Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of retinoblastoma binding protein-1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rbbp42.778e-15253.45RB binding protein 4, chromatin remodeling factor ... [more]
rbb4l5.430e-14853.32histone-binding protein RBBP7 [Source:NCBI gene;Ac... [more]
rbb4l5.097e-14250.12histone-binding protein RBBP7 [Source:NCBI gene;Ac... [more]
grwd11.316e-2227.24glutamate rich WD repeat containing 1 [Source:NCBI... [more]
pex72.741e-2231.02peroxisomal biogenesis factor 7 [Source:NCBI gene;... [more]
back to top
BLAST of retinoblastoma binding protein-1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000007931.10.000e+099.25SMESG000007931.1[more]
SMESG000007931.10.000e+094.26SMESG000007931.1[more]
SMESG000062893.12.724e-12945.04SMESG000062893.1[more]
SMESG000055161.12.208e-8285.92SMESG000055161.1[more]
SMESG000037114.12.020e-7135.38SMESG000037114.1[more]
back to top
Cross References
External references for this transcript
DatabaseAccession
SmedGD GBrowseSMED30000072
GenBankAFJ24856.1
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30000072 ID=SMED30000072|Name=retinoblastoma binding protein-1|organism=Schmidtea mediterranea sexual|type=transcript|length=1273bp
TTTTAAAATAGAAATTATTTGTTTGTTCAAAATTTCTTTGTTTTACAGCA
GTTAAGTATACAATGATTGAAGAGCTTTCTAATGATAGCAATAGTTTTTG
CAAAGATTATATCAGATGGAAAAAGAATACCCCGTTTTTATATGATTTGG
TAATGACTCATAATTTAACTTGGCCTAGTCTAACAGTTCAATGGATGCCA
GATATAACTAGACTTGAAGATAAGGATTATTCCACTCAACGAATTATAGT
TGGTACACAAGCTGAAGAAGAACAAGATTATCTTCTCATTGCATCAGTGA
CTGTACCAAATGAATATAAATGCTTCGAATCCAAACATTATGATGCTGAG
AAAGATGAATTTGGAGGATATGGTTTAGTTACTGCTCATACAGATATTAG
TATTAAAATTAATCATGATGGATGTATAAATAGGGCTAGATATTTACCTC
AATGTCCTAATGTAATCGCAACTAAATCATCTAATGGAAATGTATATTTA
TTTGATTATACGAGACATCCCAGCAAGCCTGATCAAAGTGGCAAATGCAA
GCCTGATCTCGTTCTAAAAGGACATTCTCAGGAAGGTTTTGGATTATCTT
GGAATATCAAAAACGCTGGTGTATTACTTAGTTCTGCAGTGGATGGAACA
ATTCAATTGTGGGATATTAATTGTACTCCAGAAAATAAGAATGATTTTAA
AGTTCTTAATTCATTGTCTCAATATTTGGGCCATGAAGGTTCTGTTGAAG
ATGTATGTTGGCATAAATTTAGTGACCAATTGTTTGGTTCGGTTGGGGTT
GATAAAAATCTCTTAATTTGGGATCGCCGAGAGTCTAAACCAGCTGTTAA
AGTTATGGCTCATTCTGATGATGTTGTGACTCTAGACTTTAATCCGTTCT
CAGAATATATTCTTGCCACTGGGAGTGAAGATAAGACTATTGGTTTATGG
GACTTAAGAAACATGGGAGGTAGCTTAAAATATTTACGTGGTCACGAAGG
GTCTATTGGACAGTTACAATGGTCACTCCACAAAGAAACCATATTAGCTT
CAGGAGGCAGTGATAATAAAGTTCATTTGTGGGATTTGAAGAAAACTGGA
ACCTCGAAAGAAAACACTTACAGTGAGGAATTAGCATTTATTCATGCTGG
TCATTGTTCTCGTGTCATTGATTTTGCCTGGAATGGAAATGAGCCATTAA
TGATGGCATCAGTGTCATATGATAATATCCTGCAGTTATGGCAACCATCA
GAATTTTTAAAATTATAGTATTC
back to top

protein sequence of SMED30000072-orf-1

>SMED30000072-orf-1 ID=SMED30000072-orf-1|Name=SMED30000072-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=402bp
MIEELSNDSNSFCKDYIRWKKNTPFLYDLVMTHNLTWPSLTVQWMPDITR
LEDKDYSTQRIIVGTQAEEEQDYLLIASVTVPNEYKCFESKHYDAEKDEF
GGYGLVTAHTDISIKINHDGCINRARYLPQCPNVIATKSSNGNVYLFDYT
RHPSKPDQSGKCKPDLVLKGHSQEGFGLSWNIKNAGVLLSSAVDGTIQLW
DINCTPENKNDFKVLNSLSQYLGHEGSVEDVCWHKFSDQLFGSVGVDKNL
LIWDRRESKPAVKVMAHSDDVVTLDFNPFSEYILATGSEDKTIGLWDLRN
MGGSLKYLRGHEGSIGQLQWSLHKETILASGGSDNKVHLWDLKKTGTSKE
NTYSEELAFIHAGHCSRVIDFAWNGNEPLMMASVSYDNILQLWQPSEFLK
L*
back to top
Aliases
The feature 'retinoblastoma binding protein-1' has the following synonyms
Synonym
RBP1
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000014zeta neoblast
PLANA:0000099neuron
PLANA:0000420parapharyngeal region
PLANA:0000429neoblast
PLANA:0002109X1 cell
PLANA:0002111X2 cell
Vocabulary: INTERPRO
TermDefinition
IPR036322WD40_repeat_dom_sf
IPR020472G-protein_beta_WD-40_rep
IPR001680WD40_repeat
IPR015943WD40/YVTN_repeat-like_dom_sf
IPR022052Histone-bd_RBBP4_N
IPR019775WD40_repeat_CS
IPR017986WD40_repeat_dom
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR020472G-protein beta WD-40 repeatPRINTSPR00320GPROTEINBRPTcoord: 284..298
score: 44.79
coord: 328..342
score: 40.15
coord: 188..202
score: 37.13
IPR001680WD40 repeatSMARTSM00320WD40_4coord: 257..297
e-value: 8.1E-6
score: 35.3
coord: 161..201
e-value: 0.0033
score: 26.7
coord: 211..254
e-value: 1.2E-4
score: 31.5
coord: 109..148
e-value: 2.2
score: 14.9
coord: 354..394
e-value: 0.008
score: 25.4
coord: 301..341
e-value: 4.4E-6
score: 36.2
IPR001680WD40 repeatPFAMPF00400WD40coord: 305..341
e-value: 0.0025
score: 18.6
coord: 266..297
e-value: 6.2E-4
score: 20.5
coord: 218..254
e-value: 0.0016
score: 19.2
IPR001680WD40 repeatPROSITEPS50082WD_REPEATS_2coord: 308..350
score: 12.948
IPR001680WD40 repeatPROSITEPS50082WD_REPEATS_2coord: 168..203
score: 10.709
IPR001680WD40 repeatPROSITEPS50082WD_REPEATS_2coord: 221..263
score: 8.704
IPR001680WD40 repeatPROSITEPS50082WD_REPEATS_2coord: 264..300
score: 13.048
IPR022052Histone-binding protein RBBP4, N-terminalPFAMPF12265CAF1C_H4-bdcoord: 16..83
e-value: 3.5E-25
score: 88.0
IPR015943WD40/YVTN repeat-like-containing domain superfamilyGENE3DG3DSA:2.130.10.10coord: 2..399
e-value: 5.7E-130
score: 436.1
NoneNo IPR availablePANTHERPTHR22850WD40 REPEAT FAMILYcoord: 12..398
NoneNo IPR availablePANTHERPTHR22850:SF90HISTONE-BINDING PROTEIN RBBP4coord: 12..398
IPR019775WD40 repeat, conserved sitePROSITEPS00678WD_REPEATS_1coord: 188..202
IPR019775WD40 repeat, conserved sitePROSITEPS00678WD_REPEATS_1coord: 284..298
IPR019775WD40 repeat, conserved sitePROSITEPS00678WD_REPEATS_1coord: 328..342
IPR017986WD40-repeat-containing domainPROSITEPS50294WD_REPEATS_REGIONcoord: 168..401
score: 33.801
IPR036322WD40-repeat-containing domain superfamilySUPERFAMILYSSF50978WD40 repeat-likecoord: 117..396