hypothetical protein

Overview
Namehypothetical protein (AHY82417.1)
Smed IDSMED30000059
Length (bp)758
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of hypothetical protein (SMED30000059) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for hypothetical protein (SMED30000059) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30000059

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 10

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30000059h1SMcG0003314 Contig3012uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30000059h1SMcG0003314 Contig3012newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30000059h1SMcG0017055 Contig3012uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30000059h1SMcG0017055 Contig3012newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
parapharyngeal regionSMED30000059h1SMcG0017055 SmedASXL_004617SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
nervous systemSMED30000059h1SMcG0017055 dd_Smed_v4_6448_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30000059h1SMcG0017055 dd_Smed_v4_6448_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30000059h1SMcG0017055 dd_Smed_v4_6448_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30000059h1SMcG0017055 dd_Smed_v4_6448_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30000059h1SMcG0017055 dd_Smed_v4_6448_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of hypothetical protein vs. TrEMBL
Match: A0A023ZS25 (Uncharacterized protein (Fragment) OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 256.144 bits (653), Expect = 4.249e-84
Identity = 124/124 (100.00%), Postives = 124/124 (100.00%), Query Frame = 1
Query:  295 MITKSDLIKLPSNIERNVMEEEGLLLNNVKIIFEEFQSTAKDGSWEYFNRIYGKAYKMSAVSIFQFLMKDTLSIVKRLSNCNREIMGIHCARSILQIDQGLLIEGCSLGYNKMSSLAPRIIENW 666
            MITKSDLIKLPSNIERNVMEEEGLLLNNVKIIFEEFQSTAKDGSWEYFNRIYGKAYKMSAVSIFQFLMKDTLSIVKRLSNCNREIMGIHCARSILQIDQGLLIEGCSLGYNKMSSLAPRIIENW
Sbjct:    1 MITKSDLIKLPSNIERNVMEEEGLLLNNVKIIFEEFQSTAKDGSWEYFNRIYGKAYKMSAVSIFQFLMKDTLSIVKRLSNCNREIMGIHCARSILQIDQGLLIEGCSLGYNKMSSLAPRIIENW 124          
BLAST of hypothetical protein vs. Planmine SMEST
Match: SMESG000066598.1 (SMESG000066598.1)

HSP 1 Score: 433.721 bits (1114), Expect = 3.269e-156
Identity = 213/213 (100.00%), Postives = 213/213 (100.00%), Query Frame = 1
Query:   85 SVRRGIVDKLNDIKYAVSSTPRQLDGALSDLAEVGPELFEACSNFKVGESKIPILLDITEFLINLNQQLPMITKSDLIKLPSNIERNVMEEEGLLLNNVKIIFEEFQSTAKDGSWEYFNRIYGKAYKMSAVSIFQFLMKDTLSIVKRLSNCNREIMGIHCARSILQIDQGLLIEGCSLGYNKMSSLAPRIIENWKIRLGKLLSFCKKQISECR 723
            SVRRGIVDKLNDIKYAVSSTPRQLDGALSDLAEVGPELFEACSNFKVGESKIPILLDITEFLINLNQQLPMITKSDLIKLPSNIERNVMEEEGLLLNNVKIIFEEFQSTAKDGSWEYFNRIYGKAYKMSAVSIFQFLMKDTLSIVKRLSNCNREIMGIHCARSILQIDQGLLIEGCSLGYNKMSSLAPRIIENWKIRLGKLLSFCKKQISECR
Sbjct:   17 SVRRGIVDKLNDIKYAVSSTPRQLDGALSDLAEVGPELFEACSNFKVGESKIPILLDITEFLINLNQQLPMITKSDLIKLPSNIERNVMEEEGLLLNNVKIIFEEFQSTAKDGSWEYFNRIYGKAYKMSAVSIFQFLMKDTLSIVKRLSNCNREIMGIHCARSILQIDQGLLIEGCSLGYNKMSSLAPRIIENWKIRLGKLLSFCKKQISECR 229          
BLAST of hypothetical protein vs. Planmine SMEST
Match: SMESG000037569.1 (SMESG000037569.1)

HSP 1 Score: 51.9878 bits (123), Expect = 1.372e-7
Identity = 32/123 (26.02%), Postives = 59/123 (47.97%), Query Frame = 1
Query:  373 NNVKIIFEEFQSTAKDGSWEYFNRIYGKAYKMSAVSIFQFLMKDT-------LSIVKRLSNCNREIMGIHCARSILQIDQGLLIEGCSLGYNKMSSLAPRIIENWKIRLGKLLSFCKKQISEC 720
            NN K + +  +   K+G +++F + Y  +++ +  +I+  +   T       +++ K    CN   +   C   I  I++GL IEG  +GY   SS A    E+WK+++  L+  C   I  C
Sbjct:  145 NNYKALEDAQRENTKEG-YQFFAKQYENSFEFATENIYDAMTGSTGPFGFNMVNLYKTNVKCNPVRLSQFCTMGISLINKGLTIEGAYIGYLNFSSKAEAKAESWKVKIDALMKQCSSLIESC 266          
BLAST of hypothetical protein vs. Planmine SMEST
Match: SMESG000046431.1 (SMESG000046431.1)

HSP 1 Score: 51.9878 bits (123), Expect = 1.490e-7
Identity = 55/223 (24.66%), Postives = 104/223 (46.64%), Query Frame = 1
Query:  112 LNDIKYAV-SSTPRQLDGALSD-LAEVGP------ELFEACSNFKVG-ESKIPILLDITEFLINLNQQLPMITKSDLIKLPSNIERNVMEEEGL-LLNNVKIIFEEFQSTAKDG---SWEYFNRIYGKAYKMSAVSIFQFLMKDT-------LSIVKRLSNCNREIMGIHCARSILQIDQGLLIEGCSLGYNKMSSLAPRIIENWKIRLGKLLSFCKKQISEC 720
            +N+IK  V S  P+++   +S  L ++GP       L    ++F V  + +   L  I E    LN +L ++T   L  L + +E +      +  ++ +  ++E    T KD    S+ +F + Y K+YK +A +++  L   +       +++ K    CN   +   C   I  I++GL IEG  LG+   ++     +E WK +L ++   C+  +S+C
Sbjct:   46 INNIKNLVKSGKPKEMFSKISGVLKKLGPLKMSISALISNFTSFSVKPKEESAELKAINEGFEKLNDRLDLLTMK-LGNLDTLVEISAARAAYVQTVSTINHLYESLTDTTKDNTKESYAFFAKQYEKSYKFAAANLYDALTGSSGSFGFNLINLYKDHVKCNTVSLMEFCVMGIHLINKGLSIEGAYLGFIDFNAKIEAKMETWKGKLDEISQRCEGLVSQC 267          
BLAST of hypothetical protein vs. Planmine SMEST
Match: SMESG000027653.1 (SMESG000027653.1)

HSP 1 Score: 51.9878 bits (123), Expect = 1.490e-7
Identity = 55/223 (24.66%), Postives = 104/223 (46.64%), Query Frame = 1
Query:  112 LNDIKYAV-SSTPRQLDGALSD-LAEVGP------ELFEACSNFKVG-ESKIPILLDITEFLINLNQQLPMITKSDLIKLPSNIERNVMEEEGL-LLNNVKIIFEEFQSTAKDG---SWEYFNRIYGKAYKMSAVSIFQFLMKDT-------LSIVKRLSNCNREIMGIHCARSILQIDQGLLIEGCSLGYNKMSSLAPRIIENWKIRLGKLLSFCKKQISEC 720
            +N+IK  V S  P+++   +S  L ++GP       L    ++F V  + +   L  I E    LN +L ++T   L  L + +E +      +  ++ +  ++E    T KD    S+ +F + Y K+YK +A +++  L   +       +++ K    CN   +   C   I  I++GL IEG  LG+   ++     +E WK +L ++   C+  +S+C
Sbjct:   46 INNIKNLVKSGKPKEMFSKISGVLKKLGPLKMSISALISNFTSFSVKPKEESAELKAINEGFEKLNDRLDLLTMK-LGNLDTLVEISAARAAYVQTVSTINHLYESLTDTTKDNTKESYAFFAKQYEKSYKFAAANLYDALTGSSGSFGFNLINLYKDHVKCNTVSLMEFCVMGIHLINKGLSIEGAYLGFIDFNAKIEAKMETWKGKLDEISQRCEGLVSQC 267          
BLAST of hypothetical protein vs. Planmine SMEST
Match: SMESG000027656.1 (SMESG000027656.1)

HSP 1 Score: 49.2914 bits (116), Expect = 1.358e-6
Identity = 29/123 (23.58%), Postives = 57/123 (46.34%), Query Frame = 1
Query:  373 NNVKIIFEEFQSTAKDGSWEYFNRIYGKAYKMSAVSIFQFLMKDT-------LSIVKRLSNCNREIMGIHCARSILQIDQGLLIEGCSLGYNKMSSLAPRIIENWKIRLGKLLSFCKKQISEC 720
            NN + + E  +S +K+G ++YF + Y  +++ +  +++  +   T       +++ K    CN   +   C   +  I +GL +EG  LGY   S+ A    E W  ++ ++   C   I  C
Sbjct:  141 NNYETLNEAKKSNSKEG-YDYFAKQYENSFEFATANMYDAMTGSTGPFGFNMVNLYKTHVRCNPVKLSQFCTMGLQLITKGLTVEGAYLGYMNFSAKAKGKTETWTTKINEVSKQCSAVIEAC 262          
The following BLAST results are available for this feature:
BLAST of hypothetical protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of hypothetical protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of hypothetical protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of hypothetical protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of hypothetical protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of hypothetical protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of hypothetical protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of hypothetical protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 1
Match NameE-valueIdentityDescription
A0A023ZS254.249e-84100.00Uncharacterized protein (Fragment) OS=Schmidtea me... [more]
back to top
BLAST of hypothetical protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of hypothetical protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of hypothetical protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of hypothetical protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of hypothetical protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of hypothetical protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000066598.13.269e-156100.00SMESG000066598.1[more]
SMESG000037569.11.372e-726.02SMESG000037569.1[more]
SMESG000046431.11.490e-724.66SMESG000046431.1[more]
SMESG000027653.11.490e-724.66SMESG000027653.1[more]
SMESG000027656.11.358e-623.58SMESG000027656.1[more]
back to top
Cross References
External references for this transcript
DatabaseAccession
SmedGD GBrowseSMED30000059
GenBankAHY82417.1
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30000059 ID=SMED30000059|Name=hypothetical protein|organism=Schmidtea mediterranea sexual|type=transcript|length=758bp
GAATTAGTCGAATGCCTAATAATTTTATAATTAAAAATGCTTAAATACAT
TTTCATTTTGTTATTTTTACTTCTGGGCATAAAATCAGTGAGAAGAGGAA
TTGTCGACAAGCTTAATGATATTAAATATGCAGTGAGCTCTACCCCAAGA
CAACTCGACGGAGCTCTGTCTGACCTAGCAGAAGTGGGACCTGAGTTATT
TGAGGCTTGTTCAAATTTTAAAGTTGGAGAGTCAAAGATTCCAATTCTTT
TAGACATTACCGAATTTTTGATAAATTTAAATCAGCAATTGCCAATGATT
ACAAAGTCGGATTTAATAAAACTTCCATCAAATATCGAAAGAAATGTAAT
GGAAGAAGAGGGGCTTTTATTAAACAATGTTAAAATAATTTTTGAAGAAT
TTCAATCAACAGCTAAAGACGGAAGTTGGGAATATTTCAATCGAATTTAT
GGAAAAGCTTACAAAATGTCTGCTGTATCAATATTTCAATTTTTAATGAA
AGACACTTTGTCAATTGTAAAACGGTTATCGAATTGCAACAGAGAAATTA
TGGGAATTCACTGTGCAAGATCAATTCTTCAAATTGATCAAGGTTTACTG
ATTGAAGGATGCTCTCTTGGATATAATAAAATGTCGAGTCTCGCGCCACG
AATAATTGAGAACTGGAAAATAAGATTAGGAAAACTGTTATCATTCTGTA
AAAAGCAAATATCAGAATGTAGATGATTTATAATTTAAATATATATTCTT
GATTTAAA
back to top

protein sequence of SMED30000059-orf-1

>SMED30000059-orf-1 ID=SMED30000059-orf-1|Name=SMED30000059-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=230bp
MLKYIFILLFLLLGIKSVRRGIVDKLNDIKYAVSSTPRQLDGALSDLAEV
GPELFEACSNFKVGESKIPILLDITEFLINLNQQLPMITKSDLIKLPSNI
ERNVMEEEGLLLNNVKIIFEEFQSTAKDGSWEYFNRIYGKAYKMSAVSIF
QFLMKDTLSIVKRLSNCNREIMGIHCARSILQIDQGLLIEGCSLGYNKMS
SLAPRIIENWKIRLGKLLSFCKKQISECR*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000070intestinal phagocyte
PLANA:0000099neuron
PLANA:0000420parapharyngeal region
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..20
score: 0.828