Rab-GAP TBC domain-containing protein

Overview
NameRab-GAP TBC domain-containing protein
Smed IDSMED30000054
Length (bp)2895
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Rab-GAP TBC domain-containing protein (SMED30000054) t-SNE clustered cells

Violin plots show distribution of expression levels for Rab-GAP TBC domain-containing protein (SMED30000054) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Rab-GAP TBC domain-containing protein (SMED30000054) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Rab-GAP TBC domain-containing protein (SMED30000054) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30000054

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
protonephridiaSMED30000054SMESG000003946.1 dd_Smed_v4_10066_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30000054SMESG000003946.1 dd_Smed_v4_10066_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30000054SMESG000003946.1 dd_Smed_v4_10066_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30000054SMESG000003946.1 dd_Smed_v4_10066_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Rab-GAP TBC domain-containing protein vs. Ensembl Human
Match: EVI5L (ecotropic viral integration site 5 like [Source:HGNC Symbol;Acc:HGNC:30464])

HSP 1 Score: 429.098 bits (1102), Expect = 6.378e-136
Identity = 272/736 (36.96%), Postives = 428/736 (58.15%), Query Frame = 1
Query:  139 KNRSLQMDSKSVQSLTGLSRKNSVTSEMNVAFTLDDDKIXXXXXXXXXXXADINARHLEKWSNVINNWNQFSRKKSQV-KELMKQSNGVPHHYRPLIWQLITGCNEDNVNSVQLKAIYPEYLKQQSPCEKAIRRDIARTYPQHDLFKDPNGDGQERLFNIMKAYSIHDREVGYCQGSGFIGGLLLIQMPEEDAFVVLVSLMFEHQLRNLYKPNMSELGLCMYQLDCLVEEQLPKLALHFRSHNFHATVYASGWFLTLFTLSFSIELSSRVMDLFMVEGIDIIFKISLAYLTTFQDELLKLDMESMLRFLQSIGPQQLELDPNPLFDLAVQLKLNTRKMKKAEKEYLALKMEEEENHVELRRLRTENGLLLQRIDRLEKECELLNSNYITKNMAYLQQCDEIKILRIDISEAKRKVDNLKQNLSGTEIQL-QLAVGQLNGRINEENNKDIIQKRRSVDVSSDLVHQLQTQLVNIRLKEAETNASFXXXXXXXXXXXXXXXXXXXTPTE-EVAKLQEDLVAIKLREAETGLSLKDSLKRLNELNKLWMNHVDQCHQNLENVQTDSKKDRHSLYEGKDSTNK-DIGILQ---LSRKLVEAEYASDLNAARQKIMETEARQQIYCRQVSRXXXXXXXXXXXXXXYIVIQKKLRLELKEAERRCIDLETKRKEDLMMWKIQKMEMGSIIAELKQKVARMETQREEISTSSRMGHN------KNLPPQIEMKQTSTRLEHQP 2307
            +NR L+ DSKS++S+ G SR+NS +S ++ +    +                        W  + N W ++ R+K ++ KEL+++  G+PHH+R ++WQL+    +     + +K  Y E LK  SPCEK IRRDIARTYP+H+ FK  +  GQE LFN+MKAYS+ DREVGYCQGS FI GLLL+QMPEE+AF V V LM E++LR L+KP+M+ELGLC+YQ + +++EQLP L  HFRS +FH ++YAS WFLTLF  +F + +++RV D+FM EG++I+F++ LA L   Q EL++LDME M ++ Q + P Q +  P+ L   A Q+K N +KMK+ EKEY A+K +E E  +E++RLRTEN LL QRI+ LEKE   L    I   +   Q+ +E  +++ +++  +++  +  ++L   +  + QL   Q N R+ E                 D V  L+T+L   RL+E ET  +    +E   ++ +  +R S  P E  VA+LQE+L A+K+RE +   S ++   +L EL+  W  H+ +  +                   K+S  K  +G LQ   +S +L EA+  ++    RQ+++E E +  I+   ++R++ E   L+EKL+      K L+ +L E+ R+  + E K KE++M  ++++ +  + +AE++Q++A +E QREE     ++ H+      + L  QIE  +   RL   P
Sbjct:   44 QNRLLEADSKSMRSMNG-SRRNSGSSLVSSSSASSNLSHLEEDTWIL-------------WGRIANEWEEWRRRKEKLLKELIRK--GIPHHFRAIVWQLLCSATD-----MPVKNQYSELLKMSSPCEKLIRRDIARTYPEHEFFKGQDSLGQEVLFNVMKAYSLVDREVGYCQGSAFIVGLLLMQMPEEEAFCVFVRLMQEYRLRELFKPSMAELGLCIYQFEYMLQEQLPDLNTHFRSQSFHTSMYASSWFLTLFLTTFPLPVATRVFDIFMYEGLEIVFRVGLALLQVNQAELMQLDMEGMSQYFQRVIPHQFDSCPDKLVLKAYQVKYNPKKMKRLEKEYAAMKSKEMEEQIEIKRLRTENRLLKQRIETLEKESAALADRLIQGQVTRAQEAEENYVIKRELAVVRQQCSSAAEDLQKAQSTIRQLQEQQENPRLTE-----------------DFVSHLETELEQSRLRETETLGAL---REMQDKVLDMEKRNSSLPDENNVAQLQEELKALKVREGQAVASTRELKLQLQELSDTWQAHLARGGR------------------WKESPRKLVVGELQDELMSVRLREAQALAEGRELRQRVVELETQDHIHRNLLNRVEAERAALQEKLQYLAAQNKGLQTQLSESRRKQAEAECKSKEEVMAVRLREADSMAAVAEMRQRIAELEIQREEGRIQGQLNHSDSSQYIRELKDQIEELKAEVRLLKGP 720          
BLAST of Rab-GAP TBC domain-containing protein vs. Ensembl Human
Match: EVI5L (ecotropic viral integration site 5 like [Source:HGNC Symbol;Acc:HGNC:30464])

HSP 1 Score: 418.698 bits (1075), Expect = 3.475e-132
Identity = 273/739 (36.94%), Postives = 420/739 (56.83%), Query Frame = 1
Query:  139 KNRSLQMDSKSVQSLTGLSRKNSVTSEMNVAFTLDDDKIXXXXXXXXXXXADINARHLEKWSNVINNWNQFSRKKSQV-KELMKQSNGVPHHYRPLIWQLITGCNEDNVNSVQLKAIYPEYLKQQSPCEKAIRRDIARTYPQHDLFKDPNGDGQERLFNIMKAYSIHDREVGYCQGSGFIGGLLLIQMPEEDAFVVLVSLMFEHQLRNLYKPNMSELGLCMYQLDCLVEEQLPKLALHFRSHNFHATVYASGWFLTLFTLSFSIELSSRVMDLFMVEGIDIIFKISLAYLTTFQDELLKLDMESMLRFLQSIGPQQLELDPNPLFDLAVQLKLNTRKMKKAEKEYLALKMEEEENHVELRRLRTENGLLLQRIDRLEK----ECELLNSNYITKNMAYLQQCDEIKILRIDISEAKRKVDNLKQNLSGTEIQLQLAVGQLNGRINEENNKDIIQKRRSVDVSSDLVHQLQTQLVNIRLKEAETNASFXXXXXXXXXXXXXXXXXXXTPTE-EVAKLQEDLVAIKLREAETGLSLKDSLKRLNELNKLWMNHVDQCHQNLENVQTDSKKDRHSLYEGKDSTNK-DIGILQ---LSRKLVEAEYASDLNAARQKIMETEARQQIYCRQVSRXXXXXXXXXXXXXXYIVIQKKLRLELKEAERRCIDLETKRKEDLMMWKIQKMEMGSIIAELKQKVARMETQREEISTSSRMGHN------KNLPPQIEMKQTSTRLEHQP 2307
            +NR L+ DSKS++S+ G SR+NS +S ++ +    +                        W  + N W ++ R+K ++ KEL+++  G+PHH+R ++WQL+    +     + +K  Y E LK  SPCEK IRRDIARTYP+H+ FK  +  GQE LFN+MKAYS+ DREVGYCQGS FI GLLL+QMPEE+AF V V LM E++LR L+KP+M+ELGLC+YQ + +++EQLP L  HFRS +FH ++YAS WFLTLF  +F + +++RV D+FM EG++I+F++ LA L   Q EL++LDME M ++ Q + P Q +  P+ L   A Q+K N +KMK+ EKEY A+K +E E  +E++RLRTEN LL QRI+ LEK      +    NY+ K         E+ ++R   S A   +   +  +       QL   Q N R+ E                 D V  L+T+L   RL+E ET  +    +E   ++ +  +R S  P E  VA+LQE+L A+K+RE +   S ++   +L EL+  W  H+ +  +                   K+S  K  +G LQ   +S +L EA+  ++    RQ+++E E +  I+   ++R++ E   L+EKL+      K L+ +L E+ R+  + E K KE++M  ++++ +  + +AE++Q++A +E QREE     ++ H+      + L  QIE  +   RL   P
Sbjct:   44 QNRLLEADSKSMRSMNG-SRRNSGSSLVSSSSASSNLSHLEEDTWIL-------------WGRIANEWEEWRRRKEKLLKELIRK--GIPHHFRAIVWQLLCSATD-----MPVKNQYSELLKMSSPCEKLIRRDIARTYPEHEFFKGQDSLGQEVLFNVMKAYSLVDREVGYCQGSAFIVGLLLMQMPEEEAFCVFVRLMQEYRLRELFKPSMAELGLCIYQFEYMLQEQLPDLNTHFRSQSFHTSMYASSWFLTLFLTTFPLPVATRVFDIFMYEGLEIVFRVGLALLQVNQAELMQLDMEGMSQYFQRVIPHQFDSCPDKLVLKAYQVKYNPKKMKRLEKEYAAMKSKEMEEQIEIKRLRTENRLLKQRIETLEKGQVTRAQEAEENYVIKR--------ELAVVRQQCSSAAEDLQKAQSTIR------QLQEQQENPRLTE-----------------DFVSHLETELEQSRLRETETLGAL---REMQDKVLDMEKRNSSLPDENNVAQLQEELKALKVREGQAVASTRELKLQLQELSDTWQAHLARGGR------------------WKESPRKLVVGELQDELMSVRLREAQALAEGRELRQRVVELETQDHIHRNLLNRVEAERAALQEKLQYLAAQNKGLQTQLSESRRKQAEAECKSKEEVMAVRLREADSMAAVAEMRQRIAELEIQREEGRIQGQLNHSDSSQYIRELKDQIEELKAEVRLLKGP 709          
BLAST of Rab-GAP TBC domain-containing protein vs. Ensembl Human
Match: EVI5 (ecotropic viral integration site 5 [Source:HGNC Symbol;Acc:HGNC:3501])

HSP 1 Score: 413.69 bits (1062), Expect = 5.354e-130
Identity = 264/705 (37.45%), Postives = 413/705 (58.58%), Query Frame = 1
Query:  118 LLAKLEEKNRSLQMDSKSVQSLTGLSRKNSVTSEMNVAFTLDDDKIXXXXXXXXXXXADINARHLEKWSNVINNWNQFSRKK-SQVKELMKQSNGVPHHYRPLIWQLITGCNEDNVNSVQLKAIYPEYLKQQSPCEKAIRRDIARTYPQHDLFKDPNGDGQERLFNIMKAYSIHDREVGYCQGSGFIGGLLLIQMPEEDAFVVLVSLMFEHQLRNLYKPNMSELGLCMYQLDCLVEEQLPKLALHFRSHNFHATVYASGWFLTLFTLSFSIELSSRVMDLFMVEGIDIIFKISLAYLTTFQDELLKLDMESMLRFLQSIGPQQLELDPNPLFDLAVQLKLNTRKMKKAEKEYLALKMEEEENHVELRRLRTENGLLLQRIDRLEKECELLNSNYITKNMAYLQQCDEIKILRIDISEAKRKVDNLKQNLSGTEIQLQLAVGQLNGRINEENNKDIIQKRRSVDVSSDLVHQLQTQLVNIRLKEAETNASFXXXXXXXXXXXXXXXXXXXTPTEE-VAKLQEDLVAIKLREAETGLSLKDSLKRLNELNKLWMNHVDQCHQNLENVQTDSKKD---RHSLYEGKDSTNKDIGILQLSRKLVEAEYASDLNAARQKIMETEARQQIYCRQVSRXXXXXXXXXXXXXXYIVIQKKLRLELKEAERRCIDLETKRKEDLMMWKIQKMEMGSIIAELKQKVARMETQREE 2217
            LLAKLEE+NR L+ DSKS++S+ G SR+NS +S ++ +    +       +                W  ++N W    +KK  QVKEL+ +  G+PHH+R ++WQL+  C+     S+ +K  Y E LK  SPCEK IRRDIARTYP+H+ FK+ +  GQE LFN+MKAYS+ DREVGYCQGS FI GLLL+QMPEE+AF V V LM +++LR L+KP+M+ELGLCMYQ +C+++E LP+L +HF+S +FH ++YAS WFLT+F  +F + +++R+ D+FM EG++I+F++ LA L   Q EL++LDME ML+  Q + P Q +  P+ L   A Q+K N++KMKK EKEY  +K +E E  VE              I RL  E  LL                            K++++ L++  +    +L                   IQ + S + + D V QL+ +LV  RL EAE+  + +E+++K  ++E+ N      P E  +A+LQE+L+A+KLREAE  + LK+  +++ +L + W  H+ +         T   KD   ++++ E +D          ++ +L EAE  +++   +Q++ME E + QI    + R ++E+I L+EK++      K L  +L EA+R+  ++E K KE++M  ++++ +  + +AEL+Q +A +E Q+EE
Sbjct:   85 LLAKLEEQNRLLETDSKSLRSVNG-SRRNSGSSLVSSSSASSNLSHLEEDSWIL-------------WGRIVNEWEDVRKKKEKQVKELVHK--GIPHHFRAIVWQLL--CS---AQSMPIKDQYSELLKMTSPCEKLIRRDIARTYPEHNFFKEKDSLGQEVLFNVMKAYSLVDREVGYCQGSAFIVGLLLMQMPEEEAFCVFVKLMQDYRLRELFKPSMAELGLCMYQFECMIQEHLPELFVHFQSQSFHTSMYASSWFLTIFLTTFPLPIATRIFDIFMSEGLEIVFRVGLALLQMNQAELMQLDMEGMLQHFQKVIPHQFDGVPDKLIQAAYQVKYNSKKMKKLEKEYTTIKTKEMEEQVE--------------IKRLRTENRLL----------------------------KQRIETLEKESASLADRL-------------------IQHKCSSNYNEDFVLQLEKELVQARLSEAESQCALKEMQDKVLDIEKRNNS---LPDENNIARLQEELIAVKLREAEAIMGLKELRQQVKDLEEHWQRHLART--------TGRWKDPPKKNAMNELQDEL--------MTIRLREAETQAEIREIKQRMMEMETQNQINSNHLRRAEQEVISLQEKVQYLSAQNKGLLTQLSEAKRKQAEIECKNKEEVMAVRLREADSIAAVAELRQHIAELEIQKEE 688          
BLAST of Rab-GAP TBC domain-containing protein vs. Ensembl Human
Match: EVI5 (ecotropic viral integration site 5 [Source:HGNC Symbol;Acc:HGNC:3501])

HSP 1 Score: 397.897 bits (1021), Expect = 4.794e-124
Identity = 251/642 (39.10%), Postives = 392/642 (61.06%), Query Frame = 1
Query:  118 LLAKLEEKNRSLQMDSKSVQSLTGLSRKNSVTSEMNVAFTLDDDKIXXXXXXXXXXXADINARHLEKWSNVINNWNQFSRKK-SQVKELMKQSNGVPHHYRPLIWQLITGCNEDNVNSVQLKAIYPEYLKQQSPCEKAIRRDIARTYPQHDLFKDPNGDGQERLFNIMKAYSIHDREVGYCQGSGFIGGLLLIQMPEEDAFVVLVSLMFEHQLRNLYKPNMSELGLCMYQLDCLVEEQLPKLALHFRSHNFHATVYASGWFLTLFTLSFSIELSSRVMDLFMVEGIDIIFKISLAYLTTFQDELLKLDMESMLRFLQSIGPQQLELDPNPLFDLAVQLKLNTRKMKKAEKEYLALKMEEEENHVELRRLRTENGLLLQRIDRLEK-ECELLNSNYITKNMAYLQQCDEIKILRIDISEAKRKVDNLKQNLSGTEIQLQLAVGQLNGRINEENNKDIIQKRRSVDVSSDLVHQLQTQLVNIRLKEAETNASFXXXXXXXXXXXXXXXXXXXTPT---------EEVAKLQEDLVAIKLREAETGLSLKDSLKRLNEL---NKLWMNHVDQCHQNL----ENVQTDSKKDRHSLYEGKDSTNKDIGI------LQLSRKLVEAEYASDLNAARQKIMETEARQQ 1971
            LLAKLEE+NR L+ DSKS++S+ G SR+NS +S ++ +    +       +                W  ++N W    +KK  QVKEL+ +  G+PHH+R ++WQL+  C+     S+ +K  Y E LK  SPCEK IRRDIARTYP+H+ FK+ +  GQE LFN+MKAYS+ DREVGYCQGS FI GLLL+QMPEE+AF V V LM +++LR L+KP+M+ELGLCMYQ +C+++E LP+L +HF+S +FH ++YAS WFLT+F  +F + +++R+ D+FM EG++I+F++ LA L   Q EL++LDME ML+  Q + P Q +  P+ L   A Q+K N++KMKK EKEY  +K +E E  VE++RLRTEN LL QRI+ LEK +C   +SNY   N  ++ Q  E ++++  +SEA+                 Q A+ ++  ++ +      I+KR +     + + +LQ +L+ ++L+EAE     +EL+++ ++LEE  +R     T           + +LQ++L+ I+LREAET   +++  +R+ E+   N++  NH+ +  Q +    E VQ  S +++  L +  ++  K   I        ++ +L EA+  + +   RQ I E E +++
Sbjct:   85 LLAKLEEQNRLLETDSKSLRSVNG-SRRNSGSSLVSSSSASSNLSHLEEDSWIL-------------WGRIVNEWEDVRKKKEKQVKELVHK--GIPHHFRAIVWQLL--CS---AQSMPIKDQYSELLKMTSPCEKLIRRDIARTYPEHNFFKEKDSLGQEVLFNVMKAYSLVDREVGYCQGSAFIVGLLLMQMPEEEAFCVFVKLMQDYRLRELFKPSMAELGLCMYQFECMIQEHLPELFVHFQSQSFHTSMYASSWFLTIFLTTFPLPIATRIFDIFMSEGLEIVFRVGLALLQMNQAELMQLDMEGMLQHFQKVIPHQFDGVPDKLIQAAYQVKYNSKKMKKLEKEYTTIKTKEMEEQVEIKRLRTENRLLKQRIETLEKHKC---SSNY---NEDFVLQL-EKELVQARLSEAES----------------QCALKEMQDKVLD------IEKRNNSLPDENNIARLQEELIAVKLREAEAIMGLKELRQQVKDLEEHWQRHLARTTGRWKDPPKKNAMNELQDELMTIRLREAETQAEIREIKQRMMEMETQNQINSNHLRRAEQEVISLQEKVQYLSAQNKGLLTQLSEAKRKQAEIECKNKEEVMAVRLREADSIAAVAELRQHIAELEIQKE 676          
BLAST of Rab-GAP TBC domain-containing protein vs. Ensembl Human
Match: RABGAP1 (RAB GTPase activating protein 1 [Source:HGNC Symbol;Acc:HGNC:17155])

HSP 1 Score: 241.506 bits (615), Expect = 1.297e-65
Identity = 143/374 (38.24%), Postives = 217/374 (58.02%), Query Frame = 1
Query:  310 LEKWSNVINNWN-QFSRKKSQVKELMKQSNGVPHHYRPLIWQLITGCNEDNVNSVQLKAIYPEYLKQQSPCEKAIRRDIARTYPQHDLFKDPNGDGQERLFNIMKAYSIHDREVGYCQGSGFIGGLLLIQMPEEDAFVVLVSLMFEHQLRNLYKPNMSELGLCMYQLDCLVEEQLPKLALHFRSHNFHATVYASGWFLTLFTLSFSIELSSRVMDLFMVEGIDIIFKISLAYLTTFQDELLKLDMESMLRFLQSIGPQQLELDPNP--LFDLAVQLKLNTRKMKKAEKEYLALKMEEEENHVELRRLRTENGLLLQRIDRLEKECELLNSNYITKNMAYLQQCDEIKILRIDISEAKRKVDNLKQNLSGTEIQL 1422
            LE W  +++ W+   + +  Q+  L++  NGVP   R  +WQL+ GC+    N+  L   Y   + ++SP + AI RDI RT+P HD FKD  GDGQ+ L+ I KAYS++D E+GYCQG  F+  +LL+ MPEE AF VLV +MF++ LR L+K N  +L    YQL+ L++E +P L  HF   +  A +YAS WFLTLFT  F + +   ++DL + EGI +IF ++L  L T +D+LL  D E  L+F +   P++   + N   L +LA  +K++ +K+KK EKEY  ++ ++ +    + R   EN  L +   RLE+E + L    +T  +A          LR D+  A+ K D L + L  T+ +L
Sbjct:  538 LETWGELLSKWHLNLNVRPKQLSSLVR--NGVPEALRGEVWQLLAGCH----NNDHLVEKYRILITKESPQDSAITRDINRTFPAHDYFKDTGGDGQDSLYKICKAYSVYDEEIGYCQGQSFLAAVLLLHMPEEQAFSVLVKIMFDYGLRELFKQNFEDLHCKFYQLERLMQEYIPDLYNHFLDISLEAHMYASQWFLTLFTAKFPLYMVFHIIDLLLCEGISVIFNVALGLLKTSKDDLLLTDFEGALKFFRVQLPKRYRSEENAKKLMELACNMKISQKKLKKYEKEYHTMREQQAQQEDPIERFERENRRLQEANMRLEQENDDLAHELVTSKIA----------LRKDLDNAEEKADALNKELLMTKQKL 895          
BLAST of Rab-GAP TBC domain-containing protein vs. Ensembl Celegans
Match: eat-17 (pep chromosome:WBcel235:X:16399210:16408873:-1 gene:WBGene00020770.1 transcript:T24D11.1d.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:eat-17)

HSP 1 Score: 387.882 bits (995), Expect = 4.655e-121
Identity = 248/681 (36.42%), Postives = 400/681 (58.74%), Query Frame = 1
Query:  319 WSNVINNWN-QFSRKKSQVKELMKQSNGVPHHYRPLIWQLITGCNEDNVNSVQLKAIYPEYLKQQSPCEKAIRRDIARTYPQHDLFKDPNGDGQERLFNIMKAYSIHDREVGYCQGSGFIGGLLLIQMPEEDAFVVLVSLMFEHQLRNLYKPNMSELGLCMYQLDCLVEEQLPKLALHFRSHNFHATVYASGWFLTLFTLSFSIELSSRVMDLFMVEGIDIIFKISLAYLTTFQDELLKLDMESMLRFLQSIGPQQLELDPNPLFDLAVQLKLNTRKMKKAEKEYLALKMEEEENHVELRRLRTENGLLLQRIDRLEKECELLNSNYITK--NMA-----YLQQCDEIKILRIDISEAKRKVDNLKQNLSGTEIQLQLAVGQLNGRINEENNKDIIQKRRSVDVSS--DLVHQLQTQLVNIRLKEAETNASFXXXXXXXXXXXXXXXXXXXT-PTEEVAKLQEDLVAIKLREAETGLSLKDSLKRLNELNKLWMN--HVDQCHQNLENVQTDSKKDRHSLYE-----------------------GKDSTNKDIGILQLSRKLV-----EAEYASDLNAARQKIMETEARQQIYCRQVSRXXXXXXXXXXXXXXYIVIQKKLRLELKEAERRCIDLETKRKEDLMMWKIQKMEMGSIIAELKQKVARMETQREEISTSSRM 2238
            W  +I NW  +  ++ + +K+L+K+  G+P H+R + WQ     N  N +   +  +Y +Y++Q S  EK I+RDI RTYP+ D FKD    GQ  LFN++KAYS+HD+EVGYCQGS FI GLLL+QMPEE+AF VLVSLM  ++LR LYKP M++LGLCM+QL+CLV++Q+P L  HF +  F  ++YAS WFLTLFT +  +++++R+MD F+VEG+D IF IS+A L   + ELL+LDME ML++ Q    ++ E D + LF +A Q++LN ++MK+ EK+YL  + +E+E  VELRRLRTEN LL QRID LE E   L    +    N+A     Y+    E+  LR   S+  RK++   + +                 ++     +I+     VD +S  + +H LQ +L+    ++A++  + R+ K +  ELE  N+RL +  P+E+VA LQE+L+++K+REAE+ L+LK+  +RL EL + W    HV     +  +++ +S  + HS  +                         + T+  I + +L  +L+     EA+  ++L   RQK+ME E +  +   Q+ R DEE+  ++E  E  +  +K+L  +LK+ + +  + E++  E  +  +++  E    I +L+  ++++E ++ E  T +++
Sbjct:   45 WGELILNWEIEVKKRPNYIKDLVKR--GIPQHFRMIAWQ-----NLSNASVSSVHDLYSDYMRQSSVYEKVIQRDIPRTYPELDFFKDGER-GQSLLFNVIKAYSVHDKEVGYCQGSAFIVGLLLLQMPEEEAFAVLVSLMENYRLRELYKPTMTDLGLCMFQLECLVQDQMPDLYTHFNNMGFDTSMYASSWFLTLFTTTMPLDIANRIMDCFLVEGMDFIFCISIAILQQARIELLRLDMEGMLKYFQREVRERYEFDADLLFTVANQVQLNAKRMKRLEKDYLTKRTKEQEEAVELRRLRTENRLLRQRIDYLEAESSALADRLVKGQVNLAQEAENYINIAHELNKLRDMNSDVHRKLEGAYETIR---------------ELSSARRDNIMDTGTQVDDTSMIEHIHSLQQELIEAHTRQADSENTLRDAKLRVSELEMANKRLLENEPSEDVAGLQEELISVKMREAESSLALKEMRQRLAELEQHWAKYVHVRAFDPSSASIEKESTSEAHSTQQQPSPPLTSARARLAKITASLIGGSTEETDNCISVRELEDQLMGVRIKEADTLAELKEMRQKVMELETQNHVCTNQLKRQDEEMKRVREDSEVLVKKRKELEDQLKDEKEKLDNKESEFNEGRINDRLKYSEAMQTIQDLQSSISQLELKKAEKWTQNQL 702          
BLAST of Rab-GAP TBC domain-containing protein vs. Ensembl Celegans
Match: eat-17 (pep chromosome:WBcel235:X:16399210:16413306:-1 gene:WBGene00020770.1 transcript:T24D11.1a.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:eat-17)

HSP 1 Score: 389.037 bits (998), Expect = 5.250e-121
Identity = 265/749 (35.38%), Postives = 424/749 (56.61%), Query Frame = 1
Query:  118 LLAKLEEKNRSLQMDSKSVQS-LTGLSRKNSVTSEMNVAFTLDDDKIXXXXXXXXXXXADINARHLEKWSNVINNWN-QFSRKKSQVKELMKQSNGVPHHYRPLIWQLITGCNEDNVNSVQLKAIYPEYLKQQSPCEKAIRRDIARTYPQHDLFKDPNGDGQERLFNIMKAYSIHDREVGYCQGSGFIGGLLLIQMPEEDAFVVLVSLMFEHQLRNLYKPNMSELGLCMYQLDCLVEEQLPKLALHFRSHNFHATVYASGWFLTLFTLSFSIELSSRVMDLFMVEGIDIIFKISLAYLTTFQDELLKLDMESMLRFLQSIGPQQLELDPNPLFDLAVQLKLNTRKMKKAEKEYLALKMEEEENHVELRRLRTENGLLLQRIDRLEKECELLNSNYITK--NMA-----YLQQCDEIKILRIDISEAKRKVDNLKQNLSGTEIQLQLAVGQLNGRINEENNKDIIQKRRSVDVSS--DLVHQLQTQLVNIRLKEAETNASFXXXXXXXXXXXXXXXXXXXT-PTEEVAKLQEDLVAIKLREAETGLSLKDSLKRLNELNKLWMN--HVDQCHQNLENVQTDSKKDRHSLYE-----------------------GKDSTNKDIGILQLSRKLV-----EAEYASDLNAARQKIMETEARQQIYCRQVSRXXXXXXXXXXXXXXYIVIQKKLRLELKEAERRCIDLETKRKEDLMMWKIQKMEMGSIIAELKQKVARMETQREEISTSSRM 2238
            LLAK+E+ N+S + DS+SV S  TG S       E +     +D                        W  +I NW  +  ++ + +K+L+K+  G+P H+R + WQ     N  N +   +  +Y +Y++Q S  EK I+RDI RTYP+ D FKD    GQ  LFN++KAYS+HD+EVGYCQGS FI GLLL+QMPEE+AF VLVSLM  ++LR LYKP M++LGLCM+QL+CLV++Q+P L  HF +  F  ++YAS WFLTLFT +  +++++R+MD F+VEG+D IF IS+A L   + ELL+LDME ML++ Q    ++ E D + LF +A Q++LN ++MK+ EK+YL  + +E+E  VELRRLRTEN LL QRID LE E   L    +    N+A     Y+    E+  LR   S+  RK++   + +                 ++     +I+     VD +S  + +H LQ +L+    ++A++  + R+ K +  ELE  N+RL +  P+E+VA LQE+L+++K+REAE+ L+LK+  +RL EL + W    HV     +  +++ +S  + HS  +                         + T+  I + +L  +L+     EA+  ++L   RQK+ME E +  +   Q+ R DEE+  ++E  E  +  +K+L  +LK+ + +  + E++  E  +  +++  E    I +L+  ++++E ++ E  T +++
Sbjct:   37 LLAKMEQLNKSNEEDSRSVASKKTGSSESRKGAREHSPEEDEED--------------------LWSVWGELILNWEIEVKKRPNYIKDLVKR--GIPQHFRMIAWQ-----NLSNASVSSVHDLYSDYMRQSSVYEKVIQRDIPRTYPELDFFKDGER-GQSLLFNVIKAYSVHDKEVGYCQGSAFIVGLLLLQMPEEEAFAVLVSLMENYRLRELYKPTMTDLGLCMFQLECLVQDQMPDLYTHFNNMGFDTSMYASSWFLTLFTTTMPLDIANRIMDCFLVEGMDFIFCISIAILQQARIELLRLDMEGMLKYFQREVRERYEFDADLLFTVANQVQLNAKRMKRLEKDYLTKRTKEQEEAVELRRLRTENRLLRQRIDYLEAESSALADRLVKGQVNLAQEAENYINIAHELNKLRDMNSDVHRKLEGAYETIR---------------ELSSARRDNIMDTGTQVDDTSMIEHIHSLQQELIEAHTRQADSENTLRDAKLRVSELEMANKRLLENEPSEDVAGLQEELISVKMREAESSLALKEMRQRLAELEQHWAKYVHVRAFDPSSASIEKESTSEAHSTQQQPSPPLTSARARLAKITASLIGGSTEETDNCISVRELEDQLMGVRIKEADTLAELKEMRQKVMELETQNHVCTNQLKRQDEEMKRVREDSEVLVKKRKELEDQLKDEKEKLDNKESEFNEGRINDRLKYSEAMQTIQDLQSSISQLELKKAEKWTQNQL 742          
BLAST of Rab-GAP TBC domain-containing protein vs. Ensembl Celegans
Match: eat-17 (pep chromosome:WBcel235:X:16399210:16417063:-1 gene:WBGene00020770.1 transcript:T24D11.1e.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:eat-17)

HSP 1 Score: 389.808 bits (1000), Expect = 1.195e-120
Identity = 265/749 (35.38%), Postives = 426/749 (56.88%), Query Frame = 1
Query:  118 LLAKLEEKNRSLQMDSKSVQS-LTGLSRKNSVTSEMNVAFTLDDDKIXXXXXXXXXXXADINARHLEKWSNVINNWN-QFSRKKSQVKELMKQSNGVPHHYRPLIWQLITGCNEDNVNSVQLKAIYPEYLKQQSPCEKAIRRDIARTYPQHDLFKDPNGDGQERLFNIMKAYSIHDREVGYCQGSGFIGGLLLIQMPEEDAFVVLVSLMFEHQLRNLYKPNMSELGLCMYQLDCLVEEQLPKLALHFRSHNFHATVYASGWFLTLFTLSFSIELSSRVMDLFMVEGIDIIFKISLAYLTTFQDELLKLDMESMLRFLQSIGPQQLELDPNPLFDLAVQLKLNTRKMKKAEKEYLALKMEEEENHVELRRLRTENGLLLQRIDRLEKECELLNSNYITK--NMA-----YLQQCDEIKILRIDISEAKRKVDNLKQNLSGTEIQLQLAVGQLNGRINEENNKDIIQKRRSVDVSS--DLVHQLQTQLVNIRLKEAETNASFXXXXXXXXXXXXXXXXXXXT-PTEEVAKLQEDLVAIKLREAETGLSLKDSLKRLNELNKLWMN--HVDQCHQNLENVQTDSKKDRHSLYE-----------------------GKDSTNKDIGILQLSRKLV-----EAEYASDLNAARQKIMETEARQQIYCRQVSRXXXXXXXXXXXXXXYIVIQKKLRLELKEAERRCIDLETKRKEDLMMWKIQKMEMGSIIAELKQKVARMETQREEISTSSRM 2238
            LLAK+E+ N+S + DS+SV S  TG S       E     + ++D+                      W  +I NW  +  ++ + +K+L+K+  G+P H+R + WQ     N  N +   +  +Y +Y++Q S  EK I+RDI RTYP+ D FKD    GQ  LFN++KAYS+HD+EVGYCQGS FI GLLL+QMPEE+AF VLVSLM  ++LR LYKP M++LGLCM+QL+CLV++Q+P L  HF +  F  ++YAS WFLTLFT +  +++++R+MD F+VEG+D IF IS+A L   + ELL+LDME ML++ Q    ++ E D + LF +A Q++LN ++MK+ EK+YL  + +E+E  VELRRLRTEN LL QRID LE E   L    +    N+A     Y+    E+  LR   S+  RK++   + +                 ++     +I+     VD +S  + +H LQ +L+    ++A++  + R+ K +  ELE  N+RL +  P+E+VA LQE+L+++K+REAE+ L+LK+  +RL EL + W    HV     +  +++ +S  + HS  +                         + T+  I + +L  +L+     EA+  ++L   RQK+ME E +  +   Q+ R DEE+  ++E  E  +  +K+L  +LK+ + +  + E++  E  +  +++  E    I +L+  ++++E ++ E  T +++
Sbjct:   97 LLAKMEQLNKSNEEDSRSVASKKTGSSESRKGARE----HSPEEDEYFQEDLWSV-------------WGELILNWEIEVKKRPNYIKDLVKR--GIPQHFRMIAWQ-----NLSNASVSSVHDLYSDYMRQSSVYEKVIQRDIPRTYPELDFFKDGER-GQSLLFNVIKAYSVHDKEVGYCQGSAFIVGLLLLQMPEEEAFAVLVSLMENYRLRELYKPTMTDLGLCMFQLECLVQDQMPDLYTHFNNMGFDTSMYASSWFLTLFTTTMPLDIANRIMDCFLVEGMDFIFCISIAILQQARIELLRLDMEGMLKYFQREVRERYEFDADLLFTVANQVQLNAKRMKRLEKDYLTKRTKEQEEAVELRRLRTENRLLRQRIDYLEAESSALADRLVKGQVNLAQEAENYINIAHELNKLRDMNSDVHRKLEGAYETIR---------------ELSSARRDNIMDTGTQVDDTSMIEHIHSLQQELIEAHTRQADSENTLRDAKLRVSELEMANKRLLENEPSEDVAGLQEELISVKMREAESSLALKEMRQRLAELEQHWAKYVHVRAFDPSSASIEKESTSEAHSTQQQPSPPLTSARARLAKITASLIGGSTEETDNCISVRELEDQLMGVRIKEADTLAELKEMRQKVMELETQNHVCTNQLKRQDEEMKRVREDSEVLVKKRKELEDQLKDEKEKLDNKESEFNEGRINDRLKYSEAMQTIQDLQSSISQLELKKAEKWTQNQL 805          
BLAST of Rab-GAP TBC domain-containing protein vs. Ensembl Celegans
Match: eat-17 (pep chromosome:WBcel235:X:16399210:16417063:-1 gene:WBGene00020770.1 transcript:T24D11.1b.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:eat-17)

HSP 1 Score: 389.423 bits (999), Expect = 1.445e-120
Identity = 265/749 (35.38%), Postives = 424/749 (56.61%), Query Frame = 1
Query:  118 LLAKLEEKNRSLQMDSKSVQS-LTGLSRKNSVTSEMNVAFTLDDDKIXXXXXXXXXXXADINARHLEKWSNVINNWN-QFSRKKSQVKELMKQSNGVPHHYRPLIWQLITGCNEDNVNSVQLKAIYPEYLKQQSPCEKAIRRDIARTYPQHDLFKDPNGDGQERLFNIMKAYSIHDREVGYCQGSGFIGGLLLIQMPEEDAFVVLVSLMFEHQLRNLYKPNMSELGLCMYQLDCLVEEQLPKLALHFRSHNFHATVYASGWFLTLFTLSFSIELSSRVMDLFMVEGIDIIFKISLAYLTTFQDELLKLDMESMLRFLQSIGPQQLELDPNPLFDLAVQLKLNTRKMKKAEKEYLALKMEEEENHVELRRLRTENGLLLQRIDRLEKECELLNSNYITK--NMA-----YLQQCDEIKILRIDISEAKRKVDNLKQNLSGTEIQLQLAVGQLNGRINEENNKDIIQKRRSVDVSS--DLVHQLQTQLVNIRLKEAETNASFXXXXXXXXXXXXXXXXXXXT-PTEEVAKLQEDLVAIKLREAETGLSLKDSLKRLNELNKLWMN--HVDQCHQNLENVQTDSKKDRHSLYE-----------------------GKDSTNKDIGILQLSRKLV-----EAEYASDLNAARQKIMETEARQQIYCRQVSRXXXXXXXXXXXXXXYIVIQKKLRLELKEAERRCIDLETKRKEDLMMWKIQKMEMGSIIAELKQKVARMETQREEISTSSRM 2238
            LLAK+E+ N+S + DS+SV S  TG S       E +     +D                        W  +I NW  +  ++ + +K+L+K+  G+P H+R + WQ     N  N +   +  +Y +Y++Q S  EK I+RDI RTYP+ D FKD    GQ  LFN++KAYS+HD+EVGYCQGS FI GLLL+QMPEE+AF VLVSLM  ++LR LYKP M++LGLCM+QL+CLV++Q+P L  HF +  F  ++YAS WFLTLFT +  +++++R+MD F+VEG+D IF IS+A L   + ELL+LDME ML++ Q    ++ E D + LF +A Q++LN ++MK+ EK+YL  + +E+E  VELRRLRTEN LL QRID LE E   L    +    N+A     Y+    E+  LR   S+  RK++   + +                 ++     +I+     VD +S  + +H LQ +L+    ++A++  + R+ K +  ELE  N+RL +  P+E+VA LQE+L+++K+REAE+ L+LK+  +RL EL + W    HV     +  +++ +S  + HS  +                         + T+  I + +L  +L+     EA+  ++L   RQK+ME E +  +   Q+ R DEE+  ++E  E  +  +K+L  +LK+ + +  + E++  E  +  +++  E    I +L+  ++++E ++ E  T +++
Sbjct:   97 LLAKMEQLNKSNEEDSRSVASKKTGSSESRKGAREHSPEEDEED--------------------LWSVWGELILNWEIEVKKRPNYIKDLVKR--GIPQHFRMIAWQ-----NLSNASVSSVHDLYSDYMRQSSVYEKVIQRDIPRTYPELDFFKDGER-GQSLLFNVIKAYSVHDKEVGYCQGSAFIVGLLLLQMPEEEAFAVLVSLMENYRLRELYKPTMTDLGLCMFQLECLVQDQMPDLYTHFNNMGFDTSMYASSWFLTLFTTTMPLDIANRIMDCFLVEGMDFIFCISIAILQQARIELLRLDMEGMLKYFQREVRERYEFDADLLFTVANQVQLNAKRMKRLEKDYLTKRTKEQEEAVELRRLRTENRLLRQRIDYLEAESSALADRLVKGQVNLAQEAENYINIAHELNKLRDMNSDVHRKLEGAYETIR---------------ELSSARRDNIMDTGTQVDDTSMIEHIHSLQQELIEAHTRQADSENTLRDAKLRVSELEMANKRLLENEPSEDVAGLQEELISVKMREAESSLALKEMRQRLAELEQHWAKYVHVRAFDPSSASIEKESTSEAHSTQQQPSPPLTSARARLAKITASLIGGSTEETDNCISVRELEDQLMGVRIKEADTLAELKEMRQKVMELETQNHVCTNQLKRQDEEMKRVREDSEVLVKKRKELEDQLKDEKEKLDNKESEFNEGRINDRLKYSEAMQTIQDLQSSISQLELKKAEKWTQNQL 802          
BLAST of Rab-GAP TBC domain-containing protein vs. Ensembl Celegans
Match: tbc-11 (TBC (Tre-2/Bub2/Cdc16) domain family [Source:UniProtKB/TrEMBL;Acc:H2KZZ5])

HSP 1 Score: 219.55 bits (558), Expect = 2.729e-61
Identity = 127/344 (36.92%), Postives = 191/344 (55.52%), Query Frame = 1
Query:  307 HLEKWSNVINNWNQFSRKKSQVKELMKQSNGVPHHYRPLIWQLITGCNEDNVNSVQLKAIYPEYLKQQSPCEKAIRRDIARTYPQHDLFKDPNGDGQERLFNIMKAYSIHDREVGYCQGSGFIGGLLLIQMPEEDAFVVLVSLMFEHQLRNLYKPNMSELGLCMYQLDCLVEEQLPKLALHFRSHNFHATVYASGWFLTLFTLSFSIELSSRVMDLFMVEGIDIIFKISLAYLTTFQDELLKLDMESMLRFLQSIGPQQL--ELDPNPLFDLAVQLKLNTRKMKKAEKEYLALKMEEEENHVELRRLRTENGLLLQRIDRLEKECELLNSNYITKNMAYLQQCD 1332
            HLE W  +I NW+Q S +  ++ EL+   +G+P   R  +WQL++      ++   L   Y  +L Q  P E+ I RDI RT+P HD FK+  G GQ+ L+ I K YS++D EV YCQG  F+   LL+ MPEE AF  LV +MF + LR+L+K     L L  +QL  L+++ +P L+ H         +YAS WFLTLFT  F +++   ++DLF+ +G++ IF ISLA L   + +LL+LD E  L++ +   P++   E     L   AV+ +LN  K++  E EY  +K  E EN   + R+  E G       RLE+E + L    +T  +   ++ D
Sbjct:   35 HLEMWDQLIENWDQQSDRPQKISELV--LDGIPDKLRGRVWQLLSNA----IDQPDLVEKYHIFLSQPCPSEQVIMRDIHRTFPAHDYFKESQGKGQQSLYKISKVYSLYDEEVSYCQGLSFLAASLLLHMPEEQAFCTLVKIMFNYGLRDLFKLGFDNLHLRFFQLTALLKDYIPDLSHHLEHIGIETHMYASQWFLTLFTAKFPLQMVFFILDLFLSQGMNTIFHISLALLDDAKTDLLQLDFEGTLKYFRVSLPRKYRTEASTKCLIHKAVKFRLNHSKLEVYENEYKRIKELERENEDPVLRMEKEIGRHQANTLRLERENDDLAHELVTSKIELRRKLD 372          
BLAST of Rab-GAP TBC domain-containing protein vs. Ensembl Fly
Match: Evi5 (gene:FBgn0262740 transcript:FBtr0332620)

HSP 1 Score: 459.529 bits (1181), Expect = 2.441e-148
Identity = 284/727 (39.06%), Postives = 431/727 (59.28%), Query Frame = 1
Query:  118 LLAKLEEKNRSLQMDSKSVQSL-TGLSRKNSVTSEMNVAFTLDDDKIXXXXXXXXXXXADINARHLEKWSNVINNW-NQFSRKKSQVKELMKQSNGVPHHYRPLIWQLITGCNEDNVNSVQLKAIYPEYLKQQSPCEKAIRRDIARTYPQHDLFKDPNGDGQERLFNIMKAYSIHDREVGYCQGSGFIGGLLLIQMPEEDAFVVLVSLMFEHQLRNLYKPNMSELGLCMYQLDCLVEEQLPKLALHFRSHNFHATVYASGWFLTLFTLSFSIELSSRVMDLFMVEGIDIIFKISLAYLTTFQDELLKLDMESMLRFLQSIGPQQLELDPNPLFDLAVQLKLNTRKMKKAEKEYLALKMEEEENHVELRRLRTENGLLLQRIDRLEKECELLNSNYITKNMAYLQQCD-------EIKILRIDISEAKRKVDNLKQNLSGTEIQLQLAVGQLNGRINEENNKDIIQKRRSVDVSSDLVHQLQTQLVNIRLKEAETNASFXX-XXXXXXXXXXXXXXXXXTPTEEVAKLQEDLVAIKLREAETGLSLKDSLKRLNELNKLWM-----NHVDQCHQNLENVQTDSKKDRHSLYEGKDSTNKDIGILQ--LSRKLVEAEYASDLNAARQKIMETEARQQIYCRQVSRXXXXXXXXXXXXXXYIVIQKKLRLELKEAERRCIDLETKRKEDLMMWKIQKMEMGSIIAELKQKVARMETQREEISTSSRMGHN 2247
            LLAKLE  N+ ++ D+KS+ SL +  SRKNS TS+  ++ T   + ++           DI       W+ ++N+W     RK   V EL+++  G+PHH+R ++WQ ++G ++ +      K  Y EY+K  S CEK IRRDIARTYP+ + FK+ +G GQE LFN++KAYS+HDREVGYCQGSGFI GLLL+QMPEE+AF VLV +M +H++R+++KP+MSELGLCMYQL+ LV+EQ+P + +HF+   F  T+YAS WFLTL+T + ++ LS R+MD+F+ EG++ IFK++LA L T +D LL LDME+ML+F Q   P ++E D    F+LA  +KLNT++MKK EKEY  LK +E+E   ELRRLR EN LL QR + LE E   L    +   ++  ++ +       E+  LR    E   +++N  + + G  ++LQ         I+E     +  K  ++    ++V  L  +LV +R   AE+    R    +     E++      TP   VA LQ++L+A KLREAE  LSLKD  +R+ EL+  W      N   +  +    V +  KK   + ++   S+     + +  ++ ++ E E  ++L   R K+ME E + Q+   Q+ R DEE   LKE+LE  +  +K +  + +E + R  DLE++ K++LM  KI+  E    +AELKQ+++R+ET+  E+     +  N
Sbjct:   38 LLAKLEAANKLIESDAKSLNSLHSTHSRKNSDTSQ--ISLTSSGNSVAEE---------DI----WTTWATILNDWEGALKRKNPCVSELVRR--GIPHHFRAIVWQQLSGASDGD------KKQYAEYIKATSACEKVIRRDIARTYPEVEFFKEKDGPGQEALFNVIKAYSLHDREVGYCQGSGFIVGLLLMQMPEEEAFAVLVQIMQQHRMRHMFKPSMSELGLCMYQLENLVQEQIPDMHIHFQQQGFQTTMYASSWFLTLYTTTLNVNLSCRIMDVFLSEGMEFIFKVALALLLTGKDTLLCLDMEAMLKFFQKELPGRVEADVEGFFNLAYSIKLNTKRMKKMEKEYQDLKKKEQEEMAELRRLRRENCLLKQRNELLEAESAELADRLVRGQVSRAEEEETSYAIQTELMQLRRSYLEVSHQLENANEEVRGLSLRLQENNNSRQSSIDE-----LCMKEEALKQRDEMVSCLLEELVKVRQGLAESEDQIRNLKAKVEELEEDKKTLRETTPDNSVAHLQDELIASKLREAEASLSLKDLKQRVQELSSQWQRQLAENQRSESERTTNAVDSTPKKLLTNFFDSSKSSEHTQKLEEELMTTRIREMETLTELKELRLKVMELETQVQVSTNQLRRQDEEHKKLKEELEMAVTREKDMSNKAREQQHRYSDLESRMKDELMNVKIKFTEQSQTVAELKQEISRLETKNSEMLAEGELRAN 736          
BLAST of Rab-GAP TBC domain-containing protein vs. Ensembl Fly
Match: Evi5 (gene:FBgn0262740 transcript:FBtr0300732)

HSP 1 Score: 459.529 bits (1181), Expect = 2.441e-148
Identity = 284/727 (39.06%), Postives = 431/727 (59.28%), Query Frame = 1
Query:  118 LLAKLEEKNRSLQMDSKSVQSL-TGLSRKNSVTSEMNVAFTLDDDKIXXXXXXXXXXXADINARHLEKWSNVINNW-NQFSRKKSQVKELMKQSNGVPHHYRPLIWQLITGCNEDNVNSVQLKAIYPEYLKQQSPCEKAIRRDIARTYPQHDLFKDPNGDGQERLFNIMKAYSIHDREVGYCQGSGFIGGLLLIQMPEEDAFVVLVSLMFEHQLRNLYKPNMSELGLCMYQLDCLVEEQLPKLALHFRSHNFHATVYASGWFLTLFTLSFSIELSSRVMDLFMVEGIDIIFKISLAYLTTFQDELLKLDMESMLRFLQSIGPQQLELDPNPLFDLAVQLKLNTRKMKKAEKEYLALKMEEEENHVELRRLRTENGLLLQRIDRLEKECELLNSNYITKNMAYLQQCD-------EIKILRIDISEAKRKVDNLKQNLSGTEIQLQLAVGQLNGRINEENNKDIIQKRRSVDVSSDLVHQLQTQLVNIRLKEAETNASFXX-XXXXXXXXXXXXXXXXXTPTEEVAKLQEDLVAIKLREAETGLSLKDSLKRLNELNKLWM-----NHVDQCHQNLENVQTDSKKDRHSLYEGKDSTNKDIGILQ--LSRKLVEAEYASDLNAARQKIMETEARQQIYCRQVSRXXXXXXXXXXXXXXYIVIQKKLRLELKEAERRCIDLETKRKEDLMMWKIQKMEMGSIIAELKQKVARMETQREEISTSSRMGHN 2247
            LLAKLE  N+ ++ D+KS+ SL +  SRKNS TS+  ++ T   + ++           DI       W+ ++N+W     RK   V EL+++  G+PHH+R ++WQ ++G ++ +      K  Y EY+K  S CEK IRRDIARTYP+ + FK+ +G GQE LFN++KAYS+HDREVGYCQGSGFI GLLL+QMPEE+AF VLV +M +H++R+++KP+MSELGLCMYQL+ LV+EQ+P + +HF+   F  T+YAS WFLTL+T + ++ LS R+MD+F+ EG++ IFK++LA L T +D LL LDME+ML+F Q   P ++E D    F+LA  +KLNT++MKK EKEY  LK +E+E   ELRRLR EN LL QR + LE E   L    +   ++  ++ +       E+  LR    E   +++N  + + G  ++LQ         I+E     +  K  ++    ++V  L  +LV +R   AE+    R    +     E++      TP   VA LQ++L+A KLREAE  LSLKD  +R+ EL+  W      N   +  +    V +  KK   + ++   S+     + +  ++ ++ E E  ++L   R K+ME E + Q+   Q+ R DEE   LKE+LE  +  +K +  + +E + R  DLE++ K++LM  KI+  E    +AELKQ+++R+ET+  E+     +  N
Sbjct:   38 LLAKLEAANKLIESDAKSLNSLHSTHSRKNSDTSQ--ISLTSSGNSVAEE---------DI----WTTWATILNDWEGALKRKNPCVSELVRR--GIPHHFRAIVWQQLSGASDGD------KKQYAEYIKATSACEKVIRRDIARTYPEVEFFKEKDGPGQEALFNVIKAYSLHDREVGYCQGSGFIVGLLLMQMPEEEAFAVLVQIMQQHRMRHMFKPSMSELGLCMYQLENLVQEQIPDMHIHFQQQGFQTTMYASSWFLTLYTTTLNVNLSCRIMDVFLSEGMEFIFKVALALLLTGKDTLLCLDMEAMLKFFQKELPGRVEADVEGFFNLAYSIKLNTKRMKKMEKEYQDLKKKEQEEMAELRRLRRENCLLKQRNELLEAESAELADRLVRGQVSRAEEEETSYAIQTELMQLRRSYLEVSHQLENANEEVRGLSLRLQENNNSRQSSIDE-----LCMKEEALKQRDEMVSCLLEELVKVRQGLAESEDQIRNLKAKVEELEEDKKTLRETTPDNSVAHLQDELIASKLREAEASLSLKDLKQRVQELSSQWQRQLAENQRSESERTTNAVDSTPKKLLTNFFDSSKSSEHTQKLEEELMTTRIREMETLTELKELRLKVMELETQVQVSTNQLRRQDEEHKKLKEELEMAVTREKDMSNKAREQQHRYSDLESRMKDELMNVKIKFTEQSQTVAELKQEISRLETKNSEMLAEGELRAN 736          
BLAST of Rab-GAP TBC domain-containing protein vs. Ensembl Fly
Match: Evi5 (gene:FBgn0262740 transcript:FBtr0073547)

HSP 1 Score: 460.299 bits (1183), Expect = 2.854e-148
Identity = 284/723 (39.28%), Postives = 434/723 (60.03%), Query Frame = 1
Query:  118 LLAKLEEKNRSLQMDSKSVQSL-TGLSRKNSVTSEMNVAFTLDDDKIXXXXXXXXXXXADINARHLEKWSNVINNW-NQFSRKKSQVKELMKQSNGVPHHYRPLIWQLITGCNEDNVNSVQLKAIYPEYLKQQSPCEKAIRRDIARTYPQHDLFKDPNGDGQERLFNIMKAYSIHDREVGYCQGSGFIGGLLLIQMPEEDAFVVLVSLMFEHQLRNLYKPNMSELGLCMYQLDCLVEEQLPKLALHFRSHNFHATVYASGWFLTLFTLSFSIELSSRVMDLFMVEGIDIIFKISLAYLTTFQDELLKLDMESMLRFLQSIGPQQLELDPNPLFDLAVQLKLNTRKMKKAEKEYLALKMEEEENHVELRRLRTENGLLLQRIDRLEKECELLNSNYITKNMAYLQQCD-------EIKILRIDISEAKRKVDNLKQNLSGTEIQLQLAVGQLNGRINEENNK-----DIIQKRRSVDVSSDLVHQLQTQLVNIRLKEAETNASFXX-XXXXXXXXXXXXXXXXXTPTEEVAKLQEDLVAIKLREAETGLSLKDSLKRLNELNKLWM-----NHVDQCHQNLENVQTDSKKDRHSLYEGKDSTNKDIGILQ--LSRKLVEAEYASDLNAARQKIMETEARQQIYCRQVSRXXXXXXXXXXXXXXYIVIQKKLRLELKEAERRCIDLETKRKEDLMMWKIQKMEMGSIIAELKQKVARMETQREEI 2220
            LLAKLE  N+ ++ D+KS+ SL +  SRKNS TS+  ++ T   + ++           DI       W+ ++N+W     RK   V EL+++  G+PHH+R ++WQ ++G ++ +      K  Y EY+K  S CEK IRRDIARTYP+ + FK+ +G GQE LFN++KAYS+HDREVGYCQGSGFI GLLL+QMPEE+AF VLV +M +H++R+++KP+MSELGLCMYQL+ LV+EQ+P + +HF+   F  T+YAS WFLTL+T + ++ LS R+MD+F+ EG++ IFK++LA L T +D LL LDME+ML+F Q   P ++E D    F+LA  +KLNT++MKK EKEY  LK +E+E   ELRRLR EN LL QR + LE E   L    +   ++  ++ +       E+  LR    E   +++N  + + G  ++LQ    + N  I+  N++     ++  K  ++    ++V  L  +LV +R   AE+    R    +     E++      TP   VA LQ++L+A KLREAE  LSLKD  +R+ EL+  W      N   +  +    V +  KK   + ++   S+     + +  ++ ++ E E  ++L   R K+ME E + Q+   Q+ R DEE   LKE+LE  +  +K +  + +E + R  DLE++ K++LM  KI+  E    +AELKQ+++R+ET+  E+
Sbjct:   38 LLAKLEAANKLIESDAKSLNSLHSTHSRKNSDTSQ--ISLTSSGNSVAEE---------DI----WTTWATILNDWEGALKRKNPCVSELVRR--GIPHHFRAIVWQQLSGASDGD------KKQYAEYIKATSACEKVIRRDIARTYPEVEFFKEKDGPGQEALFNVIKAYSLHDREVGYCQGSGFIVGLLLMQMPEEEAFAVLVQIMQQHRMRHMFKPSMSELGLCMYQLENLVQEQIPDMHIHFQQQGFQTTMYASSWFLTLYTTTLNVNLSCRIMDVFLSEGMEFIFKVALALLLTGKDTLLCLDMEAMLKFFQKELPGRVEADVEGFFNLAYSIKLNTKRMKKMEKEYQDLKKKEQEEMAELRRLRRENCLLKQRNELLEAESAELADRLVRGQVSRAEEEETSYAIQTELMQLRRSYLEVSHQLENANEEVRGLSLRLQ----ENNVSIDSNNSRQSSIDELCMKEEALKQRDEMVSCLLEELVKVRQGLAESEDQIRNLKAKVEELEEDKKTLRETTPDNSVAHLQDELIASKLREAEASLSLKDLKQRVQELSSQWQRQLAENQRSESERTTNAVDSTPKKLLTNFFDSSKSSEHTQKLEEELMTTRIREMETLTELKELRLKVMELETQVQVSTNQLRRQDEEHKKLKEELEMAVTREKDMSNKAREQQHRYSDLESRMKDELMNVKIKFTEQSQTVAELKQEISRLETKNSEM 733          
BLAST of Rab-GAP TBC domain-containing protein vs. Ensembl Fly
Match: Evi5 (gene:FBgn0262740 transcript:FBtr0073546)

HSP 1 Score: 459.529 bits (1181), Expect = 3.471e-148
Identity = 285/732 (38.93%), Postives = 436/732 (59.56%), Query Frame = 1
Query:  118 LLAKLEEKNRSLQMDSKSVQSL-TGLSRKNSVTSEMNVAFTLDDDKIXXXXXXXXXXXADINARHLEKWSNVINNW-NQFSRKKSQVKELMKQSNGVPHHYRPLIWQLITGCNEDNVNSVQLKAIYPEYLKQQSPCEKAIRRDIARTYPQHDLFKDPNGDGQERLFNIMKAYSIHDREVGYCQGSGFIGGLLLIQMPEEDAFVVLVSLMFEHQLRNLYKPNMSELGLCMYQLDCLVEEQLPKLALHFRSHNFHATVYASGWFLTLFTLSFSIELSSRVMDLFMVEGIDIIFKISLAYLTTFQDELLKLDMESMLRFLQSIGPQQLELDPNPLFDLAVQLKLNTRKMKKAEKEYLALKMEEEENHVELRRLRTENGLLLQRIDRLEKECELLNSNYITKNMAYLQQCD-------EIKILRIDISEAKRKVDNLKQNLSGTEIQLQLAVGQLNGRINEENNK-----DIIQKRRSVDVSSDLVHQLQTQLVNIRLKEAETNASFXX-XXXXXXXXXXXXXXXXXTPTEEVAKLQEDLVAIKLREAETGLSLKDSLKRLNELNKLWM-----NHVDQCHQNLENVQTDSKKDRHSLYEGKDSTNKDIGILQ--LSRKLVEAEYASDLNAARQKIMETEARQQIYCRQVSRXXXXXXXXXXXXXXYIVIQKKLRLELKEAERRCIDLETKRKEDLMMWKIQKMEMGSIIAELKQKVARMETQREEISTSSRMGHN 2247
            LLAKLE  N+ ++ D+KS+ SL +  SRKNS TS+  ++ T   + ++           DI       W+ ++N+W     RK   V EL+++  G+PHH+R ++WQ ++G ++ +      K  Y EY+K  S CEK IRRDIARTYP+ + FK+ +G GQE LFN++KAYS+HDREVGYCQGSGFI GLLL+QMPEE+AF VLV +M +H++R+++KP+MSELGLCMYQL+ LV+EQ+P + +HF+   F  T+YAS WFLTL+T + ++ LS R+MD+F+ EG++ IFK++LA L T +D LL LDME+ML+F Q   P ++E D    F+LA  +KLNT++MKK EKEY  LK +E+E   ELRRLR EN LL QR + LE E   L    +   ++  ++ +       E+  LR    E   +++N  + + G  ++LQ    + N  I+  N++     ++  K  ++    ++V  L  +LV +R   AE+    R    +     E++      TP   VA LQ++L+A KLREAE  LSLKD  +R+ EL+  W      N   +  +    V +  KK   + ++   S+     + +  ++ ++ E E  ++L   R K+ME E + Q+   Q+ R DEE   LKE+LE  +  +K +  + +E + R  DLE++ K++LM  KI+  E    +AELKQ+++R+ET+  E+     +  N
Sbjct:   38 LLAKLEAANKLIESDAKSLNSLHSTHSRKNSDTSQ--ISLTSSGNSVAEE---------DI----WTTWATILNDWEGALKRKNPCVSELVRR--GIPHHFRAIVWQQLSGASDGD------KKQYAEYIKATSACEKVIRRDIARTYPEVEFFKEKDGPGQEALFNVIKAYSLHDREVGYCQGSGFIVGLLLMQMPEEEAFAVLVQIMQQHRMRHMFKPSMSELGLCMYQLENLVQEQIPDMHIHFQQQGFQTTMYASSWFLTLYTTTLNVNLSCRIMDVFLSEGMEFIFKVALALLLTGKDTLLCLDMEAMLKFFQKELPGRVEADVEGFFNLAYSIKLNTKRMKKMEKEYQDLKKKEQEEMAELRRLRRENCLLKQRNELLEAESAELADRLVRGQVSRAEEEETSYAIQTELMQLRRSYLEVSHQLENANEEVRGLSLRLQ----ENNVSIDSNNSRQSSIDELCMKEEALKQRDEMVSCLLEELVKVRQGLAESEDQIRNLKAKVEELEEDKKTLRETTPDNSVAHLQDELIASKLREAEASLSLKDLKQRVQELSSQWQRQLAENQRSESERTTNAVDSTPKKLLTNFFDSSKSSEHTQKLEEELMTTRIREMETLTELKELRLKVMELETQVQVSTNQLRRQDEEHKKLKEELEMAVTREKDMSNKAREQQHRYSDLESRMKDELMNVKIKFTEQSQTVAELKQEISRLETKNSEMLAEGELRAN 742          
BLAST of Rab-GAP TBC domain-containing protein vs. Ensembl Fly
Match: Evi5 (gene:FBgn0262740 transcript:FBtr0300733)

HSP 1 Score: 459.914 bits (1182), Expect = 4.099e-148
Identity = 283/718 (39.42%), Postives = 429/718 (59.75%), Query Frame = 1
Query:  118 LLAKLEEKNRSLQMDSKSVQSL-TGLSRKNSVTSEMNVAFTLDDDKIXXXXXXXXXXXADINARHLEKWSNVINNW-NQFSRKKSQVKELMKQSNGVPHHYRPLIWQLITGCNEDNVNSVQLKAIYPEYLKQQSPCEKAIRRDIARTYPQHDLFKDPNGDGQERLFNIMKAYSIHDREVGYCQGSGFIGGLLLIQMPEEDAFVVLVSLMFEHQLRNLYKPNMSELGLCMYQLDCLVEEQLPKLALHFRSHNFHATVYASGWFLTLFTLSFSIELSSRVMDLFMVEGIDIIFKISLAYLTTFQDELLKLDMESMLRFLQSIGPQQLELDPNPLFDLAVQLKLNTRKMKKAEKEYLALKMEEEENHVELRRLRTENGLLLQRIDRLEKECELLNSNYITKNMAYLQQCD-------EIKILRIDISEAKRKVDNLKQNLSGTEIQLQLAVGQLNGRINEENNKDIIQKRRSVDVSSDLVHQLQTQLVNIRLKEAETNASFXX-XXXXXXXXXXXXXXXXXTPTEEVAKLQEDLVAIKLREAETGLSLKDSLKRLNELNKLWM-----NHVDQCHQNLENVQTDSKKDRHSLYEGKDSTNKDIGILQ--LSRKLVEAEYASDLNAARQKIMETEARQQIYCRQVSRXXXXXXXXXXXXXXYIVIQKKLRLELKEAERRCIDLETKRKEDLMMWKIQKMEMGSIIAELKQKVARMETQREEI 2220
            LLAKLE  N+ ++ D+KS+ SL +  SRKNS TS+  ++ T   + ++           DI       W+ ++N+W     RK   V EL+++  G+PHH+R ++WQ ++G ++ +      K  Y EY+K  S CEK IRRDIARTYP+ + FK+ +G GQE LFN++KAYS+HDREVGYCQGSGFI GLLL+QMPEE+AF VLV +M +H++R+++KP+MSELGLCMYQL+ LV+EQ+P + +HF+   F  T+YAS WFLTL+T + ++ LS R+MD+F+ EG++ IFK++LA L T +D LL LDME+ML+F Q   P ++E D    F+LA  +KLNT++MKK EKEY  LK +E+E   ELRRLR EN LL QR + LE E   L    +   ++  ++ +       E+  LR    E   +++N  + + G  ++LQ         I+E     +  K  ++    ++V  L  +LV +R   AE+    R    +     E++      TP   VA LQ++L+A KLREAE  LSLKD  +R+ EL+  W      N   +  +    V +  KK   + ++   S+     + +  ++ ++ E E  ++L   R K+ME E + Q+   Q+ R DEE   LKE+LE  +  +K +  + +E + R  DLE++ K++LM  KI+  E    +AELKQ+++R+ET+  E+
Sbjct:   38 LLAKLEAANKLIESDAKSLNSLHSTHSRKNSDTSQ--ISLTSSGNSVAEE---------DI----WTTWATILNDWEGALKRKNPCVSELVRR--GIPHHFRAIVWQQLSGASDGD------KKQYAEYIKATSACEKVIRRDIARTYPEVEFFKEKDGPGQEALFNVIKAYSLHDREVGYCQGSGFIVGLLLMQMPEEEAFAVLVQIMQQHRMRHMFKPSMSELGLCMYQLENLVQEQIPDMHIHFQQQGFQTTMYASSWFLTLYTTTLNVNLSCRIMDVFLSEGMEFIFKVALALLLTGKDTLLCLDMEAMLKFFQKELPGRVEADVEGFFNLAYSIKLNTKRMKKMEKEYQDLKKKEQEEMAELRRLRRENCLLKQRNELLEAESAELADRLVRGQVSRAEEEETSYAIQTELMQLRRSYLEVSHQLENANEEVRGLSLRLQENNNSRQSSIDE-----LCMKEEALKQRDEMVSCLLEELVKVRQGLAESEDQIRNLKAKVEELEEDKKTLRETTPDNSVAHLQDELIASKLREAEASLSLKDLKQRVQELSSQWQRQLAENQRSESERTTNAVDSTPKKLLTNFFDSSKSSEHTQKLEEELMTTRIREMETLTELKELRLKVMELETQVQVSTNQLRRQDEEHKKLKEELEMAVTREKDMSNKAREQQHRYSDLESRMKDELMNVKIKFTEQSQTVAELKQEISRLETKNSEM 727          
BLAST of Rab-GAP TBC domain-containing protein vs. Ensembl Zebrafish
Match: BX548019.1 (ecotropic viral integration site 5b [Source:NCBI gene;Acc:553306])

HSP 1 Score: 431.024 bits (1107), Expect = 7.552e-138
Identity = 256/638 (40.13%), Postives = 393/638 (61.60%), Query Frame = 1
Query:  319 WSNVINNWNQFSRKKSQVKELMKQSNGVPHHYRPLIWQLITGCNEDNVNSVQLKAIYPEYLKQQSPCEKAIRRDIARTYPQHDLFKDPNGDGQERLFNIMKAYSIHDREVGYCQGSGFIGGLLLIQMPEEDAFVVLVSLMFEHQLRNLYKPNMSELGLCMYQLDCLVEEQLPKLALHFRSHNFHATVYASGWFLTLFTLSFSIELSSRVMDLFMVEGIDIIFKISLAYLTTFQDELLKLDMESMLRFLQSIGPQQLELDPNPLFDLAVQLKLNTRKMKKAEKEYLALKMEEEENHVELRRLRTENGLLLQRIDRLEKECELLNSNYITKNMAYLQQCDEIKILRIDISEAKRKVDNLKQNLSGTEIQLQLAVGQLNGRINEENNKDIIQKRRSVDVSSDLVHQLQTQLVNIRLKEAETNASFXXXXXXXXXXXXXXXXXXXTPTE-EVAKLQEDLVAIKLREAETGLSLKDSLKRLNELNKLWMNHVDQCHQNLENVQTDSKKDRHSLYEGKDSTNKDIGI-LQ---LSRKLVEAEYASDLNAARQKIMETEARQQIYCRQVSRXXXXXXXXXXXXXXYIVIQKKLRLELKEAERRCIDLETKRKEDLMMWKIQKMEMGSIIAELKQKVARMETQREE 2217
            W  ++N W    RKK + +       GVPHH+R ++WQL+  CN  N+    +K  Y E LK  SPCEK IRRDIARTYP+H+ FK+ +  GQE LFN+MKAYS+ DREVGYCQGS FI GLLL+QMPEE+AF V V LM E++LR L+KP+M+ELGLCMYQ +C+++EQLP+L +HF++ +FH ++YAS WFLT+F  SF + +++R+ D+FM EG++I+F++ +A L   Q EL++LDME ML+  Q + P QL+  P+ +   A Q+K N +KMKK EKEY  +K +E E  VE++RLRTEN LL QRID LEK         +T+     Q+ +E  ++       KR++  +KQ++  T +QL+ A   +         + + Q   +   + + + QL+ +LV  RLKEAE+  +    KE   ++ +  +R +  P E  V +LQE+L+ +KLREAE    LK+  +++ +L + W  H+          +T  +         KDS  K+    LQ   +S +L EAE  ++L   RQ+++E E + QI+  Q+ R + E   L+++L       K L  EL+E +R+  ++E K KE++M  ++++ +  + +AEL+Q+++ +E Q+EE
Sbjct:   59 WGRIVNEWEDV-RKKKEKQLKELVRKGVPHHFRAIVWQLL--CNAQNLP---IKEQYSELLKMTSPCEKLIRRDIARTYPEHEFFKEKDSLGQEVLFNVMKAYSLVDREVGYCQGSAFIVGLLLMQMPEEEAFCVFVKLMQEYRLRELFKPSMAELGLCMYQFECMIQEQLPELHVHFQAQSFHTSMYASSWFLTIFLTSFPLPVATRIFDIFMCEGLEIVFRVGMAILQMNQAELMQLDMEGMLQHFQKVIPHQLDSGPDKVIQAAYQVKYNAKKMKKLEKEYTTIKTKEMEEQVEIKRLRTENRLLKQRIDTLEK-------GQVTRA----QEAEENYLV-------KRELATVKQHIEETSVQLEQAQSTI---------RQLQQPFGNPRYTEESILQLERELVQARLKEAESQCAL---KEMQDKILDMEQRNTSLPDENNVVRLQEELIGVKLREAEALTGLKELRQQVRDLEEHWQRHL---------ARTAGR--------WKDSPRKNAASELQDELMSVRLREAEAQAELRETRQRMLELETQNQIHSNQLRRAELEARNLQDRLHVLSNQNKMLHSELQETKRKQAEIECKNKEEVMAVRLREADNIAAMAELQQQISELEIQKEE 643          
BLAST of Rab-GAP TBC domain-containing protein vs. Ensembl Zebrafish
Match: evi5b (ecotropic viral integration site 5b [Source:ZFIN;Acc:ZDB-GENE-041111-244])

HSP 1 Score: 429.483 bits (1103), Expect = 7.655e-137
Identity = 255/638 (39.97%), Postives = 391/638 (61.29%), Query Frame = 1
Query:  319 WSNVINNWNQFSRKKSQVKELMKQSNGVPHHYRPLIWQLITGCNEDNVNSVQLKAIYPEYLKQQSPCEKAIRRDIARTYPQHDLFKDPNGDGQERLFNIMKAYSIHDREVGYCQGSGFIGGLLLIQMPEEDAFVVLVSLMFEHQLRNLYKPNMSELGLCMYQLDCLVEEQLPKLALHFRSHNFHATVYASGWFLTLFTLSFSIELSSRVMDLFMVEGIDIIFKISLAYLTTFQDELLKLDMESMLRFLQSIGPQQLELDPNPLFDLAVQLKLNTRKMKKAEKEYLALKMEEEENHVELRRLRTENGLLLQRIDRLEKECELLNSNYITKNMAYLQQCDEIKILRIDISEAKRKVDNLKQNLSGTEIQLQLAVGQLNGRINEENNKDIIQKRRSVDVSSDLVHQLQTQLVNIRLKEAETNASFXXXXXXXXXXXXXXXXXXXTPTE-EVAKLQEDLVAIKLREAETGLSLKDSLKRLNELNKLWMNHVDQCHQNLENVQTDSKKDRHSLYEGKDSTNKDIGI-LQ---LSRKLVEAEYASDLNAARQKIMETEARQQIYCRQVSRXXXXXXXXXXXXXXYIVIQKKLRLELKEAERRCIDLETKRKEDLMMWKIQKMEMGSIIAELKQKVARMETQREE 2217
            W  ++N W    RKK + +       GVPHH+R ++WQL+  CN  N+    +K  Y E LK  SPCEK IRRDIARTYP+H+ FK+ +  GQE LFN+MKAYS+ DREVGYCQGS FI GLLL+QMPEE+AF V V LM E++LR L+KP+M+ELGLCMYQ +C+++EQLP+L +HF++ +FH ++YAS WFLT+F  SF + +++R+ D+FM EG++I+F++ +A L   Q EL++LDME ML+  Q + P QL+  P+ +   A Q+K N +KMKK EKEY  +K +E E  VE++RLRTEN LL QRID LEK         +T+     Q+ +E  ++       KR++  +KQ++  T +QL+ A   +         + + Q   +   + + + QL+ +LV  RLKEAE+  +    KE   ++    +R +  P E  V +LQE+L+ +KLREAE    LK+  +++ +L + W  H+ +                 +    KDS  K+    LQ   +S +L EAE  ++L   RQ+++E E + QI+  Q+ R + E   L+++L       K L  EL+E +R+  ++E K KE++M  ++++ +  + +AEL+Q+++ +E Q+EE
Sbjct:   59 WGRIVNEWEDV-RKKKEKQLKELVRKGVPHHFRAIVWQLL--CNAQNLP---IKEQYSELLKMTSPCEKLIRRDIARTYPEHEFFKEKDSLGQEVLFNVMKAYSLVDREVGYCQGSAFIVGLLLMQMPEEEAFCVFVKLMQEYRLRELFKPSMAELGLCMYQFECMIQEQLPELHVHFQAQSFHTSMYASSWFLTIFLTSFPLPVATRIFDIFMCEGLEIVFRVGMAILQMNQAELMQLDMEGMLQHFQKVIPHQLDSGPDKVIQAAYQVKYNAKKMKKLEKEYTTIKTKEMEEQVEIKRLRTENRLLKQRIDTLEK-------GQVTRA----QEAEENYLV-------KRELATVKQHIEETSVQLEQAQSTI---------RQLQQPFGNPRYTEESILQLERELVQARLKEAESQCAL---KEMQDKILYMEQRNTSLPDENNVVRLQEELIGVKLREAEALTGLKELRQQVRDLEEHWQRHLAR-----------------TAGRWKDSPRKNAASELQDELMSVRLREAEAQAELRETRQRMLELETQNQIHSNQLRRAELEARNLQDRLHVLSNQNKMLHSELQETKRKQAEIECKNKEEVMAVRLREADNIAAMAELQQQISELEIQKEE 643          
BLAST of Rab-GAP TBC domain-containing protein vs. Ensembl Zebrafish
Match: BX548019.1 (ecotropic viral integration site 5b [Source:NCBI gene;Acc:553306])

HSP 1 Score: 423.32 bits (1087), Expect = 1.228e-134
Identity = 259/653 (39.66%), Postives = 398/653 (60.95%), Query Frame = 1
Query:  319 WSNVINNWNQFSRKKSQVKELMKQSNGVPHHYRPLIWQLITGCNEDNVNSVQLKAIYPEYLKQQSPCEKAIRRDIARTYPQHDLFKDPNGDGQERLFNIMKAYSIHDREVGYCQGSGFIGGLLLIQMPEEDAFVVLVSLMFEHQLRNLYKPNMSELGLCMYQLDCLVEEQLPKLALHFRSHNFHATVYASGWFLTLFTLSFSIELSSRVMDL------FMVEGIDIIFKISLAYLTTFQDELLKLDMESMLRFLQSIGPQQLELDPNPLFDLAVQLKLNTRKMKKAEKEYLALKMEEEENHVELRRLRTENGLLLQRIDRLEKECELL-NSNYITKNMAYLQQCDEIKILRIDISEAKRKVDNLKQNLSGTEIQLQLA---VGQL-----NGRINEENNKDIIQKRRSVDVSSDLVHQLQTQLVNIRLKEAETNASFXXXXXXXXXXXXXXXXXXXTPTE-EVAKLQEDLVAIKLREAETGLSLKDSLKRLNELNKLWMNHVDQCHQNLENVQTDSKKDRHSLYEGKDSTNKDIGI-LQ---LSRKLVEAEYASDLNAARQKIMETEARQQIYCRQVSRXXXXXXXXXXXXXXYIVIQKKLRLELKEAERRCIDLETKRKEDLMMWKIQKMEMGSIIAELKQKVARMETQREE 2217
            W  ++N W    RKK + +       GVPHH+R ++WQL+  CN  N+    +K  Y E LK  SPCEK IRRDIARTYP+H+ FK+ +  GQE LFN+MKAYS+ DREVGYCQGS FI GLLL+QMPEE+AF V V LM E++LR L+KP+M+ELGLCMYQ +C+++EQLP+L +HF++ +FH ++YAS WFLT+F  SF + +++R+ D+      F+  G++I+F++ +A L   Q EL++LDME ML+  Q + P QL+  P+ +   A Q+K N +KMKK EKEY  +K +E E  VE++RLRTEN LL QRID LEK  ++  +S +++  +   Q+ +E  ++       KR++  +KQ++  T +QL+ A   + QL     N R  EE+                 + QL+ +LV  RLKEAE+  +    KE   ++ +  +R +  P E  V +LQE+L+ +KLREAE    LK+  +++ +L + W  H+          +T  +         KDS  K+    LQ   +S +L EAE  ++L   RQ+++E E + QI+  Q+ R + E   L+++L       K L  EL+E +R+  ++E K KE++M  ++++ +  + +AEL+Q+++ +E Q+EE
Sbjct:   78 WGRIVNEWEDV-RKKKEKQLKELVRKGVPHHFRAIVWQLL--CNAQNLP---IKEQYSELLKMTSPCEKLIRRDIARTYPEHEFFKEKDSLGQEVLFNVMKAYSLVDREVGYCQGSAFIVGLLLMQMPEEEAFCVFVKLMQEYRLRELFKPSMAELGLCMYQFECMIQEQLPELHVHFQAQSFHTSMYASSWFLTIFLTSFPLPVATRIFDIFMFCFVFVCFGLEIVFRVGMAILQMNQAELMQLDMEGMLQHFQKVIPHQLDSGPDKVIQAAYQVKYNAKKMKKLEKEYTTIKTKEMEEQVEIKRLRTENRLLKQRIDTLEKVSDITDDSKHLSGQVTRAQEAEENYLV-------KRELATVKQHIEETSVQLEQAQSTIRQLQQPFGNPRYTEES-----------------ILQLERELVQARLKEAESQCAL---KEMQDKILDMEQRNTSLPDENNVVRLQEELIGVKLREAEALTGLKELRQQVRDLEEHWQRHL---------ARTAGR--------WKDSPRKNAASELQDELMSVRLREAEAQAELRETRQRMLELETQNQIHSNQLRRAELEARNLQDRLHVLSNQNKMLHSELQETKRKQAEIECKNKEEVMAVRLREADNIAAMAELQQQISELEIQKEE 680          
BLAST of Rab-GAP TBC domain-containing protein vs. Ensembl Zebrafish
Match: BX548019.1 (ecotropic viral integration site 5b [Source:NCBI gene;Acc:553306])

HSP 1 Score: 423.32 bits (1087), Expect = 1.526e-134
Identity = 259/653 (39.66%), Postives = 398/653 (60.95%), Query Frame = 1
Query:  319 WSNVINNWNQFSRKKSQVKELMKQSNGVPHHYRPLIWQLITGCNEDNVNSVQLKAIYPEYLKQQSPCEKAIRRDIARTYPQHDLFKDPNGDGQERLFNIMKAYSIHDREVGYCQGSGFIGGLLLIQMPEEDAFVVLVSLMFEHQLRNLYKPNMSELGLCMYQLDCLVEEQLPKLALHFRSHNFHATVYASGWFLTLFTLSFSIELSSRVMDL------FMVEGIDIIFKISLAYLTTFQDELLKLDMESMLRFLQSIGPQQLELDPNPLFDLAVQLKLNTRKMKKAEKEYLALKMEEEENHVELRRLRTENGLLLQRIDRLEKECELL-NSNYITKNMAYLQQCDEIKILRIDISEAKRKVDNLKQNLSGTEIQLQLA---VGQL-----NGRINEENNKDIIQKRRSVDVSSDLVHQLQTQLVNIRLKEAETNASFXXXXXXXXXXXXXXXXXXXTPTE-EVAKLQEDLVAIKLREAETGLSLKDSLKRLNELNKLWMNHVDQCHQNLENVQTDSKKDRHSLYEGKDSTNKDIGI-LQ---LSRKLVEAEYASDLNAARQKIMETEARQQIYCRQVSRXXXXXXXXXXXXXXYIVIQKKLRLELKEAERRCIDLETKRKEDLMMWKIQKMEMGSIIAELKQKVARMETQREE 2217
            W  ++N W    RKK + +       GVPHH+R ++WQL+  CN  N+    +K  Y E LK  SPCEK IRRDIARTYP+H+ FK+ +  GQE LFN+MKAYS+ DREVGYCQGS FI GLLL+QMPEE+AF V V LM E++LR L+KP+M+ELGLCMYQ +C+++EQLP+L +HF++ +FH ++YAS WFLT+F  SF + +++R+ D+      F+  G++I+F++ +A L   Q EL++LDME ML+  Q + P QL+  P+ +   A Q+K N +KMKK EKEY  +K +E E  VE++RLRTEN LL QRID LEK  ++  +S +++  +   Q+ +E  ++       KR++  +KQ++  T +QL+ A   + QL     N R  EE+                 + QL+ +LV  RLKEAE+  +    KE   ++ +  +R +  P E  V +LQE+L+ +KLREAE    LK+  +++ +L + W  H+          +T  +         KDS  K+    LQ   +S +L EAE  ++L   RQ+++E E + QI+  Q+ R + E   L+++L       K L  EL+E +R+  ++E K KE++M  ++++ +  + +AEL+Q+++ +E Q+EE
Sbjct:   78 WGRIVNEWEDV-RKKKEKQLKELVRKGVPHHFRAIVWQLL--CNAQNLP---IKEQYSELLKMTSPCEKLIRRDIARTYPEHEFFKEKDSLGQEVLFNVMKAYSLVDREVGYCQGSAFIVGLLLMQMPEEEAFCVFVKLMQEYRLRELFKPSMAELGLCMYQFECMIQEQLPELHVHFQAQSFHTSMYASSWFLTIFLTSFPLPVATRIFDIFMFCFVFVCFGLEIVFRVGMAILQMNQAELMQLDMEGMLQHFQKVIPHQLDSGPDKVIQAAYQVKYNAKKMKKLEKEYTTIKTKEMEEQVEIKRLRTENRLLKQRIDTLEKVSDITDDSKHLSGQVTRAQEAEENYLV-------KRELATVKQHIEETSVQLEQAQSTIRQLQQPFGNPRYTEES-----------------ILQLERELVQARLKEAESQCAL---KEMQDKILDMEQRNTSLPDENNVVRLQEELIGVKLREAEALTGLKELRQQVRDLEEHWQRHL---------ARTAGR--------WKDSPRKNAASELQDELMSVRLREAEAQAELRETRQRMLELETQNQIHSNQLRRAELEARNLQDRLHVLSNQNKMLHSELQETKRKQAEIECKNKEEVMAVRLREADNIAAMAELQQQISELEIQKEE 680          
BLAST of Rab-GAP TBC domain-containing protein vs. Ensembl Zebrafish
Match: evi5b (ecotropic viral integration site 5b [Source:ZFIN;Acc:ZDB-GENE-041111-244])

HSP 1 Score: 422.935 bits (1086), Expect = 2.245e-134
Identity = 255/645 (39.53%), Postives = 399/645 (61.86%), Query Frame = 1
Query:  319 WSNVINNWNQFSRKKSQVKELMKQSNGVPHHYRPLIWQLITGCNEDNVNSVQLKAIYPEYLKQQSPCEKAIRRDIARTYPQHDLFKDPNGDGQERLFNIMKAYSIHDREVGYCQGSGFIGGLLLIQMPEEDAFVVLVSLMFEHQLRNLYKPNMSELGLCMYQLDCLVEEQLPKLALHFRSHNFHATVYASGWFLTLFTLSFSIELSSRVMDL------FMVEGIDIIFKISLAYLTTFQDELLKLDMESMLRFLQSIGPQQLELDPNPLFDLAVQLKLNTRKMKKAEKEYLALKMEEEENHVELRRLRTENGLLLQRIDRLEKECELL-NSNYITKNMAYLQQCDEIKILRIDISEAKRKVDNLKQNLSGTEIQLQLAVGQLNGRINEENNKDIIQKRRSVDVSSDLVHQLQTQLVNIRLKEAETNASFXXXXXXXXXXXXXXXXXXXTPTE-EVAKLQEDLVAIKLREAETGLSLKDSLKRLNELNKLWMNHVDQCHQNLENVQTDSKKDRHSLYEGKDSTNKDIGI-LQ---LSRKLVEAEYASDLNAARQKIMETEARQQIYCRQVSRXXXXXXXXXXXXXXYIVIQKKLRLELKEAERRCIDLETKRKEDLMMWKIQKMEMGSIIAELKQKVARMETQREE 2217
            W  ++N W    RKK + +       GVPHH+R ++WQL+  CN  N+    +K  Y E LK  SPCEK IRRDIARTYP+H+ FK+ +  GQE LFN+MKAYS+ DREVGYCQGS FI GLLL+QMPEE+AF V V LM E++LR L+KP+M+ELGLCMYQ +C+++EQLP+L +HF++ +FH ++YAS WFLT+F  SF + +++R+ D+      F+  G++I+F++ +A L   Q EL++LDME ML+  Q + P QL+  P+ +   A Q+K N +KMKK EKEY  +K +E E  VE++RLRTEN LL QRID LEK  ++  +S +++  +   Q+ +E  ++       KR++  +KQ++  T +QL+ A   +         + + Q   +   + + + QL+ +LV  RLKEAE+  + +E+++K   +E+ N  L   P E  V +LQE+L+ +KLREAE    LK+  +++ +L + W  H+ +                 +    KDS  K+    LQ   +S +L EAE  ++L   RQ+++E E + QI+  Q+ R + E   L+++L       K L  EL+E +R+  ++E K KE++M  ++++ +  + +AEL+Q+++ +E Q+EE
Sbjct:   88 WGRIVNEWEDV-RKKKEKQLKELVRKGVPHHFRAIVWQLL--CNAQNLP---IKEQYSELLKMTSPCEKLIRRDIARTYPEHEFFKEKDSLGQEVLFNVMKAYSLVDREVGYCQGSAFIVGLLLMQMPEEEAFCVFVKLMQEYRLRELFKPSMAELGLCMYQFECMIQEQLPELHVHFQAQSFHTSMYASSWFLTIFLTSFPLPVATRIFDIFMFCFVFVCFGLEIVFRVGMAILQMNQAELMQLDMEGMLQHFQKVIPHQLDSGPDKVIQAAYQVKYNAKKMKKLEKEYTTIKTKEMEEQVEIKRLRTENRLLKQRIDTLEKVSDITDDSKHLSGQVTRAQEAEENYLV-------KRELATVKQHIEETSVQLEQAQSTI---------RQLQQPFGNPRYTEESILQLERELVQARLKEAESQCALKEMQDKILYMEQRNTSL---PDENNVVRLQEELIGVKLREAEALTGLKELRQQVRDLEEHWQRHLAR-----------------TAGRWKDSPRKNAASELQDELMSVRLREAEAQAELRETRQRMLELETQNQIHSNQLRRAELEARNLQDRLHVLSNQNKMLHSELQETKRKQAEIECKNKEEVMAVRLREADNIAAMAELQQQISELEIQKEE 690          
BLAST of Rab-GAP TBC domain-containing protein vs. Ensembl Xenopus
Match: EVI5 (ecotropic viral integration site 5 [Source:NCBI gene;Acc:733501])

HSP 1 Score: 440.654 bits (1132), Expect = 1.789e-140
Identity = 283/765 (36.99%), Postives = 446/765 (58.30%), Query Frame = 1
Query:  118 LLAKLEEKNRSLQMDSKSVQSLTGLSRKNSVTSEMNVAFTLDDDKIXXXXXXXXXXXADINARHLEK-----WSNVINNWNQ-FSRKKSQVKELMKQSNGVPHHYRPLIWQLITGCNEDNVNSVQLKAIYPEYLKQQSPCEKAIRRDIARTYPQHDLFKDPNGDGQERLFNIMKAYSIHDREVGYCQGSGFIGGLLLIQMPEEDAFVVLVSLMFEHQLRNLYKPNMSELGLCMYQLDCLVEEQLPKLALHFRSHNFHATVYASGWFLTLFTLSFSIELSSRVMDLFMVEGIDIIFKISLAYLTTFQDELLKLDMESMLRFLQSIGPQQLELDPNPLFDLAVQLKLNTRKMKKAEKEYLALKMEEEENHVELRRLRTENGLLLQRIDRLEKECELLNSNYITKNMAYLQQCDEIKILRIDISEAKRKVDNLKQNLSGTEIQLQLAVGQLNGRINEENNKDIIQKRRSVDVSSDLVHQLQTQLVNIRLKEAETNASFXXXXXXXXXXXXXXXXXXXTPTE-EVAKLQEDLVAIKLREAETGLSLKDSLKRLNELNKLWMNHVDQCHQNLENVQTDSKKDRHSLYEGKDSTNKD-IGILQ---LSRKLVEAEYASDLNAARQKIMETEARQQIYCRQVSRXXXXXXXXXXXXXXYIVIQKKLRLELKEAERRCIDLETKRKEDLMMWKIQKMEMGSIIAELKQKVARMETQREEISTSSRMGHNKNLPPQIEMKQTSTRLEHQPLSNK-WKDLPHTIMTDSIGPLDEI 2376
            LLAKLEE+NR L++DSKS++S+ G  R +  +   + +                   +   + H E+     W  ++N W + + +K+ Q+KEL+++  G+PHH+R ++WQL+  CN  N+    +K  Y + LK  SPCEK IRRDIARTYP+HD FK+ +  GQE LFN+MKAYS+ DREVGYCQGS FI GLLL+QMPEE+AF V V LM +++LR L+KP+M+ELGLCMYQ +C+++EQLP+L +HF++ +FH ++YAS WFLT+F  SF + +++R+ D+FM EG++I+F+  LA L   Q EL++LDME ML+  Q + P Q +  P+ L   A Q+K N +KMKK EKEY  +K +E E  VE+ ++R    L+  ++ R ++  E    NY+ K         E+  ++    EA  K++     +S  E+Q Q  + + N R +EE                  V QL+T+LV  RLKEAE++ +    KE   ++ E  +R +  P E  V +LQE+L+A+KLREAE  ++LK+  +++  L + W  H+ +                 +    KD   K+ I  LQ   ++ +L EAE  ++L   RQ++ME E + QI   Q+ R ++E+  L+ K++      K L+ +L EA+R+  ++E K KE++M  ++++ +  + +AEL+Q +A +E Q+EE     ++ ++ +     E+K     L+H+    K  K LP     D I  ++ I
Sbjct:   41 LLAKLEEQNRLLEIDSKSLRSVNGSRRNSGSSLVSSSS------------------ASSNLSHHQEEDSWLLWGRIVNEWEEVYKKKEKQIKELVRK--GIPHHFRAIVWQLL--CNAQNMP---IKDQYCDLLKMTSPCEKLIRRDIARTYPEHDFFKEKDSLGQEVLFNVMKAYSLVDREVGYCQGSAFIVGLLLMQMPEEEAFCVFVKLMQDYRLRELFKPSMAELGLCMYQFECMIQEQLPELYVHFQAQSFHTSMYASSWFLTIFLTSFPLPIATRIFDIFMSEGLEIVFRAGLAVLQMNQTELMQLDMEGMLQHFQKVIPHQFDGGPDKLIQAAYQVKYNAKKMKKLEKEYTTIKTKELEEQVEI-KVRKLMHLVSGQVTRAQEAEE----NYLIKR--------ELATIKQQSDEASTKLEQAHHTIS--ELQHQRELHKCNPRYSEE-----------------FVLQLETELVQARLKEAESHCAM---KEMQDKILEIEKRNASLPDEINVVRLQEELIAVKLREAEAVMALKEVKQQIKNLEEHWQRHLAR-----------------TAGRWKDPPKKNTINELQDELMTVRLREAERHAELREVRQRMMEMETQNQINSNQLRRAEQEVSSLQSKVQYLTAQNKGLQAQLNEAKRKQAEIECKNKEEVMAVRLREADSIAAVAELQQHIAELEIQKEEGKIQGQLNNSDSSQYIRELKDQIVELKHEIKCLKSQKGLPDQPTFDGIHIVNHI 728          
BLAST of Rab-GAP TBC domain-containing protein vs. Ensembl Xenopus
Match: EVI5 (ecotropic viral integration site 5 [Source:NCBI gene;Acc:733501])

HSP 1 Score: 409.453 bits (1051), Expect = 6.144e-130
Identity = 263/708 (37.15%), Postives = 412/708 (58.19%), Query Frame = 1
Query:  319 WSNVINNWNQ-FSRKKSQVKELMKQSNGVPHHYRPLIWQLITGCNEDNVNSVQLKAIYPEYLKQQSPCEKAIRRDIARTYPQHDLFKDPNGDGQERLFNIMKAYSIHDREVGYCQGSGFIGGLLLIQMPEEDAFVVLVSLMFEHQLRNLYKPNMSELGLCMYQLDCLVEEQLPKLALHFRSHNFHATVYASGWFLTLFTLSFSIELSSRVMDLFMVEGIDIIFKISLAYLTTFQDELLKLDMESMLRFLQSIGPQQLELDPNPLFDLAVQLKLNTRKMKKAEKEYLALKMEEEENHVELRRLRTENGLLLQRIDRLEKECELLNSNYITKNMAYLQQCDEIKILRIDISEAKRKVDNLKQNLSGTEIQLQLAVGQLNGRINEENNKDIIQKRRSVDVSSDLVHQLQTQLVNIRLKEAETNASFXXXXXXXXXXXXXXXXXXXTPTE-EVAKLQEDLVAIKLREAETGLSLKDSLKRLNELNKLWMNHVDQCHQNLENVQTDSKKDRHSLYEGKDSTNKD-IGILQ---LSRKLVEAEYASDLNAARQKIMETEARQQIYCRQVSRXXXXXXXXXXXXXXYIVIQKKLRLELKEAERRCIDLETKRKEDLMMWKIQKMEMGSIIAELKQKVARMETQREEISTSSRMGHNKNLPPQIEMKQTSTRLEHQPLSNKWK-DLPHTIMTDSIGPLDEICFNPDDPMITSIYIH 2421
            W  ++N W + + +K+ Q+KEL+++  G+PHH+R ++WQL+  CN  N+    +K  Y + LK  SPCEK IRRDIARTYP+HD FK+ +  GQE LFN+MKAYS+ DREVGYCQGS FI GLLL+QMPEE+AF V V LM +++LR L+KP+M+ELGLCMYQ +C+++EQLP+L +HF++ +FH ++YAS WFLT+F  SF + +++R+ D+FM EG++I+F+  LA L   Q EL++LDME ML+  Q + P Q +  P+ L   A Q+K N +KMKK                     LRTEN LL QRI+ LEK         +T+     Q+ +E  +++ +++  K++ D     L            Q +  I+E      +Q +R +    + V QL+T+LV  RLKEAE++ +    KE   ++ E  +R +  P E  V +LQE+L+A+KLREAE  ++LK+  +++  L + W  H+          +T  +         KD   K+ I  LQ   ++ +L EAE  ++L   RQ++ME E  Q +   Q+ R ++E+  L+ K++      K L+ +L EA+R+  ++E K KE++M  ++++ +  + +AEL+Q +A +E Q+EE     ++ ++ +     E+K     L+H+    +     P  I   SI     I F      + +IYIH
Sbjct:   61 WGRIVNEWEEVYKKKEKQIKELVRK--GIPHHFRAIVWQLL--CNAQNMP---IKDQYCDLLKMTSPCEKLIRRDIARTYPEHDFFKEKDSLGQEVLFNVMKAYSLVDREVGYCQGSAFIVGLLLMQMPEEEAFCVFVKLMQDYRLRELFKPSMAELGLCMYQFECMIQEQLPELYVHFQAQSFHTSMYASSWFLTIFLTSFPLPIATRIFDIFMSEGLEIVFRAGLAVLQMNQTELMQLDMEGMLQHFQKVIPHQFDGGPDKLIQAAYQVKYNAKKMKK---------------------LRTENRLLKQRIETLEK-------GQVTRA----QEAEENYLIKRELATIKQQSDEASTKLE-----------QAHHTISE------LQHQREL----EFVLQLETELVQARLKEAESHCAM---KEMQDKILEIEKRNASLPDEINVVRLQEELIAVKLREAEAVMALKEVKQQIKNLEEHWQRHL---------ARTAGR--------WKDPPKKNTINELQDELMTVRLREAERHAELREVRQRMMEMET-QVLQSNQLRRAEQEVSSLQSKVQYLTAQNKGLQAQLNEAKRKQAEIECKNKEEVMAVRLREADSIAAVAELQQHIAELEIQKEEGKIQGQLNNSDSSQYIRELKDQIVELKHEVREERLAVQYPKCIPLRSIVYKTYISFWT----VYNIYIH 683          
BLAST of Rab-GAP TBC domain-containing protein vs. Ensembl Xenopus
Match: evi5l (ecotropic viral integration site 5-like [Source:NCBI gene;Acc:100145757])

HSP 1 Score: 402.134 bits (1032), Expect = 5.521e-126
Identity = 237/641 (36.97%), Postives = 391/641 (61.00%), Query Frame = 1
Query:  319 WSNVINNW------NQFSRKKSQVKELMKQSNGVPHHYRPLIWQLITGCNEDNVNSVQLKAIYPEYLKQQSPCEKAIRRDIARTYPQHDLFKDPNGDGQERLFNIMKAYSIHDREVGYCQGSGFIGGLLLIQMPEEDAFVVLVSLMFEHQLRNLYKPNMSELGLCMYQLDCLVEEQLPKLALHFRSHNFHATVYASGWFLTLFTLSFSIELSSRVMDLFMVEGIDIIFKISLAYLTTFQDELLKLDMESMLRFLQSIGPQQLELDPNPLFDLAVQLKLNTRKMKKAEKEYLALKMEEEENHVELRRLRTENGLLLQRIDRLEKECELLNSNYITKNMAYLQQCDEIKILRIDISEAKRKVDNLKQNLSGTEIQL-QLAVGQLNGRINEENNKDIIQKRRSVDVSSDLVHQLQTQLVNIRLKEAETNASFXXXXXXXXXXXXXXXXXXXTPTE-EVAKLQEDLVAIKLREAETGLSLKDSLKRLNELNKLWMNHVDQCHQNLENVQTDSKKDRHSLYEGKDSTNKDIGILQLSRKLVEAEYASDLNAARQKIMETEARQQIYCRQVSRXXXXXXXXXXXXXXYIVIQKKLRLELKEAERRCIDLETKRKEDLMMWKIQKMEMGSIIAELKQKVARMETQREE 2217
            W+ +  NW       +++R+K   KEL+++  G+PHH+R ++WQ++      N   + +K  Y + L+  SPCEK IRRDIARTYP+HD FK  +  GQE LFN+MKAYS+ DREVGYCQGS FI GLLL+QMPEE+AF V V LM E++LR L+KP+M+ELGLC+YQL+ ++++QLP+L+ HFRSH+FH ++YAS WFLTLF  +F + +++R+ D+F+ EG+++IF++ +A LT  Q EL++LDME M +  Q + P Q +  P+ L   A Q+K N ++MK+ EKEY A+K +E E  +E++RLRTEN LL QRI+ LEK         +T+     Q+ +E   ++ +++  K++     ++L   +  + QL   Q++ RI EE                 +V  L+++L + RL+E ET  + +E+++K              P E  +A L +++ A++ REA    ++++  +++ EL   W        Q+L +      KD       + +T  D+    +S +L E E  S+    RQ+++  E+++ ++ +Q+SRL++E   L+E+L+      K L+ ++ E +RR    E K KE++M  ++++ +  + +AE++Q++A +E Q+EE
Sbjct:   81 WTRIAGNWAASLPWEEWTRRKEAFKELIRK--GIPHHFRAMVWQMLC-----NATDMPVKKQYADLLRMSSPCEKLIRRDIARTYPEHDFFKGQDSLGQEGLFNVMKAYSLVDREVGYCQGSAFIVGLLLMQMPEEEAFCVFVRLMQEYRLRELFKPSMAELGLCIYQLEYMLQDQLPELSQHFRSHSFHTSMYASSWFLTLFLTTFPLPVATRIFDIFIYEGLEVIFRVGMALLTVNQTELMQLDMEGMSQHFQKVIPHQFDSCPDKLILKAYQVKYNPKRMKRLEKEYAAIKSKEMEEQIEIKRLRTENRLLKQRIETLEK-------GQVTRA----QEAEENYAIKRELAVVKQQYYTATESLQNAQSLIRQLQEKQMDPRITEE-----------------MVLHLESELEHSRLRETETLGALKEMQDKRNSAL---------PDENNIALLHDEVQALRKREAHALQAMREGQQQVTELRDRW--------QSLSSKGGGIWKD-----SPRKNTAVDLQDEAMSCRLREVEAQSETRELRQRVLILESQEVMHEKQLSRLEKECKELRERLQSETSQNKALQSQMNEDKRRHAVTECKNKEEVMAVRLREADSMAAVAEMRQRIAELEIQKEE 664          
BLAST of Rab-GAP TBC domain-containing protein vs. Ensembl Xenopus
Match: EVI5 (ecotropic viral integration site 5 [Source:NCBI gene;Acc:733501])

HSP 1 Score: 399.053 bits (1024), Expect = 3.520e-125
Identity = 266/761 (34.95%), Postives = 424/761 (55.72%), Query Frame = 1
Query:  118 LLAKLEEKNRSLQMDSKSVQSLTGLSRKNSVTSEMNVAFTLDDDKIXXXXXXXXXXXADINARHLEK-----WSNVINNWNQ-FSRKKSQVKELMKQSNGVPHHYRPLIWQLITGCNEDNVNSVQLKAIYPEYLKQQSPCEKAIRRDIARTYPQHDLFKDPNGDGQERLFNIMKAYSIHDREVGYCQGSGFIGGLLLIQMPEEDAFVVLVSLMFEHQLRNLYKPNMSELGLCMYQLDCLVEEQLPKLALHFRSHNFHATVYASGWFLTLFTLSFSIELSSRVMDLFMVEGIDIIFKISLAYLTTFQDELLKLDMESMLRFLQSIGPQQLELDPNPLFDLAVQLKLNTRKMKKAEKEYLALKMEEEENHVELRRLRTENGLLLQRIDRLEKECELLNSNYITKNMAYLQQCDEIKILRIDISEAKRKVDNLKQNLSGTEIQLQLAVGQLNGRINEENNKDIIQKRRSVDVSSDLVHQLQTQLVNIRLKEAETNASFXXXXXXXXXXXXXXXXXXXTPTE-EVAKLQEDLVAIKLREAETGLSLKDSLKRLNELNKLWMNHVDQCHQNLENVQTDSKKDRHSLYEGKDSTNKDIGILQLSRKLVEAEYASDLNAARQKIMETEARQQIYCRQVSRXXXXXXXXXXXXXXYIVIQKKLRLELKEAERRCIDLETKRKEDLMMWKIQKMEMGSIIAELKQKVARMETQREEISTSSRMGHNKNLPPQIEMKQTSTRLEHQPLSNK-WKDLPHTIMTDSIGPLDEI 2376
            LLAKLEE+NR L++DSKS++S+ G  R +  +   + +                   +   + H E+     W  ++N W + + +K+ Q+KEL+++  G+PHH+R ++WQL+  CN  N+    +K  Y + LK  SPCEK IRRDIARTYP+HD FK+ +  GQE LFN+MKAYS+ DREVGYCQGS FI GLLL+QMPEE+AF V V LM +++LR L+KP+M+ELGLCMYQ +C+++EQLP+L +HF++ +FH ++YAS WFLT+F  SF + +++R+ D+FM EG++I+F+  LA L   Q EL++LDME ML+  Q + P Q +  P+ L   A Q+K            Y A KM+                       +LEKE       Y T     L++  EIK+ ++                      + L   + N R +EE                  V QL+T+LV  RLKEAE++ + +E+++K  E+E+ N      P E  V +LQE+L+A+KLREAE  ++LK+  +++  L + W  H+ +     ++        ++++ E +D          ++ +L EAE  ++L   RQ++ME E + QI   Q+ R ++E+  L+ K++      K L+ +L EA+R+  ++E K KE++M  ++++ +  + +AEL+Q +A +E Q+EE     ++ ++ +     E+K     L+H+    K  K LP     D I  ++ I
Sbjct:   41 LLAKLEEQNRLLEIDSKSLRSVNGSRRNSGSSLVSSSS------------------ASSNLSHHQEEDSWLLWGRIVNEWEEVYKKKEKQIKELVRK--GIPHHFRAIVWQLL--CNAQNMP---IKDQYCDLLKMTSPCEKLIRRDIARTYPEHDFFKEKDSLGQEVLFNVMKAYSLVDREVGYCQGSAFIVGLLLMQMPEEEAFCVFVKLMQDYRLRELFKPSMAELGLCMYQFECMIQEQLPELYVHFQAQSFHTSMYASSWFLTIFLTSFPLPIATRIFDIFMSEGLEIVFRAGLAVLQMNQTELMQLDMEGMLQHFQKVIPHQFDGGPDKLIQAAYQVK------------YNAKKMK-----------------------KLEKE-------YTTIKTKELEEQVEIKVRKL----------------------MHLVSHKCNPRYSEE-----------------FVLQLETELVQARLKEAESHCAMKEMQDKILEIEKRNAS---LPDEINVVRLQEELIAVKLREAEAVMALKEVKQQIKNLEEHWQRHLARTAGRWKD-----PPKKNTINELQDEL--------MTVRLREAERHAELREVRQRMMEMETQNQINSNQLRRAEQEVSSLQSKVQYLTAQNKGLQAQLNEAKRKQAEIECKNKEEVMAVRLREADSIAAVAELQQHIAELEIQKEEGKIQGQLNNSDSSQYIRELKDQIVELKHEIKCLKSQKGLPDQPTFDGIHIVNHI 679          
BLAST of Rab-GAP TBC domain-containing protein vs. Ensembl Xenopus
Match: EVI5 (ecotropic viral integration site 5 [Source:NCBI gene;Acc:733501])

HSP 1 Score: 399.053 bits (1024), Expect = 1.167e-124
Identity = 266/761 (34.95%), Postives = 424/761 (55.72%), Query Frame = 1
Query:  118 LLAKLEEKNRSLQMDSKSVQSLTGLSRKNSVTSEMNVAFTLDDDKIXXXXXXXXXXXADINARHLEK-----WSNVINNWNQ-FSRKKSQVKELMKQSNGVPHHYRPLIWQLITGCNEDNVNSVQLKAIYPEYLKQQSPCEKAIRRDIARTYPQHDLFKDPNGDGQERLFNIMKAYSIHDREVGYCQGSGFIGGLLLIQMPEEDAFVVLVSLMFEHQLRNLYKPNMSELGLCMYQLDCLVEEQLPKLALHFRSHNFHATVYASGWFLTLFTLSFSIELSSRVMDLFMVEGIDIIFKISLAYLTTFQDELLKLDMESMLRFLQSIGPQQLELDPNPLFDLAVQLKLNTRKMKKAEKEYLALKMEEEENHVELRRLRTENGLLLQRIDRLEKECELLNSNYITKNMAYLQQCDEIKILRIDISEAKRKVDNLKQNLSGTEIQLQLAVGQLNGRINEENNKDIIQKRRSVDVSSDLVHQLQTQLVNIRLKEAETNASFXXXXXXXXXXXXXXXXXXXTPTE-EVAKLQEDLVAIKLREAETGLSLKDSLKRLNELNKLWMNHVDQCHQNLENVQTDSKKDRHSLYEGKDSTNKDIGILQLSRKLVEAEYASDLNAARQKIMETEARQQIYCRQVSRXXXXXXXXXXXXXXYIVIQKKLRLELKEAERRCIDLETKRKEDLMMWKIQKMEMGSIIAELKQKVARMETQREEISTSSRMGHNKNLPPQIEMKQTSTRLEHQPLSNK-WKDLPHTIMTDSIGPLDEI 2376
            LLAKLEE+NR L++DSKS++S+ G  R +  +   + +                   +   + H E+     W  ++N W + + +K+ Q+KEL+++  G+PHH+R ++WQL+  CN  N+    +K  Y + LK  SPCEK IRRDIARTYP+HD FK+ +  GQE LFN+MKAYS+ DREVGYCQGS FI GLLL+QMPEE+AF V V LM +++LR L+KP+M+ELGLCMYQ +C+++EQLP+L +HF++ +FH ++YAS WFLT+F  SF + +++R+ D+FM EG++I+F+  LA L   Q EL++LDME ML+  Q + P Q +  P+ L   A Q+K            Y A KM+                       +LEKE       Y T     L++  EIK+ ++                      + L   + N R +EE                  V QL+T+LV  RLKEAE++ + +E+++K  E+E+ N      P E  V +LQE+L+A+KLREAE  ++LK+  +++  L + W  H+ +     ++        ++++ E +D          ++ +L EAE  ++L   RQ++ME E + QI   Q+ R ++E+  L+ K++      K L+ +L EA+R+  ++E K KE++M  ++++ +  + +AEL+Q +A +E Q+EE     ++ ++ +     E+K     L+H+    K  K LP     D I  ++ I
Sbjct:   83 LLAKLEEQNRLLEIDSKSLRSVNGSRRNSGSSLVSSSS------------------ASSNLSHHQEEDSWLLWGRIVNEWEEVYKKKEKQIKELVRK--GIPHHFRAIVWQLL--CNAQNMP---IKDQYCDLLKMTSPCEKLIRRDIARTYPEHDFFKEKDSLGQEVLFNVMKAYSLVDREVGYCQGSAFIVGLLLMQMPEEEAFCVFVKLMQDYRLRELFKPSMAELGLCMYQFECMIQEQLPELYVHFQAQSFHTSMYASSWFLTIFLTSFPLPIATRIFDIFMSEGLEIVFRAGLAVLQMNQTELMQLDMEGMLQHFQKVIPHQFDGGPDKLIQAAYQVK------------YNAKKMK-----------------------KLEKE-------YTTIKTKELEEQVEIKVRKL----------------------MHLVSHKCNPRYSEE-----------------FVLQLETELVQARLKEAESHCAMKEMQDKILEIEKRNAS---LPDEINVVRLQEELIAVKLREAEAVMALKEVKQQIKNLEEHWQRHLARTAGRWKD-----PPKKNTINELQDEL--------MTVRLREAERHAELREVRQRMMEMETQNQINSNQLRRAEQEVSSLQSKVQYLTAQNKGLQAQLNEAKRKQAEIECKNKEEVMAVRLREADSIAAVAELQQHIAELEIQKEEGKIQGQLNNSDSSQYIRELKDQIVELKHEIKCLKSQKGLPDQPTFDGIHIVNHI 721          
BLAST of Rab-GAP TBC domain-containing protein vs. Ensembl Mouse
Match: Evi5 (ecotropic viral integration site 5 [Source:MGI Symbol;Acc:MGI:104736])

HSP 1 Score: 436.032 bits (1120), Expect = 1.324e-140
Identity = 270/673 (40.12%), Postives = 408/673 (60.62%), Query Frame = 1
Query:  118 LLAKLEEKNRSLQMDSKSVQSLTGLSRKNSVTSEMNVAFTLDDDKIXXXXXXXXXXXADINARHLEKWSNVINNWNQFSRKK-SQVKELMKQSNGVPHHYRPLIWQLITGCNEDNVNSVQLKAIYPEYLKQQSPCEKAIRRDIARTYPQHDLFKDPNGDGQERLFNIMKAYSIHDREVGYCQGSGFIGGLLLIQMPEEDAFVVLVSLMFEHQLRNLYKPNMSELGLCMYQLDCLVEEQLPKLALHFRSHNFHATVYASGWFLTLFTLSFSIELSSRVMDLFMVEGIDIIFKISLAYLTTFQDELLKLDMESMLRFLQSIGPQQLELDPNPLFDLAVQLKLNTRKMKKAEKEYLALKMEEEENHVELRRLRTENGLLLQRIDRLEKECELLNSNYITKNMAYLQQCDEIKILRIDISEAKRKVDNLKQNLSGTEIQLQLAVGQLNGRINEENNKDIIQKRRSVDVSSDLVHQLQTQLVNIRLKEAETNASFXXXXXXXXXXXXXXXXXXXTPTE-EVAKLQEDLVAIKLREAETGLSLKDSLKRLNELNKLWMNHVDQCHQNLENVQTDSKKDRHSLYEGKDSTNKD-IGILQ---LSRKLVEAEYASDLNAARQKIMETEARQQIYCRQVSRXXXXXXXXXXXXXXYIVIQKKLRLELKEAERRCIDLETKRK 2118
            LLAKLEE+NR ++ DSKS++S+ G SR+NS +S ++ +    +       +                W  ++N W+   +KK  QVKEL+++  G+PHH+R ++WQL+      N  S+ +K  Y E LK  SPCEK IRRDIARTYP+H+ FK+ +  GQE LFN+MKAYS+ DREVGYCQGS FI GLLL+QMPEE+AF V V LM +++LR L+KP+M+ELGLCMYQ +C+++E LP+L +HF+S +FH ++YAS WFLT+F  +F + +++R+ D+FM EG++I+F++ LA L   Q EL++LDME ML+  Q + P Q +  P  L   A Q+K N++KMKK EKEY  +K +E E   E++RLRTEN LL QRI+ LEKE   L    I   +   Q+ +E  +++ +++  K++ D  +  L   E             I E  +     K  S   + D V QL+ +LV  RL EAE+  + +E+++K  ++E++N      P E  +A+LQE+L+A+KLREAE  + LK+  +++  L + W  H+          +T  +         KD   K+ +  LQ   +S +L EAE  +++   +Q++ME E + QI   Q+ R ++E+  L+EK+    V  K L  +L EA+RR  ++E K K
Sbjct:   41 LLAKLEEQNRLIETDSKSLRSVNG-SRRNSGSSLVSSSSASSNLSHLEEDSWIL-------------WGRIVNEWDDVRKKKEKQVKELVRK--GIPHHFRAIVWQLLC-----NAQSMTIKDQYSELLKMTSPCEKLIRRDIARTYPEHNFFKEKDSLGQEVLFNVMKAYSLVDREVGYCQGSAFIVGLLLMQMPEEEAFCVFVKLMQDYRLRELFKPSMAELGLCMYQFECMIQEYLPELFVHFQSQSFHTSMYASSWFLTIFLTTFPLPIATRIFDIFMSEGLEIVFRVGLALLQMNQAELMQLDMEGMLQHFQKVIPHQFDGGPEKLIQSAYQVKYNSKKMKKLEKEYTTIKTKEMEEQGEIKRLRTENRLLKQRIETLEKESASLADRLIQGQVTRAQEAEENYLIKRELATIKQQTDAARAKLEQAE-----------STIRELRHHRHWHKCSST-YNEDFVLQLEKELVQARLSEAESQCALKEMQDKVLDIEKKNNSF---PDENNIARLQEELIAVKLREAEAIMGLKELRQQVRTLEEHWQRHL---------ARTSGR--------WKDPPKKNAVNELQDELMSIRLREAETQAEIREMKQRMMEMETQNQINSNQLRRAEQEVNSLQEKVCSLSVKNKGLLAQLSEAKRRQAEIECKNK 660          
BLAST of Rab-GAP TBC domain-containing protein vs. Ensembl Mouse
Match: Evi5l (ecotropic viral integration site 5 like [Source:MGI Symbol;Acc:MGI:2442167])

HSP 1 Score: 433.721 bits (1114), Expect = 6.948e-138
Identity = 277/735 (37.69%), Postives = 431/735 (58.64%), Query Frame = 1
Query:  139 KNRSLQMDSKSVQSLTGLSRKNSVTSEMNVAFTLDDDKIXXXXXXXXXXXADINARHLEKWSNVINNWNQFSRKKSQV-KELMKQSNGVPHHYRPLIWQLITGCNEDNVNSVQLKAIYPEYLKQQSPCEKAIRRDIARTYPQHDLFKDPNGDGQERLFNIMKAYSIHDREVGYCQGSGFIGGLLLIQMPEEDAFVVLVSLMFEHQLRNLYKPNMSELGLCMYQLDCLVEEQLPKLALHFRSHNFHATVYASGWFLTLFTLSFSIELSSRVMDLFMVEGIDIIFKISLAYLTTFQDELLKLDMESMLRFLQSIGPQQLELDPNPLFDLAVQLKLNTRKMKKAEKEYLALKMEEEENHVELRRLRTENGLLLQRIDRLEKECELLNSNYITKNMAYLQQCDEIKILRIDISEAKRKVDNLKQNLSGTEIQLQLAVGQLNGRINEENNKDIIQKRRSVDVSSDLVHQLQTQLVNIRLKEAETNASFXXXXXXXXXXXXXXXXXXXTPTE-EVAKLQEDLVAIKLREAETGLSLKDSLKRLNELNKLWMNHVDQCHQNLENVQTDSKKDRHSLYEGKDSTNKDI-GILQ---LSRKLVEAEYASDLNAARQKIMETEARQQIYCRQVSRXXXXXXXXXXXXXXYIVIQKKLRLELKEAERRCIDLETKRKEDLMMWKIQKMEMGSIIAELKQKVARMETQREEISTSSRMGHN------KNLPPQIEMKQTSTRLEHQP 2307
            +NR L+ DSKS++S+ G SR+NS +S ++ +    +                        W  + N W ++ R+K ++ KEL+++  G+PHH+R ++WQL+    +     + +K  Y E LK  SPCEK IRRDIARTYP+H+ FK  +  GQE LFN+MKAYS+ DREVGYCQGS FI GLLL+QMPEE+AF V V LM E++LR L+KP+M+ELGLC+YQ + +++EQLP L  HFRS +FH ++YAS WFLTLF  +F + +++RV D+FM EG++I+F++ LA L   Q EL++LDME M ++ Q + P Q +  P+ L   A Q+K N +KMK+ EKEY A+K +E E  +E++RLRTEN LL QRI+ LEKE   L    I   +   Q+ +E  ++       KR++  ++Q  S T   LQ A   +         + + +++ +  ++ D V  L+T+L   RL+E ET  +    +E   ++ +  +R S  P E  VA+LQE+L A+K+RE E   S ++   +L EL+  W  H+             S+  R      K+S  K + G LQ   ++ +L EA+  +D    RQ+++E E +  I+   ++R++ E   L+EKL+      K L+ +L E+ R+  + E K KE++M  ++++ +  + +AE++Q++A +E QREE     ++ H+      + L  QIE  +T  RL   P
Sbjct:   49 QNRLLEADSKSMRSMNG-SRRNSGSSLVSSSSASSNLSHLEEDTWIL-------------WGRIANEWEEWRRRKEKLLKELIRK--GIPHHFRAIVWQLLCSATD-----MPVKNQYSELLKMSSPCEKLIRRDIARTYPEHEFFKGQDSLGQEVLFNVMKAYSLVDREVGYCQGSAFIVGLLLMQMPEEEAFCVFVRLMQEYRLRELFKPSMAELGLCIYQFEYMLQEQLPDLNTHFRSQSFHTSMYASSWFLTLFLTTFPLPVATRVFDIFMYEGLEIVFRVGLALLQVNQTELMQLDMEGMSQYFQRVIPHQFDSCPDKLVLKAYQVKYNPKKMKRLEKEYAAMKSKEMEEQIEIKRLRTENRLLKQRIETLEKESAALADRLIQGQVTRAQEAEENYVI-------KRELAVVRQQCSSTAEDLQKAQSTI---------RQLQEQQENPRLTEDFVAHLETELEQSRLRETETLGAL---REMQDKVLDMEKRNSSLPDENNVARLQEELKALKVREGEAVASARELKLQLQELSDTWQAHL-------------SRGGRW-----KESPRKLVLGELQDELMTVRLREAQALADGREWRQRVVELETQDNIHRNLLNRVEAERAALQEKLQYLAAQNKGLQTQLSESRRKQAEAECKSKEEVMAVRLREADSMAAVAEMRQRIAELEIQREEGRIQGQLNHSDSSQYIRELKDQIEELKTEVRLLKGP 725          
BLAST of Rab-GAP TBC domain-containing protein vs. Ensembl Mouse
Match: Evi5l (ecotropic viral integration site 5 like [Source:MGI Symbol;Acc:MGI:2442167])

HSP 1 Score: 423.32 bits (1087), Expect = 5.563e-134
Identity = 275/735 (37.41%), Postives = 430/735 (58.50%), Query Frame = 1
Query:  139 KNRSLQMDSKSVQSLTGLSRKNSVTSEMNVAFTLDDDKIXXXXXXXXXXXADINARHLEKWSNVINNWNQFSRKKSQV-KELMKQSNGVPHHYRPLIWQLITGCNEDNVNSVQLKAIYPEYLKQQSPCEKAIRRDIARTYPQHDLFKDPNGDGQERLFNIMKAYSIHDREVGYCQGSGFIGGLLLIQMPEEDAFVVLVSLMFEHQLRNLYKPNMSELGLCMYQLDCLVEEQLPKLALHFRSHNFHATVYASGWFLTLFTLSFSIELSSRVMDLFMVEGIDIIFKISLAYLTTFQDELLKLDMESMLRFLQSIGPQQLELDPNPLFDLAVQLKLNTRKMKKAEKEYLALKMEEEENHVELRRLRTENGLLLQRIDRLEKECELLNSNYITKNMAYLQQCDEIKILRIDISEAKRKVDNLKQNLSGTEIQLQLAVGQLNGRINEENNKDIIQKRRSVDVSSDLVHQLQTQLVNIRLKEAETNASFXXXXXXXXXXXXXXXXXXXTPTE-EVAKLQEDLVAIKLREAETGLSLKDSLKRLNELNKLWMNHVDQCHQNLENVQTDSKKDRHSLYEGKDSTNKDI-GILQ---LSRKLVEAEYASDLNAARQKIMETEARQQIYCRQVSRXXXXXXXXXXXXXXYIVIQKKLRLELKEAERRCIDLETKRKEDLMMWKIQKMEMGSIIAELKQKVARMETQREEISTSSRMGHN------KNLPPQIEMKQTSTRLEHQP 2307
            +NR L+ DSKS++S+ G SR+NS +S ++ +    +                        W  + N W ++ R+K ++ KEL+++  G+PHH+R ++WQL+    +     + +K  Y E LK  SPCEK IRRDIARTYP+H+ FK  +  GQE LFN+MKAYS+ DREVGYCQGS FI GLLL+QMPEE+AF V V LM E++LR L+KP+M+ELGLC+YQ + +++EQLP L  HFRS +FH ++YAS WFLTLF  +F + +++RV D+FM EG++I+F++ LA L   Q EL++LDME M ++ Q + P Q +  P+ L   A Q+K N +KMK+ EKEY A+K +E E  +E++RLRTEN LL QRI+ LEK         +T+     Q+ +E  ++       KR++  ++Q  S T   LQ A   +         + + +++ +  ++ D V  L+T+L   RL+E ET  +    +E   ++ +  +R S  P E  VA+LQE+L A+K+RE E   S ++   +L EL+  W  H+             S+  R      K+S  K + G LQ   ++ +L EA+  +D    RQ+++E E +  I+   ++R++ E   L+EKL+      K L+ +L E+ R+  + E K KE++M  ++++ +  + +AE++Q++A +E QREE     ++ H+      + L  QIE  +T  RL   P
Sbjct:   49 QNRLLEADSKSMRSMNG-SRRNSGSSLVSSSSASSNLSHLEEDTWIL-------------WGRIANEWEEWRRRKEKLLKELIRK--GIPHHFRAIVWQLLCSATD-----MPVKNQYSELLKMSSPCEKLIRRDIARTYPEHEFFKGQDSLGQEVLFNVMKAYSLVDREVGYCQGSAFIVGLLLMQMPEEEAFCVFVRLMQEYRLRELFKPSMAELGLCIYQFEYMLQEQLPDLNTHFRSQSFHTSMYASSWFLTLFLTTFPLPVATRVFDIFMYEGLEIVFRVGLALLQVNQTELMQLDMEGMSQYFQRVIPHQFDSCPDKLVLKAYQVKYNPKKMKRLEKEYAAMKSKEMEEQIEIKRLRTENRLLKQRIETLEK-------GQVTRA----QEAEENYVI-------KRELAVVRQQCSSTAEDLQKAQSTI---------RQLQEQQENPRLTEDFVAHLETELEQSRLRETETLGAL---REMQDKVLDMEKRNSSLPDENNVARLQEELKALKVREGEAVASARELKLQLQELSDTWQAHL-------------SRGGRW-----KESPRKLVLGELQDELMTVRLREAQALADGREWRQRVVELETQDNIHRNLLNRVEAERAALQEKLQYLAAQNKGLQTQLSESRRKQAEAECKSKEEVMAVRLREADSMAAVAEMRQRIAELEIQREEGRIQGQLNHSDSSQYIRELKDQIEELKTEVRLLKGP 714          
BLAST of Rab-GAP TBC domain-containing protein vs. Ensembl Mouse
Match: Evi5 (ecotropic viral integration site 5 [Source:MGI Symbol;Acc:MGI:104736])

HSP 1 Score: 405.216 bits (1040), Expect = 4.113e-127
Identity = 255/702 (36.32%), Postives = 404/702 (57.55%), Query Frame = 1
Query:  118 LLAKLEEKNRSLQMDSKSVQSLTGLSRKNSVTSEMNVAFTLDDDKIXXXXXXXXXXXADINARHLEKWSNVINNWNQFSRKK-SQVKELMKQSNGVPHHYRPLIWQLITGCNEDNVNSVQLKAIYPEYLKQQSPCEKAIRRDIARTYPQHDLFKDPNGDGQERLFNIMKAYSIHDREVGYCQGSGFIGGLLLIQMPEEDAFVVLVSLMFEHQLRNLYKPNMSELGLCMYQLDCLVEEQLPKLALHFRSHNFHATVYASGWFLTLFTLSFSIELSSRVMDLFMVEGIDIIFKISLAYLTTFQDELLKLDMESMLRFLQSIGPQQLELDPNPLFDLAVQLKLNTRKMKKAEKEYLALKMEEEENHVELRRLRTENGLLLQRIDRLEKECELLNSNYITKNMAYLQQCDEIKILRIDISEAKRKVDNLKQNLSGTEIQLQLAVGQLNGRINEENNKDIIQKRRSVDVSSDLVHQLQTQLVNIRLKEAETNASFXXXXXXXXXXXXXXXXXXXTPTEE-VAKLQEDLVAIKLREAETGLSLKDSLKRLNELNKLWMNHVDQCHQNLENVQTDSKKDRHSLYEGKDSTNKDIGILQLSRKLVEAEYASDLNAARQKIMETEARQQIYCRQVSRXXXXXXXXXXXXXXYIVIQKKLRLELKEAERRCIDLETKRKEDLMMWKIQKMEMGSIIAELKQKVARMETQREE 2217
            LLAKLEE+NR ++ DSKS++S+ G SR+NS +S ++ +    +       +                W  ++N W+   +KK  QVKEL+++  G+PHH+R ++WQL+      N  S+ +K  Y E LK  SPCEK IRRDIARTYP+H+ FK+ +  GQE LFN+MKAYS+ DREVGYCQGS FI GLLL+QMPEE+AF V V LM +++LR L+KP+M+ELGLCMYQ +C+++E LP+L +HF+S +FH ++YAS WFLT+F  +F + +++R+ D+FM EG++I+F++ LA L   Q EL++LDME ML+  Q + P Q +  P  L   A Q+K N++KMKK EKE                                          Y T     +++  EIK LR +    K++++ L+++                              + S   + D V QL+ +LV  RL EAE+  + +E+++K  ++E++N      P E  +A+LQE+L+A+KLREAE  + LK+  +++  L + W  H+ +     ++        ++++ E +D          +S +L EAE  +++   +Q++ME E + QI   Q+ R ++E+  L+EK+    V  K L  +L EA+RR  ++E K KE++M  ++++ +  + +AEL+Q +A +E Q+EE
Sbjct:   85 LLAKLEEQNRLIETDSKSLRSVNG-SRRNSGSSLVSSSSASSNLSHLEEDSWIL-------------WGRIVNEWDDVRKKKEKQVKELVRK--GIPHHFRAIVWQLLC-----NAQSMTIKDQYSELLKMTSPCEKLIRRDIARTYPEHNFFKEKDSLGQEVLFNVMKAYSLVDREVGYCQGSAFIVGLLLMQMPEEEAFCVFVKLMQDYRLRELFKPSMAELGLCMYQFECMIQEYLPELFVHFQSQSFHTSMYASSWFLTIFLTTFPLPIATRIFDIFMSEGLEIVFRVGLALLQMNQAELMQLDMEGMLQHFQKVIPHQFDGGPEKLIQSAYQVKYNSKKMKKLEKE------------------------------------------YTTIKTKEMEEQGEIKRLRTENRLLKQRIETLEKH------------------------------KCSSTYNEDFVLQLEKELVQARLSEAESQCALKEMQDKVLDIEKKNNSF---PDENNIARLQEELIAVKLREAEAIMGLKELRQQVRTLEEHWQRHLARTSGRWKD-----PPKKNAVNELQDEL--------MSIRLREAETQAEIREMKQRMMEMETQNQINSNQLRRAEQEVNSLQEKVCSLSVKNKGLLAQLSEAKRRQAEIECKNKEEVMAVRLREADSIAAVAELQQHIAELEIQKEE 677          
BLAST of Rab-GAP TBC domain-containing protein vs. Ensembl Mouse
Match: Evi5l (ecotropic viral integration site 5 like [Source:MGI Symbol;Acc:MGI:2442167])

HSP 1 Score: 372.474 bits (955), Expect = 3.092e-115
Identity = 259/735 (35.24%), Postives = 401/735 (54.56%), Query Frame = 1
Query:  139 KNRSLQMDSKSVQSLTGLSRKNSVTSEMNVAFTLDDDKIXXXXXXXXXXXADINARHLEKWSNVINNWNQFSRKKSQV-KELMKQSNGVPHHYRPLIWQLITGCNEDNVNSVQLKAIYPEYLKQQSPCEKAIRRDIARTYPQHDLFKDPNGDGQERLFNIMKAYSIHDREVGYCQGSGFIGGLLLIQMPEEDAFVVLVSLMFEHQLRNLYKPNMSELGLCMYQLDCLVEEQLPKLALHFRSHNFHATVYASGWFLTLFTLSFSIELSSRVMDLFMVEGIDIIFKISLAYLTTFQDELLKLDMESMLRFLQSIGPQQLELDPNPLFDLAVQLKLNTRKMKKAEKEYLALKMEEEENHVELRRLRTENGLLLQRIDRLEKECELLNSNYITKNMAYLQQCDEIKILRIDISEAKRKVDNLKQNLSGTEIQLQLAVGQLNGRINEENNKDIIQKRRSVDVSSDLVHQLQTQLVNIRLKEAETNASFXXXXXXXXXXXXXXXXXXXTPTEE-VAKLQEDLVAIKLREAETGLSLKDSLKRLNELNKLWMNHVDQCHQNLENVQTDSKKDRHSLYEGKDSTNKDI-GILQ---LSRKLVEAEYASDLNAARQKIMETEARQQIYCRQVSRXXXXXXXXXXXXXXYIVIQKKLRLELKEAERRCIDLETKRKEDLMMWKIQKMEMGSIIAELKQKVARMETQREEISTSSRMGHN------KNLPPQIEMKQTSTRLEHQP 2307
            +NR L+ DSKS++S+ G SR+NS +S ++ +    +                        W  + N W ++ R+K ++ KEL+++  G+PHH+R ++WQL+    +     + +K  Y E LK  SPCEK IRRDIARTYP+H+ FK  +  GQE LFN+MKAYS+ DREVGYCQGS FI GLLL+QMPEE+AF V V LM E++LR L+KP+M+ELGLC+YQ + +++EQLP L  HFRS +FH ++YAS WFLTLF  +F + +++RV D+FM EG++I+F++ LA L   Q EL++LDME M ++ Q + P Q +  P+ L   A Q+K N +KMK                                   RLEKE   + S  + + +       EIK LR +    K++++ L++                N R+ E                 D V  L+T+L   RL+E ET  + RE+++K  ++E+ N      P E  VA+LQE+L A+K+RE E   S ++   +L EL+  W  H+             S+  R      K+S  K + G LQ   ++ +L EA+  +D    RQ+++E E +  I+   ++R++ E   L+EKL+      K L+ +L E+ R+  + E K KE++M  ++++ +  + +AE++Q++A +E QREE     ++ H+      + L  QIE  +T  RL   P
Sbjct:   49 QNRLLEADSKSMRSMNG-SRRNSGSSLVSSSSASSNLSHLEEDTWIL-------------WGRIANEWEEWRRRKEKLLKELIRK--GIPHHFRAIVWQLLCSATD-----MPVKNQYSELLKMSSPCEKLIRRDIARTYPEHEFFKGQDSLGQEVLFNVMKAYSLVDREVGYCQGSAFIVGLLLMQMPEEEAFCVFVRLMQEYRLRELFKPSMAELGLCIYQFEYMLQEQLPDLNTHFRSQSFHTSMYASSWFLTLFLTTFPLPVATRVFDIFMYEGLEIVFRVGLALLQVNQTELMQLDMEGMSQYFQRVIPHQFDSCPDKLVLKAYQVKYNPKKMK-----------------------------------RLEKEYAAMKSKEMEEQI-------EIKRLRTENRLLKQRIETLEKE---------------NPRLTE-----------------DFVAHLETELEQSRLRETETLGALREMQDKVLDMEKRNSS---LPDENNVARLQEELKALKVREGEAVASARELKLQLQELSDTWQAHL-------------SRGGRW-----KESPRKLVLGELQDELMTVRLREAQALADGREWRQRVVELETQDNIHRNLLNRVEAERAALQEKLQYLAAQNKGLQTQLSESRRKQAEAECKSKEEVMAVRLREADSMAAVAEMRQRIAELEIQREEGRIQGQLNHSDSSQYIRELKDQIEELKTEVRLLKGP 667          
BLAST of Rab-GAP TBC domain-containing protein vs. UniProt/SwissProt
Match: sp|Q9VYY9|EVI5_DROME (Ecotropic viral integration site 5 ortholog OS=Drosophila melanogaster OX=7227 GN=Evi5 PE=1 SV=3)

HSP 1 Score: 460.299 bits (1183), Expect = 2.861e-147
Identity = 284/723 (39.28%), Postives = 434/723 (60.03%), Query Frame = 1
Query:  118 LLAKLEEKNRSLQMDSKSVQSL-TGLSRKNSVTSEMNVAFTLDDDKIXXXXXXXXXXXADINARHLEKWSNVINNW-NQFSRKKSQVKELMKQSNGVPHHYRPLIWQLITGCNEDNVNSVQLKAIYPEYLKQQSPCEKAIRRDIARTYPQHDLFKDPNGDGQERLFNIMKAYSIHDREVGYCQGSGFIGGLLLIQMPEEDAFVVLVSLMFEHQLRNLYKPNMSELGLCMYQLDCLVEEQLPKLALHFRSHNFHATVYASGWFLTLFTLSFSIELSSRVMDLFMVEGIDIIFKISLAYLTTFQDELLKLDMESMLRFLQSIGPQQLELDPNPLFDLAVQLKLNTRKMKKAEKEYLALKMEEEENHVELRRLRTENGLLLQRIDRLEKECELLNSNYITKNMAYLQQCD-------EIKILRIDISEAKRKVDNLKQNLSGTEIQLQLAVGQLNGRINEENNK-----DIIQKRRSVDVSSDLVHQLQTQLVNIRLKEAETNASFXX-XXXXXXXXXXXXXXXXXTPTEEVAKLQEDLVAIKLREAETGLSLKDSLKRLNELNKLWM-----NHVDQCHQNLENVQTDSKKDRHSLYEGKDSTNKDIGILQ--LSRKLVEAEYASDLNAARQKIMETEARQQIYCRQVSRXXXXXXXXXXXXXXYIVIQKKLRLELKEAERRCIDLETKRKEDLMMWKIQKMEMGSIIAELKQKVARMETQREEI 2220
            LLAKLE  N+ ++ D+KS+ SL +  SRKNS TS+  ++ T   + ++           DI       W+ ++N+W     RK   V EL+++  G+PHH+R ++WQ ++G ++ +      K  Y EY+K  S CEK IRRDIARTYP+ + FK+ +G GQE LFN++KAYS+HDREVGYCQGSGFI GLLL+QMPEE+AF VLV +M +H++R+++KP+MSELGLCMYQL+ LV+EQ+P + +HF+   F  T+YAS WFLTL+T + ++ LS R+MD+F+ EG++ IFK++LA L T +D LL LDME+ML+F Q   P ++E D    F+LA  +KLNT++MKK EKEY  LK +E+E   ELRRLR EN LL QR + LE E   L    +   ++  ++ +       E+  LR    E   +++N  + + G  ++LQ    + N  I+  N++     ++  K  ++    ++V  L  +LV +R   AE+    R    +     E++      TP   VA LQ++L+A KLREAE  LSLKD  +R+ EL+  W      N   +  +    V +  KK   + ++   S+     + +  ++ ++ E E  ++L   R K+ME E + Q+   Q+ R DEE   LKE+LE  +  +K +  + +E + R  DLE++ K++LM  KI+  E    +AELKQ+++R+ET+  E+
Sbjct:   38 LLAKLEAANKLIESDAKSLNSLHSTHSRKNSDTSQ--ISLTSSGNSVAEE---------DI----WTTWATILNDWEGALKRKNPCVSELVRR--GIPHHFRAIVWQQLSGASDGD------KKQYAEYIKATSACEKVIRRDIARTYPEVEFFKEKDGPGQEALFNVIKAYSLHDREVGYCQGSGFIVGLLLMQMPEEEAFAVLVQIMQQHRMRHMFKPSMSELGLCMYQLENLVQEQIPDMHIHFQQQGFQTTMYASSWFLTLYTTTLNVNLSCRIMDVFLSEGMEFIFKVALALLLTGKDTLLCLDMEAMLKFFQKELPGRVEADVEGFFNLAYSIKLNTKRMKKMEKEYQDLKKKEQEEMAELRRLRRENCLLKQRNELLEAESAELADRLVRGQVSRAEEEETSYAIQTELMQLRRSYLEVSHQLENANEEVRGLSLRLQ----ENNVSIDSNNSRQSSIDELCMKEEALKQRDEMVSCLLEELVKVRQGLAESEDQIRNLKAKVEELEEDKKTLRETTPDNSVAHLQDELIASKLREAEASLSLKDLKQRVQELSSQWQRQLAENQRSESERTTNAVDSTPKKLLTNFFDSSKSSEHTQKLEEELMTTRIREMETLTELKELRLKVMELETQVQVSTNQLRRQDEEHKKLKEELEMAVTREKDMSNKAREQQHRYSDLESRMKDELMNVKIKFTEQSQTVAELKQEISRLETKNSEM 733          
BLAST of Rab-GAP TBC domain-containing protein vs. UniProt/SwissProt
Match: sp|Q96CN4|EVI5L_HUMAN (EVI5-like protein OS=Homo sapiens OX=9606 GN=EVI5L PE=1 SV=1)

HSP 1 Score: 418.698 bits (1075), Expect = 1.669e-131
Identity = 273/739 (36.94%), Postives = 420/739 (56.83%), Query Frame = 1
Query:  139 KNRSLQMDSKSVQSLTGLSRKNSVTSEMNVAFTLDDDKIXXXXXXXXXXXADINARHLEKWSNVINNWNQFSRKKSQV-KELMKQSNGVPHHYRPLIWQLITGCNEDNVNSVQLKAIYPEYLKQQSPCEKAIRRDIARTYPQHDLFKDPNGDGQERLFNIMKAYSIHDREVGYCQGSGFIGGLLLIQMPEEDAFVVLVSLMFEHQLRNLYKPNMSELGLCMYQLDCLVEEQLPKLALHFRSHNFHATVYASGWFLTLFTLSFSIELSSRVMDLFMVEGIDIIFKISLAYLTTFQDELLKLDMESMLRFLQSIGPQQLELDPNPLFDLAVQLKLNTRKMKKAEKEYLALKMEEEENHVELRRLRTENGLLLQRIDRLEK----ECELLNSNYITKNMAYLQQCDEIKILRIDISEAKRKVDNLKQNLSGTEIQLQLAVGQLNGRINEENNKDIIQKRRSVDVSSDLVHQLQTQLVNIRLKEAETNASFXXXXXXXXXXXXXXXXXXXTPTE-EVAKLQEDLVAIKLREAETGLSLKDSLKRLNELNKLWMNHVDQCHQNLENVQTDSKKDRHSLYEGKDSTNK-DIGILQ---LSRKLVEAEYASDLNAARQKIMETEARQQIYCRQVSRXXXXXXXXXXXXXXYIVIQKKLRLELKEAERRCIDLETKRKEDLMMWKIQKMEMGSIIAELKQKVARMETQREEISTSSRMGHN------KNLPPQIEMKQTSTRLEHQP 2307
            +NR L+ DSKS++S+ G SR+NS +S ++ +    +                        W  + N W ++ R+K ++ KEL+++  G+PHH+R ++WQL+    +     + +K  Y E LK  SPCEK IRRDIARTYP+H+ FK  +  GQE LFN+MKAYS+ DREVGYCQGS FI GLLL+QMPEE+AF V V LM E++LR L+KP+M+ELGLC+YQ + +++EQLP L  HFRS +FH ++YAS WFLTLF  +F + +++RV D+FM EG++I+F++ LA L   Q EL++LDME M ++ Q + P Q +  P+ L   A Q+K N +KMK+ EKEY A+K +E E  +E++RLRTEN LL QRI+ LEK      +    NY+ K         E+ ++R   S A   +   +  +       QL   Q N R+ E                 D V  L+T+L   RL+E ET  +    +E   ++ +  +R S  P E  VA+LQE+L A+K+RE +   S ++   +L EL+  W  H+ +  +                   K+S  K  +G LQ   +S +L EA+  ++    RQ+++E E +  I+   ++R++ E   L+EKL+      K L+ +L E+ R+  + E K KE++M  ++++ +  + +AE++Q++A +E QREE     ++ H+      + L  QIE  +   RL   P
Sbjct:   44 QNRLLEADSKSMRSMNG-SRRNSGSSLVSSSSASSNLSHLEEDTWIL-------------WGRIANEWEEWRRRKEKLLKELIRK--GIPHHFRAIVWQLLCSATD-----MPVKNQYSELLKMSSPCEKLIRRDIARTYPEHEFFKGQDSLGQEVLFNVMKAYSLVDREVGYCQGSAFIVGLLLMQMPEEEAFCVFVRLMQEYRLRELFKPSMAELGLCIYQFEYMLQEQLPDLNTHFRSQSFHTSMYASSWFLTLFLTTFPLPVATRVFDIFMYEGLEIVFRVGLALLQVNQAELMQLDMEGMSQYFQRVIPHQFDSCPDKLVLKAYQVKYNPKKMKRLEKEYAAMKSKEMEEQIEIKRLRTENRLLKQRIETLEKGQVTRAQEAEENYVIKR--------ELAVVRQQCSSAAEDLQKAQSTIR------QLQEQQENPRLTE-----------------DFVSHLETELEQSRLRETETLGAL---REMQDKVLDMEKRNSSLPDENNVAQLQEELKALKVREGQAVASTRELKLQLQELSDTWQAHLARGGR------------------WKESPRKLVVGELQDELMSVRLREAQALAEGRELRQRVVELETQDHIHRNLLNRVEAERAALQEKLQYLAAQNKGLQTQLSESRRKQAEAECKSKEEVMAVRLREADSMAAVAEMRQRIAELEIQREEGRIQGQLNHSDSSQYIRELKDQIEELKAEVRLLKGP 709          
BLAST of Rab-GAP TBC domain-containing protein vs. UniProt/SwissProt
Match: sp|O60447|EVI5_HUMAN (Ecotropic viral integration site 5 protein homolog OS=Homo sapiens OX=9606 GN=EVI5 PE=1 SV=3)

HSP 1 Score: 397.897 bits (1021), Expect = 2.302e-123
Identity = 251/642 (39.10%), Postives = 392/642 (61.06%), Query Frame = 1
Query:  118 LLAKLEEKNRSLQMDSKSVQSLTGLSRKNSVTSEMNVAFTLDDDKIXXXXXXXXXXXADINARHLEKWSNVINNWNQFSRKK-SQVKELMKQSNGVPHHYRPLIWQLITGCNEDNVNSVQLKAIYPEYLKQQSPCEKAIRRDIARTYPQHDLFKDPNGDGQERLFNIMKAYSIHDREVGYCQGSGFIGGLLLIQMPEEDAFVVLVSLMFEHQLRNLYKPNMSELGLCMYQLDCLVEEQLPKLALHFRSHNFHATVYASGWFLTLFTLSFSIELSSRVMDLFMVEGIDIIFKISLAYLTTFQDELLKLDMESMLRFLQSIGPQQLELDPNPLFDLAVQLKLNTRKMKKAEKEYLALKMEEEENHVELRRLRTENGLLLQRIDRLEK-ECELLNSNYITKNMAYLQQCDEIKILRIDISEAKRKVDNLKQNLSGTEIQLQLAVGQLNGRINEENNKDIIQKRRSVDVSSDLVHQLQTQLVNIRLKEAETNASFXXXXXXXXXXXXXXXXXXXTPT---------EEVAKLQEDLVAIKLREAETGLSLKDSLKRLNEL---NKLWMNHVDQCHQNL----ENVQTDSKKDRHSLYEGKDSTNKDIGI------LQLSRKLVEAEYASDLNAARQKIMETEARQQ 1971
            LLAKLEE+NR L+ DSKS++S+ G SR+NS +S ++ +    +       +                W  ++N W    +KK  QVKEL+ +  G+PHH+R ++WQL+  C+     S+ +K  Y E LK  SPCEK IRRDIARTYP+H+ FK+ +  GQE LFN+MKAYS+ DREVGYCQGS FI GLLL+QMPEE+AF V V LM +++LR L+KP+M+ELGLCMYQ +C+++E LP+L +HF+S +FH ++YAS WFLT+F  +F + +++R+ D+FM EG++I+F++ LA L   Q EL++LDME ML+  Q + P Q +  P+ L   A Q+K N++KMKK EKEY  +K +E E  VE++RLRTEN LL QRI+ LEK +C   +SNY   N  ++ Q  E ++++  +SEA+                 Q A+ ++  ++ +      I+KR +     + + +LQ +L+ ++L+EAE     +EL+++ ++LEE  +R     T           + +LQ++L+ I+LREAET   +++  +R+ E+   N++  NH+ +  Q +    E VQ  S +++  L +  ++  K   I        ++ +L EA+  + +   RQ I E E +++
Sbjct:   85 LLAKLEEQNRLLETDSKSLRSVNG-SRRNSGSSLVSSSSASSNLSHLEEDSWIL-------------WGRIVNEWEDVRKKKEKQVKELVHK--GIPHHFRAIVWQLL--CS---AQSMPIKDQYSELLKMTSPCEKLIRRDIARTYPEHNFFKEKDSLGQEVLFNVMKAYSLVDREVGYCQGSAFIVGLLLMQMPEEEAFCVFVKLMQDYRLRELFKPSMAELGLCMYQFECMIQEHLPELFVHFQSQSFHTSMYASSWFLTIFLTTFPLPIATRIFDIFMSEGLEIVFRVGLALLQMNQAELMQLDMEGMLQHFQKVIPHQFDGVPDKLIQAAYQVKYNSKKMKKLEKEYTTIKTKEMEEQVEIKRLRTENRLLKQRIETLEKHKC---SSNY---NEDFVLQL-EKELVQARLSEAES----------------QCALKEMQDKVLD------IEKRNNSLPDENNIARLQEELIAVKLREAEAIMGLKELRQQVKDLEEHWQRHLARTTGRWKDPPKKNAMNELQDELMTIRLREAETQAEIREIKQRMMEMETQNQINSNHLRRAEQEVISLQEKVQYLSAQNKGLLTQLSEAKRKQAEIECKNKEEVMAVRLREADSIAAVAELRQHIAELEIQKE 676          
BLAST of Rab-GAP TBC domain-containing protein vs. UniProt/SwissProt
Match: sp|P97366|EVI5_MOUSE (Ecotropic viral integration site 5 protein OS=Mus musculus OX=10090 GN=Evi5 PE=1 SV=2)

HSP 1 Score: 368.622 bits (945), Expect = 2.445e-112
Identity = 242/702 (34.47%), Postives = 393/702 (55.98%), Query Frame = 1
Query:  118 LLAKLEEKNRSLQMDSKSVQSLTGLSRKNSVTSEMNVAFTLDDDKIXXXXXXXXXXXADINARHLEKWSNVINNWNQFSRKK-SQVKELMKQSNGVPHHYRPLIWQLITGCNEDNVNSVQLKAIYPEYLKQQSPCEKAIRRDIARTYPQHDLFKDPNGDGQERLFNIMKAYSIHDREVGYCQGSGFIGGLLLIQMPEEDAFVVLVSLMFEHQLRNLYKPNMSELGLCMYQLDCLVEEQLPKLALHFRSHNFHATVYASGWFLTLFTLSFSIELSSRVMDLFMVEGIDIIFKISLAYLTTFQDELLKLDMESMLRFLQSIGPQQLELDPNPLFDLAVQLKLNTRKMKKAEKEYLALKMEEEENHVELRRLRTENGLLLQRIDRLEKECELLNSNYITKNMAYLQQCDEIKILRIDISEAKRKVDNLKQNLSGTEIQLQLAVGQLNGRINEENNKDIIQKRRSVDVSSDLVHQLQTQLVNIRLKEAETNASFXXXXXXXXXXXXXXXXXXXTPTEE-VAKLQEDLVAIKLREAETGLSLKDSLKRLNELNKLWMNHVDQCHQNLENVQTDSKKDRHSLYEGKDSTNKDIGILQLSRKLVEAEYASDLNAARQKIMETEARQQIYCRQVSRXXXXXXXXXXXXXXYIVIQKKLRLELKEAERRCIDLETKRKEDLMMWKIQKMEMGSIIAELKQKVARMETQREE 2217
            LLAKLEE+NR ++ DSKS++S+ G SR+NS +S ++ +    +       +                W  ++N W+   +KK  QVKEL+++  G+PHH+R ++WQL+      N  S+ +K  Y E LK  SPCEK IRRDIARTYP+H+ FK+ +  GQE LFN+MKAYS+ DRE+   +          +QMPEE+AF V V LM +++LR L+KP+M+ELGLCMYQ +C+++E LP+L +HF+S +FH ++YAS WFLT+F  +F + +++R+ D+FM EG++I+F++ LA L   Q EL++LDME ML+  Q + P Q +  P  L   A Q+K N++KMKK EKE                                          Y T     +++  EIK LR +    K++++ L+++                              + S   + D V QL+ +LV  RL EAE+  + +E+++K  ++E++N      P E  +A+LQE+L+A+KLREAE  + LK+  +++  L + W  H+ +     ++        ++++ E +D          +S +L EAE  +++   +Q++ME E + QI   Q+ R ++E+  L+EK+    V  K L  +L EA+RR  ++E K KE++M  ++++ +  + +AEL+Q +A +E Q+EE
Sbjct:   85 LLAKLEEQNRLIETDSKSLRSVNG-SRRNSGSSLVSSSSASSNLSHLEEDSWIL-------------WGRIVNEWDDVRKKKEKQVKELVRK--GIPHHFRAIVWQLLC-----NAQSMTIKDQYSELLKMTSPCEKLIRRDIARTYPEHNFFKEKDSLGQEVLFNVMKAYSLVDRELVTVRAVLSSLDCCCMQMPEEEAFCVFVKLMQDYRLRELFKPSMAELGLCMYQFECMIQEYLPELFVHFQSQSFHTSMYASSWFLTIFLTTFPLPIATRIFDIFMSEGLEIVFRVGLALLQMNQAELMQLDMEGMLQHFQKVIPHQFDGGPEKLIQSAYQVKYNSKKMKKLEKE------------------------------------------YTTIKTKEMEEQGEIKRLRTENRLLKQRIETLEKH------------------------------KCSSTYNEDFVLQLEKELVQARLSEAESQCALKEMQDKVLDIEKKNNSF---PDENNIARLQEELIAVKLREAEAIMGLKELRQQVRTLEEHWQRHLARTSGRWKD-----PPKKNAVNELQDEL--------MSIRLREAETQAEIREMKQRMMEMETQNQINSNQLRRAEQEVNSLQEKVCSLSVKNKGLLAQLSEAKRRQAEIECKNKEEVMAVRLREADSIAAVAELQQHIAELEIQKEE 677          
BLAST of Rab-GAP TBC domain-containing protein vs. UniProt/SwissProt
Match: sp|A2AWA9|RBGP1_MOUSE (Rab GTPase-activating protein 1 OS=Mus musculus OX=10090 GN=Rabgap1 PE=1 SV=1)

HSP 1 Score: 257.684 bits (657), Expect = 2.253e-70
Identity = 143/374 (38.24%), Postives = 216/374 (57.75%), Query Frame = 1
Query:  310 LEKWSNVINNWN-QFSRKKSQVKELMKQSNGVPHHYRPLIWQLITGCNEDNVNSVQLKAIYPEYLKQQSPCEKAIRRDIARTYPQHDLFKDPNGDGQERLFNIMKAYSIHDREVGYCQGSGFIGGLLLIQMPEEDAFVVLVSLMFEHQLRNLYKPNMSELGLCMYQLDCLVEEQLPKLALHFRSHNFHATVYASGWFLTLFTLSFSIELSSRVMDLFMVEGIDIIFKISLAYLTTFQDELLKLDMESMLRFLQSIGPQQLELDPNP--LFDLAVQLKLNTRKMKKAEKEYLALKMEEEENHVELRRLRTENGLLLQRIDRLEKECELLNSNYITKNMAYLQQCDEIKILRIDISEAKRKVDNLKQNLSGTEIQL 1422
            LE W  +++ W+   S +  Q+  L++  +GVP   R  +WQL+ GC+    N+  L   Y   + ++SP + AI RDI RT+P HD FKD  GDGQ+ L+ I KAYS++D E+GYCQG  F+  +LL+ MPEE AF VLV +MF++ LR L+K N  +L    YQL+ L++E +P L  HF   +  A +YAS WFLTLFT  F + +   ++DL + EGI +IF ++L  L T +D+LL  D E  L+F +   P++   + N   L +LA   K++ +K+KK EKEY  ++ ++ +    + R   EN  L +   RLE+E + L    +T  +A          LR D+  A+ K D L + L  T+ +L
Sbjct:  533 LETWGELLSKWHLNLSVRPKQLSSLVR--SGVPEALRGEVWQLLAGCH----NNDHLVEKYRILITKESPQDSAITRDINRTFPAHDYFKDTGGDGQDSLYKICKAYSVYDEEIGYCQGQSFLAAVLLLHMPEEQAFSVLVKIMFDYGLRELFKQNFEDLHCKFYQLERLMQEYIPDLYNHFLDISLEAHMYASQWFLTLFTAKFPLYMVFHIIDLLLCEGISVIFNVALGLLKTSKDDLLLTDFEGALKFFRVQLPKRYRSEENAKRLMELACNTKISQKKLKKFEKEYHTMREQQAQQEDPIERFERENRRLQEANMRLEQENDDLAHELVTSKIA----------LRKDLDNAEEKADALNKELLMTKQKL 890          
BLAST of Rab-GAP TBC domain-containing protein vs. TrEMBL
Match: T1J7S3 (Rab-GAP TBC domain-containing protein OS=Strigamia maritima OX=126957 PE=4 SV=1)

HSP 1 Score: 508.064 bits (1307), Expect = 9.418e-164
Identity = 317/771 (41.12%), Postives = 483/771 (62.65%), Query Frame = 1
Query:  118 LLAKLEEKNRSLQMDSKSVQSLTGLS---RKNSVTSEMNVAFTLDDDKIXXXXXXXXXXXADINARHLEKWSNVINNWNQFSRKKSQ-VKELMKQSNGVPHHYRPLIWQLITGCNEDNVNSVQLKAIYPEYLKQQSPCEKAIRRDIARTYPQHDLFKDPNGDGQERLFNIMKAYSIHDREVGYCQGSGFIGGLLLIQMPEEDAFVVLVSLMFEHQLRNLYKPNMSELGLCMYQLDCLVEEQLPKLALHFRSHNFHATVYASGWFLTLFTLSFSIELSSRVMDLFMVEGIDIIFKISLAYLTTFQDELLKLDMESMLRFLQSIGPQQLELDPNPLFDLAVQLKLNTRKMKKAEKEYLALKMEEEENHVELRRLRTENGLLLQRIDRLEKECELLNSNYITKNMAYLQQCDEIKILRIDISEAKRKVDNLKQNLSGTEIQLQLAVGQLNGRINEENNKDIIQKRRSVDVSSDLVHQLQTQLVNIRLKEAETNASFXXXXXXXXXXXXXXXXXXXTPTE-EVAKLQEDLVAIKLREAETGLSLKDSLKRLNELNKLWMNHVDQCHQNLENVQTDSKKDRHSLYEGKDSTNKDIG---ILQ-----LSRKLVEAEYASDLNAARQKIMETEARQQIYCRQVSRXXXXXXXXXXXXXXYIVIQKKLRLELKEAERRCIDLETKRKEDLMMWKIQKMEMGSIIAELKQKVARMETQREEISTSSRMGHNKNLPPQIEMKQTSTRL-----EHQPLSNKWKDLPHTIMTDSIGPLDEI 2376
            LLA+LEE NR L+ D+KS+ SL+G S   R++S TS+++++        S ++   +    D+   HL  W  VI +W  +S+KKS  V++L+++  G+PHH+R L WQL+  CN    ++ Q +  + EY+KQ SPCEK IRRDIARTYP+H+ FK+ +G GQE LFN+MKAYS+HDREVGYCQGS FI GLLL+QMPEE+ F VLV +M E+++R ++KP+M+ELGLCM+QL+ L++E LP+L +HF+S +FH ++YAS WFLTLF+ +  + L+  +MDLF+ EG+++IF+++++ L   +D+LL +DME ML+FLQ   P + ELD   L  +A Q+K NT+KMKK EKEY   + +E+E  VE+RRLRTEN LL QRI+ LE+E   L    I   +   Q+ +E   L+ ++S  +++   L Q+    E+++     ++  R+     KD          ++DL+  LQ +LVNIRLKEAE+ A  +++K +  ELEE N++L   P +  VA LQE+L+A+KLREAET LS+K+ ++R+N+L+ LW  H+ + H                   G++   KD G   ILQ     L+ +L EA   ++L   + K+ME E++  +   QV RL+EE+  L   +E     ++ +   LK+ ER+  DLE+K KEDL+M++I +ME     AEL+Q+++ ME + EE+  + ++    N   + E+++   R+     E   L    K L  TIM  + G  D+I
Sbjct:   27 LLARLEELNRKLEADAKSLNSLSGTSNHSRRSSDTSQISLS--------SGSAQGEAEDAEDV--WHL--WGRVIADWELYSKKKSSFVRDLVRK--GIPHHFRGLAWQLL--CN---AHTSQAREQFAEYMKQTSPCEKVIRRDIARTYPEHEFFKEKDGPGQESLFNVMKAYSLHDREVGYCQGSAFIVGLLLMQMPEEETFAVLVKIMQEYRMREMFKPSMAELGLCMFQLEFLIQELLPELHVHFQSQSFHVSMYASSWFLTLFSTALPLPLAFHIMDLFISEGMEMIFRVAVSILQNCKDQLLSMDMEGMLKFLQKDMPAKFELDSESLLQVAFQVKYNTKKMKKLEKEYTTKRTKEQEEMVEMRRLRTENRLLRQRIECLEQESSSLADRLIQGQVTRAQEAEETFALKRELSALRQQNTELSQHKEENELKINFLEEEVK-RLQLLECKD----------ANDLIQVLQEELVNIRLKEAESQAIIKDMKVRMFELEEANKKLRDAPPDNNVAHLQEELIALKLREAETNLSMKELVQRINDLSALWEKHLKENHM------------------GENGKKKDYGKNTILQLQDDLLTARLKEATAVAELKEFQHKVMELESQNHVSLNQVRRLEEEVEKLNSTIESLQSSERDMLQRLKDEERKFYDLESKMKEDLVMYRIGEMERAQNAAELEQRLSSMECKHEEMMAARQL----NESDREEVRELQDRVVDLQSEVIRLDALNKKLTGTIMNHNYGGGDKI 745          
BLAST of Rab-GAP TBC domain-containing protein vs. TrEMBL
Match: A0A0X3NSX4 (Ecotropic viral integration site 5 ortholog (Fragment) OS=Schistocephalus solidus OX=70667 GN=EVI5 PE=4 SV=1)

HSP 1 Score: 511.531 bits (1316), Expect = 2.525e-163
Identity = 343/897 (38.24%), Postives = 496/897 (55.30%), Query Frame = 1
Query:   88 FKMATDEQEILLAKLEEKNRSLQMDSKSVQ---SLTGLSRK-------------NSVTSEMNVAF--TLDDDKIXXXXXXXXXXXADINARH----------LEKWSNVINNWNQFSRKKSQVKELMKQSNGVPHHYRPLIWQLITGCNEDNVNSVQLKAIYPEYLKQQSPCEKAIRRDIARTYPQHDLFKDPNGDGQERLFNIMKAYSIHDREVGYCQGSGFIGGLLLIQMPEEDAFVVLVSLMFEHQLRNLYKPNMSELGLCMYQLDCLVEEQLPKLALHFRSHNFHATVYASGWFLTLFTLSFSIELSSRVMDLFMVEGIDIIFKISLAYLTTFQDELLKLDMESMLRFLQSIGPQQLELDPNPLFDLAVQLKLNTRKMKKAEKEYLALKMEEEENHVELRRLRTENGLLLQRIDRLEKECELLNSNYITKNMAYLQQCDEIKILRIDISE--AKRKVDNLKQNLSGTEIQLQL------------------AVGQLNG-RINEENNKDIIQKRRSVD---------------VSSD-----LVHQLQTQLVNIRLKEAETNASFXXXXXXXXXXXXXXXXXXXTPTEEVAKLQEDLVAIKLREAETGLSLKDSLKRLNELNKLWMNHVDQCHQNLENVQTD-------SKKDRHSLYEGKDSTNKDIGILQLSRKLVEAEYASDLNAARQKIMETEARQQIYCRQVSRXXXXXXXXXXXXXXYIVIQKKLRLELKEAERRCIDLETKRKEDLMMWKIQKMEMGSIIAELKQKVARMET--QREEISTSSR-MGHNKNLP-------------------PQIEMKQTSTRLEHQP--------------------------LSNKWKDLPHTIMTDSIGPLDEICFNPDDPMIT 2406
              +  D  E L  KLEE NR+L  D+K+V    +   LSRK             +  T  +N +   T  D K +   +  +   + +N+             ++W +VINNW+ +S+KKSQV EL+K+  G+P  +RPL+WQL TG ++       LK  Y +YLK+ SP E+AIRRD++RTYP+HD FK+    GQ  L+N+MKAYS+HDREVGYCQGSGFI GLLL+QM E DAF VLV LM E++LR LYKP MSELG+ M+QLD L+ E LP L  HF +  F  ++YAS WFLTLF  +F++ +++RVMDLF+ EG+D I ++SLA LT F   L+++DMESM+ FLQ     + E     LF+ A  LKLN RK+KK   EYL ++ +E    +ELRRLRTENGLL+QR+ R+E++   L S  +  N+   Q  +E+  LR  ++   A+     L      + +                      ++  +NG         D++++R S                 V+SD      ++QL+T LV+IR++EAET++S R  K K R LEE+   + + PTE+V  LQ++L+ +KLREAE  L +K+  +RL+E+  LW    +QC +   N  +D       S    HS   GK ST+ D     LS +L+EA+Y + +    QK+ E  A Q++  RQ SR DE +  L++KL+  ++ +  L  +LK+AE   +D+E KRK D ++W+I+++E+ S +AE+KQ+   +E     E  S + R +  N  +P                   P  E+++ S   E QP                          LS+ WKDLP  IMTDSIGPL++IC  PDDPMIT
Sbjct:   11 LSIVADSDEALAHKLEELNRNLSSDTKAVNFAMAPVHLSRKASTSSLVSSASDESRYTPNLNGSTLSTGSDKKHTRWPSFTNAFPSFLNSGAGSAPLSTMSLWQQWDSVINNWDLYSKKKSQVSELIKR--GIPDEFRPLVWQLYTGAHDS-----PLKNAYHKYLKETSPFERAIRRDVSRTYPKHDFFKEKGAGGQTSLYNVMKAYSLHDREVGYCQGSGFIVGLLLMQMNEVDAFAVLVQLMNEYRLRELYKPCMSELGVRMHQLDSLLAEHLPDLYTHFVAQAFAPSLYASAWFLTLFATAFTLPMATRVMDLFIAEGMDFILRLSLAILTQFAPRLIQMDMESMIFFLQQTESTEWEDHGRILFETATALKLNQRKLKKLRNEYLTVRSQERGEQIELRRLRTENGLLMQRLARMEEDNNYLASQLVDCNLQRAQLAEEVIRLRGSVASMYARESTATLASASEPSTVSALTASASTAPASSSALPDKVPSITGVNGASATASPESDLLRERDSSTSGAASWTSLSSCSGRVTSDRLMIETINQLETDLVHIRVREAETSSSLRGAKAKIRLLEEKLDNVLRKPTEQVEVLQDELMRVKLREAEGLLQMKELRQRLDEIQSLWE---EQCGRRRANKPSDLPGFLRTSTGLLHSKILGKSSTDSDGQ--HLSDRLLEAKYLTQIADLNQKVKELTAHQELASRQASRHDERLASLQDKLDSSLLREASLIADLKQAECTIVDVEAKRKSDGILWRIREIELNSQLAEIKQRYGELECLHDAEYASNAFRDLTRNPIVPVGATALPSAPCDSSCSSAAPTPEVRRDS---EPQPIKSDSDTPRAERRTSEARTPLSFSGRLSSTWKDLPPAIMTDSIGPLEDICLLPDDPMIT 892          
BLAST of Rab-GAP TBC domain-containing protein vs. TrEMBL
Match: A0A2R2MQI6 (EVI5-like protein isoform X2 OS=Lingula unguis OX=7574 GN=LOC106166103 PE=4 SV=1)

HSP 1 Score: 501.901 bits (1291), Expect = 7.179e-160
Identity = 312/739 (42.22%), Postives = 458/739 (61.98%), Query Frame = 1
Query:   97 ATDEQEILLAKLEEKNRSLQMDSKSV------QSLTGLSRK------NSVTSEMNVAFTLDDDKIXXXXXXXXXXXADINARHLEKWSNVINNWNQFSRKKSQVKELMKQSNGVPHHYRPLIWQLITGCNEDNVNSVQLKAIYPEYLKQQSPCEKAIRRDIARTYPQHDLFKDPNGDGQERLFNIMKAYSIHDREVGYCQGSGFIGGLLLIQMPEEDAFVVLVSLMFEHQLRNLYKPNMSELGLCMYQLDCLVEEQLPKLALHFRSHNFHATVYASGWFLTLFTLSFSIELSSRVMDLFMVEGIDIIFKISLAYLTTFQDELLKLDMESMLRFLQSIGPQQLELDPNPLFDLAVQLKLNTRKMKKAEKEYLALKMEEEENHVELRRLRTENGLLLQRIDRLEKECELLNSNYITKNMAYLQQCDEIKILRIDISEAKRKVDNLKQNLSGTEIQLQLAVGQLNGRINEENNKDIIQKRRSVDVSSDLVHQLQTQLVNIRLKEAETNASFXXXXXXXXXXXXXXXXXXXTPTEEVAKLQEDLVAIKLREAETGLSLKDSLKRLNELNKLWMNHVDQCHQNLENVQTDSKKDRHSLYEGKDSTNKDIGILQLSRKLVEAEYASDLNAARQKIMETEARQQIYCRQVSRXXXXXXXXXXXXXXYIVIQKKLRLELKEAERRCIDLETKRKEDLMMWKIQKMEMGSIIAELKQKVARMETQREEISTSSRM---GHNKNLPPQI 2268
            AT E   LLAKLEE NR  + D+KS+       S++G SRK      NS+TS ++   TLDD     +                  W  VI +W  +++KK+ +++L+++  G+PHH+R L WQ +  CN    +  + K +Y EYLK+ SPCEK I+RDIARTYP+H LFKD +G GQE LFN+MKAYSI DREVGYCQGS FI GLLL+ MPEE+AF VLV LM E++LR L+KP+M+ELGLCM+QL+C+V++QLP L +HF+S +FH ++YAS WFLTLFT +  +E+S RVMDL++ EG++IIFKI +A L   Q EL+  DME ML+F Q   P + E D   L  +A  +K N RKMKK EKEY  LK +E E  +ELRRLRTEN LL QRID LEKE   L    I   +   Q+ +E+ IL+ D+S  + + + LK+ L     + Q  + QL     +E    +           +++ QLQ++LV +RLK A+ + + +E+ +K RELE  NRRL   P  E+A +QE+L+A+KLREAE  L++K+  +++  L   W  + ++ + + +  + +SK    +L       ++ +G+     KL EAE  +D+   + ++ME E + QI   Q+ R+DEE   LK+K+E     +K+LR E+   ER+  D E++ +E+ MM +I+  E  + IAE++QK+A +E Q +E+ T+ ++   G  ++L  +I
Sbjct:   16 ATPEDLALLAKLEEANRQFEQDTKSLISTTSRGSVSGHSRKGSDISSNSITSTLS-NLTLDDQSSPQDEYAV--------------WGKVIGDWETYAKKKTYIRDLVRK--GIPHHFRGLAWQHV--CN---AHDSENKELYAEYLKKTSPCEKLIKRDIARTYPEHSLFKDKDGLGQESLFNVMKAYSIVDREVGYCQGSCFIVGLLLMLMPEEEAFAVLVKLMKEYRLRELFKPSMTELGLCMFQLECMVQDQLPSLYMHFQSQSFHTSMYASHWFLTLFTTALPLEMSFRVMDLYISEGMEIIFKIGIAILQDCQIELMTCDMEGMLKFFQKDMPAKYEQDYERLLSIAYDVKYNARKMKKLEKEYTTLKAKENEEQIELRRLRTENRLLRQRIDNLEKETATLADRLIHNQVTKAQEAEEMFILKRDMSGMRTQNEELKKQLE----EAQNTIKQL----QKERTSSVTSTTSVDSEQEEVIKQLQSELVTVRLKAADQSCNVKEMVDKIRELENTNRRLQTEPESEIASIQEELIAVKLREAEGRLAVKELRQQIKYLTDYWDKYWEKVNASPKTKEKNSKAVVQNL------QDELMGV-----KLREAESLADVKEMKARVMELETQNQICSHQIRRMDEENKKLKDKIEAMGEKEKELRNEILALERKSADSESRVREESMMTRIKNAEHSTTIAEMRQKIAELEIQNQELVTAGQLQSKGETQDLENRI 713          
BLAST of Rab-GAP TBC domain-containing protein vs. TrEMBL
Match: A0A1E1XJV9 (Rab-GAP TBC domain-containing protein (Fragment) OS=Amblyomma sculptum OX=1581419 PE=2 SV=1)

HSP 1 Score: 500.745 bits (1288), Expect = 2.138e-159
Identity = 291/718 (40.53%), Postives = 449/718 (62.53%), Query Frame = 1
Query:  118 LLAKLEEKNRSLQMDSKSVQSLTGL-SRKNSVTSEMNVA-------FTLDDDKIXXXXXXXXXXXADINARHLEKWSNVINNWNQFSRKK-SQVKELMKQSNGVPHHYRPLIWQLITGCNEDNVNSVQLKAIYPEYLKQQSPCEKAIRRDIARTYPQHDLFKDPNGDGQERLFNIMKAYSIHDREVGYCQGSGFIGGLLLIQMPEEDAFVVLVSLMFEHQLRNLYKPNMSELGLCMYQLDCLVEEQLPKLALHFRSHNFHATVYASGWFLTLFTLSFSIELSSRVMDLFMVEGIDIIFKISLAYLTTFQDELLKLDMESMLRFLQSIGPQQLELDPNPLFDLAVQLKLNTRKMKKAEKEYLALKMEEEENHVELRRLRTENGLLLQRIDRLEKECELLNSNYITKNMAYLQQCDEIKILRIDISEAKRKVDNLKQNLSGTEIQLQLAVGQLNGRINEENNKDIIQKRRSVDV-SSDLVHQLQTQLVNIRLKEAETNASFXX-XXXXXXXXXXXXXXXXXTPTEEVAKLQEDLVAIKLREAETGLSLKDSLKRLNELNKLWMNHVDQCHQNLENVQTDSKKDRHSLYEGKDSTNKDIGILQLSRKLVEAEYASDLNAARQKIMETEARQQIYCRQVSRXXXXXXXXXXXXXXYIVIQKKLRLELKEAERRCIDLETKRKEDLMMWKIQKMEMGSIIAELKQKVARMETQREEISTSSRM 2238
            LLA+LEE+NR L+ DSKS+ SLT   SRK+S TS+++VA         LDDD                       W  ++N W+ + +KK + VKE +++  G+P H+R + WQL+  CN     +   +  Y EYLK  SPCEK IRRDIARTYP+H+ F+D +G GQE LFN+MKAYS+HDREVGYCQGS FI GLLL+QMPEE+ F VLV +M +++LR +YKP+M+ELGLCMYQL+CLV+E +P++ +HF++ +FH ++YAS WFLTLFT      L+ RVMDLF+ EG+++IF+I++A L   ++++L+LDME MLR+ Q   P + E DP+ L +LA+Q+K N++K+KK EKEY ALK++E E  +ELRRLRTEN LL QRI+ LE+E   L    I   +   Q+ ++  I+       KR++  L+Q     E+ +Q  + + N +I E +      +  S+D  + DL+  LQ +LV ++L+EAE   + R   +  +   EE  R    TP + VA LQE+L+A+KLREAE  LS+K+  +++ +L   W  H  +     +N  T S+      + G  S    +    ++ +L EA+  ++L   RQ++ME E + Q+   Q+ R  +EI   ++  +  +  +++L+  +++  R+  +LE++ KE+ M  +I+++E   IIAE+KQK++ +E + +E+ T+ ++
Sbjct:   92 LLARLEEQNRLLESDSKSLNSLTSTHSRKSSDTSQVSVASGASQQSTALDDDSEDAWVL----------------WGRMVNEWDTYIKKKNAYVKEQVRK--GIPQHFRAIAWQLL--CN---APACAAREQYAEYLKASSPCEKVIRRDIARTYPEHEFFRDKDGPGQEGLFNVMKAYSLHDREVGYCQGSAFIVGLLLLQMPEEETFTVLVRMMQDYRLREIYKPSMAELGLCMYQLECLVQELVPEIHMHFQAQSFHTSMYASSWFLTLFTSCLPHTLACRVMDLFLSEGMEMIFRIAIAILQFCKEDILQLDMEGMLRYFQKEMPSKCETDPDYLINLALQVKYNSKKIKKLEKEYTALKVKEHEEMIELRRLRTENRLLRQRIEHLEQESSALADRLIQGQVVRAQEAEDNYII-------KRELAALRQQ----ELTVQQELQKANNQIKELHQAQT--QPSSLDSQTEDLLKSLQDELVAVKLREAEGQEAMRSLRQRIHELEEENKRLREATPDDSVATLQEELIAVKLREAEANLSMKELRQKVADLQAAWEKHRSENPHQSDNQSTPSR------WSGNKSQVNQLQEELMTARLKEADATAELRELRQRVMELETQNQVSLNQIRRQADEIAKYQQMSDKVLEKERELQSLVQDEARKITNLESQMKEERMNARIREVEHAQIIAEMKQKISSLEIKNQELLTAGQL 767          
BLAST of Rab-GAP TBC domain-containing protein vs. TrEMBL
Match: A0A067RH37 (TBC1 domain family member (Fragment) OS=Zootermopsis nevadensis OX=136037 GN=L798_07671 PE=4 SV=1)

HSP 1 Score: 494.197 bits (1271), Expect = 9.792e-159
Identity = 299/724 (41.30%), Postives = 453/724 (62.57%), Query Frame = 1
Query:  118 LLAKLEEKNRSLQMDSKSVQSLTG---LSRKNSVTSEMNVAFTLDDDKIXXXXXXXXXXXADINARHLEKWSNVINNWNQFSRKK-SQVKELMKQSNGVPHHYRPLIWQLITGCNEDNVNSVQLKAIYPEYLKQQSPCEKAIRRDIARTYPQHDLFKDPNGDGQERLFNIMKAYSIHDREVGYCQGSGFIGGLLLIQMPEEDAFVVLVSLMFEHQLRNLYKPNMSELGLCMYQLDCLVEEQLPKLALHFRSHNFHATVYASGWFLTLFTLSFSIELSSRVMDLFMVEGIDIIFKISLAYLTTFQDELLKLDMESMLRFLQSIGPQQLELDPNPLFDLAVQLKLNTRKMKKAEKEYLALKMEEEENHVELRRLRTENGLLLQRIDRLEKECELLNSNYITKNMAYLQQCDEIKILRIDISEAKRKVDNLKQNLSGTEIQLQLAVGQLN--GRINEENN-------KDIIQKRRSVDVSSDLVHQLQTQLVNIRLKEAETNASFXXXXXX-XXXXXXXXXXXXXTPTEEVAKLQEDLVAIKLREAETGLSLKDSLKRLNELNKLWMNHVDQCHQNLENVQTDSKKDRHSLYEGKDSTNKDIGILQLSRKLVEAEYASDLNAARQKIMETEARQQIYCRQVSRXXXXXXXXXXXXXXYIVIQKKLRLELKEAERRCIDLETKRKEDLMMWKIQKMEMGSIIAELKQKVARMETQREEISTSSRMGHN 2247
            LLAKLEE NR ++ D+KS+ SL+G    SRK+S TS+++         ++  +++      D    +   W  V N+W+ F +K+ S V+EL+++  GVPHH+R ++WQL+  C  D+     +K  Y +Y+K  S CEK IRRDIARTYP+HD FK+ +G GQE LFN+MKAYS+HDREVGYCQGSGFI GLLL+QMPEE+AF VLV LM E+++R+++KP M+ELGLCMYQL+ LV+E +P L +HF+S +FH ++YAS WFLTLFT +  + ++ R+MD F+ EG+++IFK++LA LT  +++LL LDME ML+F Q   P + E DP+ L  LA  +K N ++MKK EKEY  +K +E+E  VELRRLRTEN LL QR++ LE E   L    +   ++  ++ +   ++       +R++  L+     T  QL++A  ++     + EE +       ++I  KR  +    +L+  LQ +LV +RL+EAE +A  R+L+ +     E++      TP   VA LQE+L+A+KLREAE  LSLKD  +R+ EL++ W  H+ Q H+       DS   +   +E + +  + +    ++ ++ E E  +++   R K+ME E + Q+   Q+ R DEE   L+E+LE     +++   +L+E   R  DLE+K KE+LMM +I+  E    +AELKQK++R+E + EE+ T   +  N
Sbjct:    4 LLAKLEEANRLIEADAKSLNSLSGNSGHSRKSSDTSQIS---------LTSGTSSSQERTEDGEEDNWTLWGRVSNDWDNFWKKRNSFVRELVRK--GVPHHFRGIVWQLLC-CAHDS----PVKKQYADYIKATSACEKVIRRDIARTYPEHDFFKEKDGLGQESLFNVMKAYSLHDREVGYCQGSGFIVGLLLMQMPEEEAFAVLVKLMQEYKMRDMFKPTMAELGLCMYQLENLVQELIPDLHVHFQSQSFHTSMYASSWFLTLFTTALPLPVACRIMDAFLSEGMEVIFKVALALLTLGKEDLLCLDMEGMLKFFQKDLPPRAESDPDGLMLLAYNMKFNPKRMKKLEKEYTVMKTKEQEEMVELRRLRTENRLLRQRVELLEAESSELADRLVRGQVSRAEEEETTFVV-------QRELAALRHTHLETSHQLEIAHEEIRNLSLLMEETHTSRQSSLEEISMKREQLSQKEELIECLQEELVKVRLREAENDALIRDLRARIQELEEDKKTLRESTPDNSVAHLQEELIAVKLREAEANLSLKDLRQRVGELSQQWQRHL-QEHRVEATPPPDSTPKKLLFWENRGNETQRLEEELMTTRIREMEVLTEVKELRLKVMELETQVQVSTNQLRRQDEENKNLREELEKAENREREHVTKLREENHRYTDLESKMKENLMMARIRDAEHSQYVAELKQKISRLELKNEEMVTEGELRSN 703          
BLAST of Rab-GAP TBC domain-containing protein vs. Ensembl Cavefish
Match: evi5b (ecotropic viral integration site 5 protein homolog [Source:NCBI gene;Acc:103029208])

HSP 1 Score: 454.907 bits (1169), Expect = 1.947e-145
Identity = 277/705 (39.29%), Postives = 436/705 (61.84%), Query Frame = 1
Query:  118 LLAKLEEKNRSLQMDSKSVQSLTGLSRKNSVTSEMNVAFTLDDDKIXXXXXXXXXXXADINARHLEKWSNVINNWNQFSRKKSQVKELMKQSNGVPHHYRPLIWQLITGCNEDNVNSVQLKAIYPEYLKQQSPCEKAIRRDIARTYPQHDLFKDPNGDGQERLFNIMKAYSIHDREVGYCQGSGFIGGLLLIQMPEEDAFVVLVSLMFEHQLRNLYKPNMSELGLCMYQLDCLVEEQLPKLALHFRSHNFHATVYASGWFLTLFTLSFSIELSSRVMDLFMVEGIDIIFKISLAYLTTFQDELLKLDMESMLRFLQSIGPQQLELDPNPLFDLAVQLKLNTRKMKKAEKEYLALKMEEEENHVELRRLRTENGLLLQRIDRLEKECELLNSNYITKNMAYLQQCDEIKILRIDISEAKRKVDNLKQNL---SGTEIQLQL-AVGQLNGRINEENNKDIIQKRRSVDVSSDLVHQLQTQLVNIRLKEAETNASFXXXXXXXXXXXXXXXXXXXTPTE-EVAKLQEDLVAIKLREAETGLSLKDSLKRLNELNKLWMNHVDQCHQNLENVQTDSKKDRHSLYEGKDSTNKDIGILQLSRKLVEAEYASDLNAARQKIMETEARQQIYCRQVSRXXXXXXXXXXXXXXYIVIQKKLRLELKEAERRCIDLETKRKEDLMMWKIQKMEMGSIIAELKQKVARMETQREE 2217
            LLAKLEE+NR L+ DSKS++S+ G SR+NS +S ++ +    +       +                W  ++N W +  RKK + +       G+PHH+R ++WQL+  C+  N+    +K  Y E LK  SPCEK IRRDIARTYP+H+ FK+ +  GQE LFN+MKAYS+ DREVGYCQGS FI GLLL+QMPEE+AF V V LM +++LR L+KP+M+ELGLCMYQ +C+++EQLP+L +HF++ +FH ++YAS WFLT+F  SF + +++R+ D+FM EG++I+F++ LA L   Q +L++LDME ML++ Q + P QL+  P+ +  +A Q+K N +KMKK EKEY  +K +E E  VE++RLRTEN LL QRID LEKE   L    I   +   Q+ +E  +++ +++  K++ + +   L     T +QLQL    + N R +EE                  + QL+ +LV  RLKEAE+  + +E+++K  ++E+ N  L   P E  V +LQE+L+ +KLREAE    LK+  +++  L + W  H+ +     +    DS + +++  E +D          +S +L EAE  ++L   RQ+++E E + QI+  Q+ R ++E   L+E+++      K L  EL+E +R+  ++E K KE++M  ++++ +  + +AEL+Q+++ +E Q+EE
Sbjct:   88 LLAKLEEQNRLLETDSKSLRSVNG-SRRNSGSSLVSSSSASSNLSHLEEDSWIL-------------WGRIVNEWEEV-RKKKEKQLKELVRKGIPHHFRAIVWQLL--CSAQNLP---IKDQYSELLKMTSPCEKLIRRDIARTYPEHEFFKEKDSLGQEVLFNVMKAYSLVDREVGYCQGSAFIVGLLLMQMPEEEAFCVFVKLMQDYRLRELFKPSMAELGLCMYQFECMIQEQLPELHMHFQAQSFHTSMYASSWFLTIFLTSFPLPVATRIFDIFMCEGLEIVFRVGLAILQMNQADLIQLDMEGMLQYFQKVVPHQLDSGPDKVIQVAYQVKYNAKKMKKLEKEYTTIKTKEMEEQVEIKRLRTENRLLKQRIDTLEKESASLADRLIQGQVTRAQEAEENYLVKRELATVKQQSEEVSAQLEQAQSTILQLQLQQSAKGNPRYSEE-----------------FILQLERELVQARLKEAESQCALKEMQDKILDMEKRNTSL---PDENNVVRLQEELIGVKLREAEALTGLKELRQQVRNLEEHWQKHLARTAGRWK----DSPR-KNATSELQDEL--------MSVRLREAEAQAELRETRQQLLELETQNQIHSNQLRRAEQEARSLQERVQILTSQNKTLNSELQEIKRKQAEIECKNKEEVMAVRLREADNIAAMAELQQQISELEIQKEE 739          
BLAST of Rab-GAP TBC domain-containing protein vs. Ensembl Cavefish
Match: si:ch211-239f4.1 (ecotropic viral integration site 5 like [Source:NCBI gene;Acc:103041787])

HSP 1 Score: 413.69 bits (1062), Expect = 6.461e-130
Identity = 272/740 (36.76%), Postives = 433/740 (58.51%), Query Frame = 1
Query:  319 WSNVINNWNQFSRKKSQV-KELMKQSNGVPHHYRPLIWQLITGCNEDNVNSVQLKAIYPEYLKQQSPCEKAIRRDIARTYPQHDLFKDPNGDGQERLFNIMKAYSIHDREVGYCQGSGFIGGLLLIQMPEEDAFVVLVSLMFEHQLRNLYKPNMSELGLCMYQLDCLVEEQLPKLALHFRSHNFHATVYASGWFLTLFTLSFSIELSSRVMDLFMVEGIDIIFKISLAYLTTFQDELLKLDMESMLRFLQSIGPQQLELDPNPLFDLAVQLKLNTRKMKKAEKEYLALKMEEEENHVELRRLRTENGLLLQRIDRLEKECELLNSNYITKNMAYLQQCDEIKILRIDISEAKRKVDNLKQNLSGTEIQLQLAVGQLNGRINEENNKDIIQKRRSVDVSSDLVHQLQTQLVNIRLKEAETNASFXXXXXXXXXXXXXXXXXXXTPTE-EVAKLQEDLVAIKLREAETGLSLKDSLKRLNELNKLWMNHVDQCHQNLENVQTDSKKDRHSLYEGKDSTNKDIGILQLSRKLVEAEYASDLNAARQKIMETEARQQIYCRQVSRXXXXXXXXXXXXXXYIVIQKKLRLELKEAERRCIDLETKRKEDLMMWKIQKMEMGSIIAELKQKVARMETQREEISTSSRMGHNKN------LPPQI-EMKQTSTRLEHQPL------SNKWKDL----PHTIMTDSIGPLDEICFNPDDPMITSIYIHPSSSQPKLQCSDITRVNAEE 2481
            W  ++N W+++ RKK ++ KEL+++  G+PHH+R ++WQL+      N   + +K  Y E LK  SPCEK IRRDIARTYP+HD FK  +  GQE LFN+MKAYS+ DREVGYCQGS FI GLLL+QMPEE+AF V V LM E++LR L+KP+M+ELGLC+YQ + L++EQLP+L +HFRS +FH ++YAS WFLTLF     + +++R+ D+FM EG++IIF++ +A L   Q +L++LDME M +  Q + P Q +  P+ L   A Q+K N +KMKK EKEY  +K +E E  +E++RLRTEN LL QRI+ LEKE   L    I   +   Q+ +E  +++ +++  +++     ++L                    E  +D I++ +    +   VH LQT+L   RL+EAE   +    KE   ++ +  +R S  P E  VA+LQE+L  +KLRE ET    ++    + ELN+ W +H  +   + +    +S K +++L E +D          +S +L EA+  ++L   + K ++ +++ QIY +   R ++E   L+E+L++ +   K L+ +L E +R+  + + K KE++M  ++++ +  + +AEL+QK+A +E Q+EE     ++ H+ +      L  QI E+K    +L  QP       S  ++DL    P +   D +   +++  +P     T++Y H  S  P+L     T    +E
Sbjct:  125 WGRIVNEWDEWRRKKDKLLKELIRK--GIPHHFRAIVWQLLG-----NATDMPVKNQYSELLKMSSPCEKLIRRDIARTYPEHDFFKGQDSLGQEVLFNVMKAYSLVDREVGYCQGSAFIVGLLLMQMPEEEAFCVFVRLMQEYRLRELFKPSMAELGLCIYQFEYLLQEQLPELNVHFRSQSFHTSMYASSWFLTLFLTFLPLPIATRIFDIFMYEGLEIIFRVGIAILQYNQTDLIQLDMEGMSQHFQKVIPHQFDSCPDKLIFRAYQVKYNPKKMKKLEKEYTTIKNKEMEEQIEIKRLRTENRLLKQRIETLEKESAALADRLIQGQVTRAQEAEENYVIKRELAVVRQQCTTASESL--------------------EKAQDTIRELQQHAYTEQFVHGLQTKLEQSRLQEAELLGAL---KEMQDKVLDLEKRSSSLPDETNVAQLQEELKQVKLRELETLRCFRELQDTVTELNQRWQHHTSRGGGHWK----ESPK-KNALNELQDKL--------MSLRLREAQTQAELKEVKLKNLQLDSQNQIYSKAAGRHEQESAALQERLQNTLSHNKTLQGQLNEMKRKQAESDCKSKEEVMAVRLREADSMAAMAELRQKIAELEIQKEEGLIQGQLNHSDSRQYITELRDQIAELKNEIRQLRGQPSKFQNSGSGAYQDLCLASPASAEGDYLSSDEDLLQSPLP--ATALYAHHPS--PRLDSDGSTDSEGDE 817          
BLAST of Rab-GAP TBC domain-containing protein vs. Ensembl Cavefish
Match: si:ch211-239f4.1 (ecotropic viral integration site 5 like [Source:NCBI gene;Acc:103041787])

HSP 1 Score: 414.075 bits (1063), Expect = 7.324e-130
Identity = 272/740 (36.76%), Postives = 433/740 (58.51%), Query Frame = 1
Query:  319 WSNVINNWNQFSRKKSQV-KELMKQSNGVPHHYRPLIWQLITGCNEDNVNSVQLKAIYPEYLKQQSPCEKAIRRDIARTYPQHDLFKDPNGDGQERLFNIMKAYSIHDREVGYCQGSGFIGGLLLIQMPEEDAFVVLVSLMFEHQLRNLYKPNMSELGLCMYQLDCLVEEQLPKLALHFRSHNFHATVYASGWFLTLFTLSFSIELSSRVMDLFMVEGIDIIFKISLAYLTTFQDELLKLDMESMLRFLQSIGPQQLELDPNPLFDLAVQLKLNTRKMKKAEKEYLALKMEEEENHVELRRLRTENGLLLQRIDRLEKECELLNSNYITKNMAYLQQCDEIKILRIDISEAKRKVDNLKQNLSGTEIQLQLAVGQLNGRINEENNKDIIQKRRSVDVSSDLVHQLQTQLVNIRLKEAETNASFXXXXXXXXXXXXXXXXXXXTPTE-EVAKLQEDLVAIKLREAETGLSLKDSLKRLNELNKLWMNHVDQCHQNLENVQTDSKKDRHSLYEGKDSTNKDIGILQLSRKLVEAEYASDLNAARQKIMETEARQQIYCRQVSRXXXXXXXXXXXXXXYIVIQKKLRLELKEAERRCIDLETKRKEDLMMWKIQKMEMGSIIAELKQKVARMETQREEISTSSRMGHNKN------LPPQI-EMKQTSTRLEHQPL------SNKWKDL----PHTIMTDSIGPLDEICFNPDDPMITSIYIHPSSSQPKLQCSDITRVNAEE 2481
            W  ++N W+++ RKK ++ KEL+++  G+PHH+R ++WQL+      N   + +K  Y E LK  SPCEK IRRDIARTYP+HD FK  +  GQE LFN+MKAYS+ DREVGYCQGS FI GLLL+QMPEE+AF V V LM E++LR L+KP+M+ELGLC+YQ + L++EQLP+L +HFRS +FH ++YAS WFLTLF     + +++R+ D+FM EG++IIF++ +A L   Q +L++LDME M +  Q + P Q +  P+ L   A Q+K N +KMKK EKEY  +K +E E  +E++RLRTEN LL QRI+ LEKE   L    I   +   Q+ +E  +++ +++  +++     ++L                    E  +D I++ +    +   VH LQT+L   RL+EAE   +    KE   ++ +  +R S  P E  VA+LQE+L  +KLRE ET    ++    + ELN+ W +H  +   + +    +S K +++L E +D          +S +L EA+  ++L   + K ++ +++ QIY +   R ++E   L+E+L++ +   K L+ +L E +R+  + + K KE++M  ++++ +  + +AEL+QK+A +E Q+EE     ++ H+ +      L  QI E+K    +L  QP       S  ++DL    P +   D +   +++  +P     T++Y H  S  P+L     T    +E
Sbjct:  125 WGRIVNEWDEWRRKKDKLLKELIRK--GIPHHFRAIVWQLLG-----NATDMPVKNQYSELLKMSSPCEKLIRRDIARTYPEHDFFKGQDSLGQEVLFNVMKAYSLVDREVGYCQGSAFIVGLLLMQMPEEEAFCVFVRLMQEYRLRELFKPSMAELGLCIYQFEYLLQEQLPELNVHFRSQSFHTSMYASSWFLTLFLTFLPLPIATRIFDIFMYEGLEIIFRVGIAILQYNQTDLIQLDMEGMSQHFQKVIPHQFDSCPDKLIFRAYQVKYNPKKMKKLEKEYTTIKNKEMEEQIEIKRLRTENRLLKQRIETLEKESAALADRLIQGQVTRAQEAEENYVIKRELAVVRQQCTTASESL--------------------EKAQDTIRELQQHAYTEQFVHGLQTKLEQSRLQEAELLGAL---KEMQDKVLDLEKRSSSLPDETNVAQLQEELKQVKLRELETLRCFRELQDTVTELNQRWQHHTSRGGGHWK----ESPK-KNALNELQDKL--------MSLRLREAQTQAELKEVKLKNLQLDSQNQIYSKAAGRHEQESAALQERLQNTLSHNKTLQGQLNEMKRKQAESDCKSKEEVMAVRLREADSMAAMAELRQKIAELEIQKEEGLIQGQLNHSDSRQYITELRDQIAELKNEIRQLRGQPSKFQNSGSGAYQDLCLASPASAEGDYLSSDEDLLQSPLP--ATALYAHHPS--PRLDSDGSTDSEGDE 817          
BLAST of Rab-GAP TBC domain-containing protein vs. Ensembl Cavefish
Match: si:ch211-239f4.1 (ecotropic viral integration site 5 like [Source:NCBI gene;Acc:103041787])

HSP 1 Score: 403.29 bits (1035), Expect = 4.209e-126
Identity = 270/740 (36.49%), Postives = 435/740 (58.78%), Query Frame = 1
Query:  319 WSNVINNWNQFSRKKSQV-KELMKQSNGVPHHYRPLIWQLITGCNEDNVNSVQLKAIYPEYLKQQSPCEKAIRRDIARTYPQHDLFKDPNGDGQERLFNIMKAYSIHDREVGYCQGSGFIGGLLLIQMPEEDAFVVLVSLMFEHQLRNLYKPNMSELGLCMYQLDCLVEEQLPKLALHFRSHNFHATVYASGWFLTLFTLSFSIELSSRVMDLFMVEGIDIIFKISLAYLTTFQDELLKLDMESMLRFLQSIGPQQLELDPNPLFDLAVQLKLNTRKMKKAEKEYLALKMEEEENHVELRRLRTENGLLLQRIDRLEKECELLNSNYITKNMAYLQQCDEIKILRIDISEAKRKVDNLKQNLSGTEIQLQLAVGQLNGRINEENNKDIIQKRRSVDVSSDLVHQLQTQLVNIRLKEAETNASFXXXXXXXXXXXXXXXXXXXTPTE-EVAKLQEDLVAIKLREAETGLSLKDSLKRLNELNKLWMNHVDQCHQNLENVQTDSKKDRHSLYEGKDSTNKDIGILQLSRKLVEAEYASDLNAARQKIMETEARQQIYCRQVSRXXXXXXXXXXXXXXYIVIQKKLRLELKEAERRCIDLETKRKEDLMMWKIQKMEMGSIIAELKQKVARMETQREEISTSSRMGHNKN------LPPQI-EMKQTSTRLEHQPL------SNKWKDL----PHTIMTDSIGPLDEICFNPDDPMITSIYIHPSSSQPKLQCSDITRVNAEE 2481
            W  ++N W+++ RKK ++ KEL+++  G+PHH+R ++WQL+      N   + +K  Y E LK  SPCEK IRRDIARTYP+HD FK  +  GQE LFN+MKAYS+ DREVGYCQGS FI GLLL+QMPEE+AF V V LM E++LR L+KP+M+ELGLC+YQ + L++EQLP+L +HFRS +FH ++YAS WFLTLF     + +++R+ D+FM EG++IIF++ +A L   Q +L++LDME M +  Q + P Q +  P+ L   A Q+K N +KMKK EKEY  +K +E E  +E++RLRTEN LL QRI+ LEK         +T+     Q+ +E  +++ +++  +++     ++L                    E  +D I++ +    +   VH LQT+L   RL+EAE   + +E+++K  +LE+ +      P E  VA+LQE+L  +KLRE ET    ++    + ELN+ W +H  +   + +    +S K +++L E +D          +S +L EA+  ++L   + K ++ +++ QIY +   R ++E   L+E+L++ +   K L+ +L E +R+  + + K KE++M  ++++ +  + +AEL+QK+A +E Q+EE     ++ H+ +      L  QI E+K    +L  QP       S  ++DL    P +   D +   +++  +P     T++Y H  S  P+L     T    +E
Sbjct:  125 WGRIVNEWDEWRRKKDKLLKELIRK--GIPHHFRAIVWQLLG-----NATDMPVKNQYSELLKMSSPCEKLIRRDIARTYPEHDFFKGQDSLGQEVLFNVMKAYSLVDREVGYCQGSAFIVGLLLMQMPEEEAFCVFVRLMQEYRLRELFKPSMAELGLCIYQFEYLLQEQLPELNVHFRSQSFHTSMYASSWFLTLFLTFLPLPIATRIFDIFMYEGLEIIFRVGIAILQYNQTDLIQLDMEGMSQHFQKVIPHQFDSCPDKLIFRAYQVKYNPKKMKKLEKEYTTIKNKEMEEQIEIKRLRTENRLLKQRIETLEK-------GQVTR----AQEAEENYVIKRELAVVRQQCTTASESL--------------------EKAQDTIRELQQHAYTEQFVHGLQTKLEQSRLQEAELLGALKEMQDKVLDLEKRSSS---LPDETNVAQLQEELKQVKLRELETLRCFRELQDTVTELNQRWQHHTSRGGGHWK----ESPK-KNALNELQDKL--------MSLRLREAQTQAELKEVKLKNLQLDSQNQIYSKAAGRHEQESAALQERLQNTLSHNKTLQGQLNEMKRKQAESDCKSKEEVMAVRLREADSMAAMAELRQKIAELEIQKEEGLIQGQLNHSDSRQYITELRDQIAELKNEIRQLRGQPSKFQNSGSGAYQDLCLASPASAEGDYLSSDEDLLQSPLP--ATALYAHHPS--PRLDSDGSTDSEGDE 806          
BLAST of Rab-GAP TBC domain-containing protein vs. Ensembl Cavefish
Match: evi5b (ecotropic viral integration site 5 protein homolog [Source:NCBI gene;Acc:103029208])

HSP 1 Score: 394.045 bits (1011), Expect = 5.989e-123
Identity = 255/701 (36.38%), Postives = 405/701 (57.77%), Query Frame = 1
Query:  118 LLAKLEEKNRSLQMDSKSVQSLTGLSRKNSVTSEMNVAFTLDDDKIXXXXXXXXXXXADINARHLEKWSNVINNWNQFSRKKSQVKELMKQSNGVPHHYRPLIWQLITGCNEDNVNSVQLKAIYPEYLKQQSPCEKAIRRDIARTYPQHDLFKDPNGDGQERLFNIMKAYSIHDREVGYCQGSGFIGGLLLIQMPEEDAFVVLVSLMFEHQLRNLYKPNMSELGLCMYQLDCLVEEQLPKLALHFRSHNFHATVYASGWFLTLFTLSFSIELSSRVMDLFMVEGIDIIFKISLAYLTTFQDELLKLDMESMLRFLQSIGPQQLELDPNPLFDLAVQLKLNTRKMKKAEKEYLALKMEEEENHVELRRLRTENGLLLQRIDRLEKECELLNSNYITKNMAYLQQCDEIKILRIDISEAKRKVDNLKQNLSGTEIQLQLAVGQLNGRINEENNKDIIQKRRSVDVSSDLVHQLQTQLVNIRLKEAETNASFXXXXXXXXXXXXXXXXXXXTPTEE-VAKLQEDLVAIKLREAETGLSLKDSLKRLNELNKLWMNHVDQCHQNLENVQTDSKKDRHSLYEGKDSTNKDIGILQLSRKLVEAEYASDLNAARQKIMETEARQQIYCRQVSRXXXXXXXXXXXXXXYIVIQKKLRLELKEAERRCIDLETKRKEDLMMWKIQKMEMGSIIAELKQKVARMETQREE 2217
            LLAKLEE+NR L+ DSKS++S+ G SR+NS +S ++ +    +       +                W  ++N W +  RKK + +       G+PHH+R ++WQL+  C+  N+    +K  Y E LK  SPCEK IRRDIARTYP+H+ FK+ +  GQE LFN+MKAYS+ DREVGYCQGS FI GLLL+QMPEE+AF V V LM +++LR L+KP+M+ELGLCMYQ +C+++EQLP+L +HF++ +FH ++YAS WFLT+F  SF + +++R+ D+FM EG++I+F++ LA L   Q +L++LDME ML++ Q + P QL+  P+ +  +A Q+K N +KMKK                                   LEKE       Y T     +++  EIK LR +    K+++D L++              + N R +EE                  + QL+ +LV  RLKEAE+  + +E+++K  ++E+ N  L   P E  V +LQE+L+ +KLREAE    LK+  +++  L + W  H+ +     +    DS + +++  E +D          +S +L EAE  ++L   RQ+++E E + QI+  Q+ R ++E   L+E+++      K L  EL+E +R+  ++E K KE++M  ++++ +  + +AEL+Q+++ +E Q+EE
Sbjct:   88 LLAKLEEQNRLLETDSKSLRSVNG-SRRNSGSSLVSSSSASSNLSHLEEDSWIL-------------WGRIVNEWEEV-RKKKEKQLKELVRKGIPHHFRAIVWQLL--CSAQNLP---IKDQYSELLKMTSPCEKLIRRDIARTYPEHEFFKEKDSLGQEVLFNVMKAYSLVDREVGYCQGSAFIVGLLLMQMPEEEAFCVFVKLMQDYRLRELFKPSMAELGLCMYQFECMIQEQLPELHMHFQAQSFHTSMYASSWFLTIFLTSFPLPVATRIFDIFMCEGLEIVFRVGLAILQMNQADLIQLDMEGMLQYFQKVVPHQLDSGPDKVIQVAYQVKYNAKKMKK-----------------------------------LEKE-------YTTIKTKEMEEQVEIKRLRTENRLLKQRIDTLEK--------------KGNPRYSEE-----------------FILQLERELVQARLKEAESQCALKEMQDKILDMEKRNTSL---PDENNVVRLQEELIGVKLREAEALTGLKELRQQVRNLEEHWQKHLARTAGRWK----DSPR-KNATSELQDEL--------MSVRLREAEAQAELRETRQQLLELETQNQIHSNQLRRAEQEARSLQERVQILTSQNKTLNSELQEIKRKQAEIECKNKEEVMAVRLREADNIAAMAELQQQISELEIQKEE 679          
BLAST of Rab-GAP TBC domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010479.1 (pep scaffold:Pmarinus_7.0:GL480469:1915:23479:-1 gene:ENSPMAG00000009488.1 transcript:ENSPMAT00000010479.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 351.673 bits (901), Expect = 6.617e-112
Identity = 192/433 (44.34%), Postives = 280/433 (64.67%), Query Frame = 1
Query:  487 YPEYLKQQSPCEKAIRRDIARTYPQHDLFKDPNGDGQERLFNIMKAYSIHDREVGYCQGSGFIGGLLLIQMPEEDAFVVLVSLMFEHQLRNLYKPNMSELGLCMYQLDCLVEEQLPKLALHFRSHNFHATVYASGWFLTLFTLSFSIELSSRVMDLFMVEGIDIIFKISLAYLTTFQDELLKLDMESMLRFLQSIGPQQLELDPNPLFDLAVQLKLNTRKMKKAEKEYLALKMEEEENHVELRRLRTENGLLLQRIDRLEKECELLNSNYITKNMAYLQQCDEIKILRIDISEAKRKVDNLKQNLSGTEIQLQLAVGQLNGRINEENNKDIIQKRRSVDVSSDLVHQLQTQLVNIRLKEAETNASFXXXXXXXXXXXXXXXXXXXTPTEE-VAKLQEDLVAIKLREAETGLSLKDSLKRLNELNKLWMNHVDQ 1782
            Y E LK  SP EK IRRD+ARTYP+H LF+ P+G GQE LFN+MKAYS+ DREVGYCQGS FI GLLL+QMPEE+AF V + LM +++LR L+KP+M+ELGLCMYQ++ L+++QL +L  H  +H+ H +++AS WFLT+F  +F + L++R+ D FM EG+++IF++ +A L+  QDELL  DME ML+  Q + P + +   + L   A Q+K N +++KK EKEY+ALK +E E  VE+++LRTEN LL Q+ID LEKE   L    I   +   Q+ +       D  + +R+VD+L+ + +    +L  A   L   + E+     + +      S + V  L+ +LV  RLKEAE  ++  E++EK   +E+    L   P E  VA+LQE+L+A+K+REAE   SLK   +++ +L   W  HV +
Sbjct:    3 YSELLKMASPSEKLIRRDLARTYPEHVLFRQPDGPGQEGLFNVMKAYSLVDREVGYCQGSAFIVGLLLMQMPEEEAFCVFIRLMHDYRLRELFKPSMAELGLCMYQIESLMQDQLSQLHAHLSTHSVHTSMFASPWFLTVFLTTFPLPLAARIFDWFMCEGLEVIFRVGVAILSALQDELLAQDMEGMLQLFQKVVPHRWDGCADKLIAAATQVKYNPKRLKKLEKEYMALKTKEMEEQVEIKKLRTENRLLRQKIDNLEKESAALADRLIQGQVTRAQEAE-------DNMQFRREVDSLRTHNATVADKLAQAHTTLRQLLAEK-----LWRSSGGRYSEEFVIGLERELVMARLKEAEAQSALHEMQEKVIGMEKRCSSL---PDESNVARLQEELIAVKIREAEALTSLKQLHQQVRDLEDAWQRHVSR 420          
BLAST of Rab-GAP TBC domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000235.1 (pep scaffold:Pmarinus_7.0:GL476858:30488:54209:-1 gene:ENSPMAG00000000212.1 transcript:ENSPMAT00000000235.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 240.736 bits (613), Expect = 3.292e-72
Identity = 127/293 (43.34%), Postives = 183/293 (62.46%), Query Frame = 1
Query:  100 TDEQEILLAKLEEKNRSLQMDSKSVQSLTGL--SRKNSVTSEMNVAFTLDDDKIXXXXXXXXXXXADINARHLEKWSNVINNWNQFSRKKSQ-VKELMKQSNGVPHHYRPLIWQLITGCNEDNVNSVQLKAIYPEYLKQQSPCEKAIRRDIARTYPQHDLFKDPNGDGQERLFNIMKAYSIHDREVGYCQGSGFIGGLLLIQMPEEDAFVVLVSLMFEHQLRNLYKPNMSELGLCMYQLDCLVE-EQLPKLALHFRSHNFHATVYASGWFLTLFTLSFSIELSSRVMDLFMVE 966
            + E E LL+KLEE+N+ L  D+     +  L  +  +  T     A   +++  ++                   W  +++ W +    K Q VK+L+++  G+PHH+R ++WQL+  C+  NV     K  Y E LK  SP EK IRRD+ARTYP+H LF+ P+G GQE LFN+MKAYS+ DREVGYCQGS FI GLLL+QMPEE+AF V + LM + +LR L+KP+M+ELGLCMYQ++ L++ E+ P L  H  +H+ H ++ AS WFLT+F  +F + L++R+ D FM E
Sbjct:   61 SAEDEELLSKLEEQNKVLCCDNSWCAGVGRLLQAVSSGPTGPGEAARPSEEELWAV-------------------WGGLVSEWQESRCHKDQRVKDLVRE--GIPHHFRGIVWQLL--CDAQNVAE---KDQYSELLKMASPSEKLIRRDLARTYPEHVLFRQPDGSGQEGLFNVMKAYSLVDREVGYCQGSAFIVGLLLMQMPEEEAFCVFIRLMHDSRLRELFKPSMAELGLCMYQIESLMQRERAPLLHAHLSTHSVHTSMVASPWFLTVFLTTFPLPLAARIFDWFMCE 327          
BLAST of Rab-GAP TBC domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010399.1 (pep scaffold:Pmarinus_7.0:GL482471:634455:650213:1 gene:ENSPMAG00000009412.1 transcript:ENSPMAT00000010399.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 126.716 bits (317), Expect = 1.246e-31
Identity = 72/255 (28.24%), Postives = 129/255 (50.59%), Query Frame = 1
Query:  316 KWSNVINNWNQFSRKKSQVKELMKQSNGVPHHYRPLIWQLITGCNEDNVNSVQLKAIYPEYLKQQSPCEKAIRRDIARTYPQHDLFKDPNGDGQERLFNIMKAYSIHDREVGYCQGSGFIGGLLLIQMPEEDAFVVLVSLMFE--HQLRNLYKPNMSELGLCMYQLDCLVEEQLPKLALHFRSHNFHATVYASGWFLTLFTLSFSIELSSRVMDLFMVEGIDIIFKISLAYLTTFQDELLKLDMESMLRFLQSIG 1074
            KW  ++ +W+++   +   + + K   G+P   R  IW L+   +        L     +  +  SP  + I  D+ RT+  H +F++  G  Q+ LF+++ AYS+++ EVGYCQG   I  LLL+ + EEDAF  LV L+ +  H +   + P   +L       D +++  LPK+  H  S      +Y + WF   F       L+ R+ D++M++G  ++  ++   L   +  L+K++ME ++ FLQS+ 
Sbjct:   75 KWLKMVKSWDKYKNTEKMARRVYK---GLPLQLRGEIWSLLLELSSLKEEFSGLYEQMKQRARLASPDVRQIDLDVNRTFRNHIMFRNRYGVKQQALFHVLAAYSMYNTEVGYCQGMSQIAALLLMYLNEEDAFWALVRLLSDNKHAMHGFFVPGFPKLMRFQEHHDLIMKRLLPKMKKHLDSQEIFTNLYTTKWFFQCFLDRTPFTLTLRLWDIYMLDGERLLIAMAYTTLKLHKKRLMKMEMEGLVGFLQSLA 326          
BLAST of Rab-GAP TBC domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010396.1 (pep scaffold:Pmarinus_7.0:GL482471:634449:650210:1 gene:ENSPMAG00000009412.1 transcript:ENSPMAT00000010396.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 126.716 bits (317), Expect = 1.283e-31
Identity = 72/255 (28.24%), Postives = 129/255 (50.59%), Query Frame = 1
Query:  316 KWSNVINNWNQFSRKKSQVKELMKQSNGVPHHYRPLIWQLITGCNEDNVNSVQLKAIYPEYLKQQSPCEKAIRRDIARTYPQHDLFKDPNGDGQERLFNIMKAYSIHDREVGYCQGSGFIGGLLLIQMPEEDAFVVLVSLMFE--HQLRNLYKPNMSELGLCMYQLDCLVEEQLPKLALHFRSHNFHATVYASGWFLTLFTLSFSIELSSRVMDLFMVEGIDIIFKISLAYLTTFQDELLKLDMESMLRFLQSIG 1074
            KW  ++ +W+++   +   + + K   G+P   R  IW L+   +        L     +  +  SP  + I  D+ RT+  H +F++  G  Q+ LF+++ AYS+++ EVGYCQG   I  LLL+ + EEDAF  LV L+ +  H +   + P   +L       D +++  LPK+  H  S      +Y + WF   F       L+ R+ D++M++G  ++  ++   L   +  L+K++ME ++ FLQS+ 
Sbjct:   75 KWLKMVKSWDKYKNTEKMARRVYK---GLPLQLRGEIWSLLLELSSLKEEFSGLYEQMKQRARLASPDVRQIDLDVNRTFRNHIMFRNRYGVKQQALFHVLAAYSMYNTEVGYCQGMSQIAALLLMYLNEEDAFWALVRLLSDNKHAMHGFFVPGFPKLMRFQEHHDLIMKRLLPKMKKHLDSQEIFTNLYTTKWFFQCFLDRTPFTLTLRLWDIYMLDGERLLIAMAYTTLKLHKKRLMKMEMEGLVGFLQSLA 326          
BLAST of Rab-GAP TBC domain-containing protein vs. Ensembl Sea Lamprey
Match: tbc1d2b (TBC1 domain family, member 2B [Source:ZFIN;Acc:ZDB-GENE-100922-148])

HSP 1 Score: 127.102 bits (318), Expect = 4.489e-30
Identity = 77/248 (31.05%), Postives = 126/248 (50.81%), Query Frame = 1
Query:  316 KWSNVINNWNQFSRKKSQVKELMKQSNGVPHHYRPLIWQLITGCNEDNVNSVQLKAIYPEYLK----QQSPCEKAIRRDIARTYPQHDLFKDPNGDGQERLFNIMKAYSIHDREVGYCQGSGFIGGLLLIQMPEEDAFVVLVSLMFEHQLRNLYKPNMSELGLCMYQLDC-----LVEEQLPKLALHFRSHNFHATVYASGWFLTLFTLSFSIELSSRVMDLFMVEGIDIIFKISLAYLTTFQDELLK 1032
            KW N++    + SR   ++K LM+  +GVPH  R  +W+     +   +      + Y E L+    Q +P  + +  D+ RT P +  F+  + +G  +L  ++ AY+ H+ EVGYCQG   +  + LI + EE AF  LV++     +  L  P+     L   Q+D      LV E+LP+LA HF  H    ++    WFL LF  S   ++  R+ D F+ EG  +IF+ +LA L   +++L+K
Sbjct:  631 KWENMLAASREPSRS-PELKMLMR--SGVPHELRSRVWRWAVEQHVRAIRGRHAASYYCELLERSHGQHNPAARQVELDLPRTLPNNRHFETQSSEGIVKLRRVLLAYAWHNPEVGYCQGLNRLAAIALIYLEEEQAFWCLVAI-----VECLMPPDYYSKTLLASQVDQRLFKELVTEKLPRLAAHFEQHGVDVSLITFNWFLVLFVDSVGSDMVFRIWDAFLYEGTKVIFRYALAMLKCREEQLIK 870          
BLAST of Rab-GAP TBC domain-containing protein vs. Ensembl Yeast
Match: GYP5 (GTPase-activating protein (GAP) for yeast Rab family members; involved in ER to Golgi trafficking; exhibits GAP activity toward Ypt1p that is stimulated by Gyl1p, also acts on Sec4p; interacts with Gyl1p, Rvs161p and Rvs167p; involved in recruiting Rvs167p to the bud tip during polarized growth; relocalizes from bud neck to cytoplasm upon DNA replication stress; GYP5 has a paralog, GYL1, that arose from the whole genome duplication [Source:SGD;Acc:S000006170])

HSP 1 Score: 152.525 bits (384), Expect = 3.300e-38
Identity = 87/250 (34.80%), Postives = 134/250 (53.60%), Query Frame = 1
Query:  319 WSNVINNWNQFSRKKSQVKELMKQSNGVPHHYRPLIWQLITGCNEDNVNSVQLKAIYPEYLKQQSPCEKAIRRDIARTYPQHDLFKDPNGDGQERLFNIMKAYSIHDREVGYCQGSGFIGGLLLIQMPEE-DAFVVLVSLMFEHQLRNLYKPNMSELGLCMYQLDCLVEEQLPKLALHFRSHNFHATVYASGWFLTLFTLSFSIELSSRVMDLFMVEGIDIIFKISLAYLTTFQDELLKLDMESMLRFLQ 1065
            W+ V+N++   +  + +  E    +NG+P   R +IWQL+      N  S +++ IY   L  +   E  IRRD+ RT       K    D  E L+ ++K YS++D +VGY QG GFI   LLI    E ++F +LV LM  + LR L+ P M  L L +YQ D L+EE  P L          +T+YA+ WFLT F   F +E   R+ D+  VEGI+++ K ++  +   ++ L+KL  + +L FL+
Sbjct:  426 WTQVVNDYATVASNEPENLE-AHVTNGIPPQIRGIIWQLMA-----NSKSREMEDIYETLLDTECLHEATIRRDLRRT-------KFVAEDKMESLYKVIKVYSVYDPDVGYTQGMGFIAAPLLINCENEAESFGLLVGLMKNYGLRELFLPGMPGLMLMLYQFDRLLEEHSPSLYNRLIREGISSTMYATQWFLTFFAYKFPLEFVLRIFDIVFVEGIEVLLKFAVNLMLKNEETLVKLRFDELLDFLK 662          
BLAST of Rab-GAP TBC domain-containing protein vs. Ensembl Yeast
Match: GYL1 (Putative GTPase activating protein (GAP) with a role in exocytosis; stimulates Gyp5p GAP activity on Ypt1p, colocalizes with Gyp5p at sites of polarized growth; interacts with Gyp5p, Rvs161p, and Rvs167p; involved in recruiting Rvs167p to the bud tip during polarized growth; increases in abundance and relocalizes from bud neck to cytoplasm upon DNA replication stress; GYL1 has a paralog, GYP5, that arose from the whole genome duplication [Source:SGD;Acc:S000004804])

HSP 1 Score: 119.783 bits (299), Expect = 3.556e-28
Identity = 89/320 (27.81%), Postives = 151/320 (47.19%), Query Frame = 1
Query:  391 SNGVPHHYRPLIWQLITGCNEDNVNSVQLKAIYPEYLKQQSPCEKAIRRDIARTYPQHDLFKDPNGDGQERLFNIMKAYSIHDREVGYCQGSGFIGGLLLIQMPEE-DAFVVLVSLMFEHQLRNLYKPNMSELGLCMYQLDCLVEEQLPKLALHFRSHNFHATVYASGWFLTLFTLSFSIELSSRVMDLFMVEGIDIIFKISLAYLTTFQDELLKLDMESMLRFL----------QSIGPQQLELDPNPLFDLAVQ-----LKLNTRKMKKAEKEYLALKMEEEENHVELRRLRTENGLLLQRIDRLEKECELLNSNYIT 1302
            S G+P  YR ++WQL++        S     IY  YL + +P       D+     Q  +  +   +  +R+ N++KAY + D E  +     +I  ++L    EE +AF +LV LM  + LR L+ P+ SE+ +  Y+ D LVEE  P++  H       ++++  G+F TLF      E+  R+ D+  +EGID I +I    L+  +D LLK+  + ML  L          Q+ G +   L  N   D  +Q     + +  + MKK   EY  +   + E  V+ + +  +N  L + + +LE +   LN  ++T
Sbjct:  295 SRGIPAAYRLVVWQLVSYAK-----SKSFDPIYETYLTEMAPF------DVQEFENQLKMMDEVPSEYVKRISNVLKAYLLFDPECEFSTDIAYIINMILDVCEEEANAFGLLVRLMKVYGLRLLFLPSASEIDILCYKFDRLVEEFYPEIHNHMVEKGVRSSMFLPGFFTTLFQKKLPTEIQPRIGDMVFLEGIDSIMRILATLLSNSRDHLLKMGFDDMLELLKSGLLDAYIKQNDGTRGDTLLSNECMDKLLQDSMMKVAITPKTMKKYSSEYEEIHRLDNEKEVQYKSITEKNLHLQKHVRKLENDYTSLNREHVT 603          
BLAST of Rab-GAP TBC domain-containing protein vs. Ensembl Yeast
Match: MDR1 (Cytoplasmic GTPase-activating protein; activates Ypt/Rab transport GTPases Ypt6p, Ypt31p and Sec4p; involved in recycling of internalized proteins and regulation of Golgi secretory function [Source:SGD;Acc:S000003332])

HSP 1 Score: 109.383 bits (272), Expect = 9.557e-25
Identity = 69/232 (29.74%), Postives = 117/232 (50.43%), Query Frame = 1
Query:  397 GVPHHYRPLIWQLITGC-NEDNVNSVQLKAIYPEYLKQQSPCEKAIRRDIARTYPQHDLFKDPNGDGQERLFNIMKAYSIHDREVGYCQGSGFIGGLLLIQMPEEDAFVVLVSLMFEHQLRNLYKPNMSELGLCMYQLDCLVEEQLPKLALHFRSHNFHATVYASGWFLTLFTLSFSIELSSRVMDLFMVEGIDIIFKISLAYLTTFQDELLKLDMESML-----RFLQSIG 1074
            GVP+  R  IW+L +G       NS + + I  E   + S     I +D+ R+ P++  ++    +G +RL N++ AYS  + +VGYCQ    +    LI M EE AF  L +L  +  +   Y   M    L     +  VE+++P L  +   H+   +V +  WFL+LF  S  +E + R+MD+F + G   +F+++LA L    D++L+ D + M       + Q++G
Sbjct:  244 GVPNRMRGEIWELCSGAMYMRYANSGEYERILNENAGKTSQAIDEIEKDLKRSLPEYSAYQ--TEEGIQRLRNVLTAYSWKNPDVGYCQAMNIVVAGFLIFMSEEQAFWCLCNLC-DIYVPGYYSKTMYGTLLDQRVFESFVEDRMPVLWEYILQHDIQLSVVSLPWFLSLFFTSMPLEYAVRIMDIFFMNGSITLFQVALAVLKINADDILQADDDGMFIAIIKHYFQTLG 472          
BLAST of Rab-GAP TBC domain-containing protein vs. Ensembl Yeast
Match: MSB4 (GTPase-activating protein of the Ras superfamily; acts primarily on Sec4p, localizes to the bud site and bud tip; msb3 msb4 double mutation causes defects in secretion and actin organization; similar to the TBC-domain Tre2 oncogene; MSB4 has a paralog, MSB3, that arose from the whole genome duplication; human homolog USP6NL can complement yeast msb3 msb4 double null mutant [Source:SGD;Acc:S000005472])

HSP 1 Score: 83.9593 bits (206), Expect = 3.049e-17
Identity = 65/257 (25.29%), Postives = 112/257 (43.58%), Query Frame = 1
Query:  397 GVPHHYRPLIWQLITGCNEDNVNSVQLKAIYPEYLKQQSPCEK---------AIRRDIARTYPQHDLF-KDPNGDGQ----ERLFNIMKAYSIHDREVGYCQGSGFIGGLLLIQMPEEDAFVVLVSLMFEHQLRNLYKPNMSELGLCMYQLDCLVEEQLPKLALHFRSHNFHA-----------------------TVYASGWFLTLFTLSFSIELSSRVMDLFMVEGIDIIFKISLAYLTTFQDELLKLDMESMLR 1056
            G+P  +R   W    G         QL A    Y + +S C +         AI RD+ RT+P +  F K+   +G+      L  ++ A+S++D+ +GYCQ   F+ GLLL+ M EE AF +LV +  ++ L  +Y+ ++    +    L   ++E LP++  H  S   +                        T+  + WF++ F     IE + R+ D    E    +FK++L  L   + E L+   + + R
Sbjct:  147 GIPAEWRGNAWWYFAGGQR------QLDANVGVYDRLKSDCREGAVSGKDMEAIERDLYRTFPDNIHFHKESFQNGEPAIIRSLRRVLMAFSVYDKTIGYCQSMNFLVGLLLLFMEEEKAFWMLVIITGKY-LPGVYESDLEGANVDQGVLVLCIKEYLPEIWSHIESSYMNGNGSTDQISGPASGEEYLCRLPTLTLCTASWFMSCFVGVVPIETTLRIWDCLFYEESHFLFKVALGILKLSESEFLESKSQKLFR 396          
BLAST of Rab-GAP TBC domain-containing protein vs. Ensembl Yeast
Match: MSB3 (Rab GTPase-activating protein; regulates endocytosis via inactivation of Vps21p at endosomes and vacuole fusion via inactivation of Ypt7p at vacuoles; also acts on Ypt52p and Sec4p; localizes to plasma membrane, sites of polarized growth; relocalizes from bud neck to cytoplasm upon DNA replication stress; similar to TBC-domain Tre2 oncogene; MSB3 has a paralog, MSB4, that arose from the whole genome duplication; human homolog USP6NL can complement yeast msb3 msb4 double null [Source:SGD;Acc:S000005237])

HSP 1 Score: 61.6178 bits (148), Expect = 4.510e-10
Identity = 69/279 (24.73%), Postives = 125/279 (44.80%), Query Frame = 1
Query:  343 NQFSRKKSQVKELMKQSNGVPHHYRP-LIWQLITGCNEDNVNSVQLKAIYPEYL------KQQSPCEKA------IRRDIARTYPQHDLFKDP--NGDGQ---ERLFNIMKAYSIHDREVGYCQGSGFIGGLLLIQMPEEDAFVVLVSLMFEHQLRNLYKPNMSELGLCMYQLDCLVEEQLPKLALHFRSHNFH------------------------------ATVYASGWFLTLFTLSFSIELSSRVMDLFMVEGIDIIFKISLAYLTTFQDELLKL 1035
            ++F  K  ++K  +++  G+P  +R    W    G  + N N    K +Y + L      K+Q+P EK       I RD+ RT+P +  F+    N +G    + L  ++ A+S+++ ++GYCQ   F+ GLLL+ + EE AF +LV ++    L  ++  N+  + +    L   V+E +P++  + +    H                               T+  + WF++ F     IE + R+ D    E    +FK+SLA L   + +L K+
Sbjct:  207 SRFPSKSERLKRYVRK--GIPAEWRGNAWWHFARGQEKLNKN----KGVYSQLLRKMKQIKKQNPNEKQVQDLDIIERDLNRTFPDNIHFQSSLHNKEGPPIIKSLRRVLVAFSLYNPKIGYCQSMNFLAGLLLLFLDEERAFWMLV-IITSRYLPGVHNINLEGVNIDQGVLMLCVKEYIPEVWSYIKPSIDHHQKNNKTFSPSNKKVLFNMQKNEFLYRLPPITLCTASWFMSCFVGVVPIETTLRIWDCLFYEESHFLFKVSLAVLKLSEHDLSKI 478          
BLAST of Rab-GAP TBC domain-containing protein vs. Ensembl Nematostella
Match: EDO34649 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SNS6])

HSP 1 Score: 337.035 bits (863), Expect = 3.416e-106
Identity = 179/424 (42.22%), Postives = 271/424 (63.92%), Query Frame = 1
Query:  331 INNWNQFSRKKSQ-VKELMKQSNGVPHHYRPLIWQLITGCNEDNVNSVQLKAIYPEYLKQQSPCEKAIRRDIARTYPQHDLFKDPNGDGQERLFNIMKAYSIHDREVGYCQGSGFIGGLLLIQMPEEDAFVVLVSLMFEHQLRNLYKPNMSELGLCMYQLDCLVEEQLPKLALHFRSHNFHATVYASGWFLTLFTLSFSIELSSRVMDLFMVEGIDIIFKISLAYLTTFQDELLKLDMESMLRFLQSIGPQQLELDPNPLFDLAVQLKLNTRKMKKAEKEYLALKMEEEENHVELRRLRTENGLLLQRIDRLEKECELLNSNYITKNMAYLQQCDEIKILRIDISEAKRKVDNLKQNLSGTEIQLQLAVGQLNGRINEENN------KDIIQKRRSVDVSS-DL-VHQLQTQLVNIRLKEAETN 1575
            + NW+   RKK + V++++++  G+P+  R L+WQL+ G  +     + LK  YP+ +K  S CE+ I+RDIART+P H  FKD +G GQ  LFN++KAYSI+D+EVGYCQGS FI GLLL+QMPEE+AF V V LM ++++R ++KP M+ELGLCM+QL+ L++E LP+L  HF++  FH  +YAS WFLTLF   F +  + RVMD+F+ EG D +F+I  A L+  Q+ELL+ DME ML++ Q   P   E D +P+  +A + K N++KMK+ EKEY  +K +E E++ E+RRL+TEN LL+QR+D LE+E   L    I   +   Q+ +E+  L+ +++  KR   ++             A+ + N RI E N        ++ Q+     VS+ D+ +  +Q +L   RL+E ++N
Sbjct:    1 MGNWDDAVRKKPKNVRDMVRK--GIPNALRGLVWQLLCGSRD-----MPLKDEYPKLIKANSACERMIKRDIARTFPDHSFFKDKDGIGQGTLFNVIKAYSIYDKEVGYCQGSAFIVGLLLMQMPEEEAFCVFVKLMQDYRMREIFKPTMAELGLCMFQLENLLQESLPELYAHFQAQGFHTAMYASSWFLTLFASVFPLNAAFRVMDMFISEGRDGLFRIIFAILSMGQEELLERDMEGMLKYFQKEMPDLYEKDMDPVMKIASEYKFNSKKMKRLEKEYTRVKHKEAEDNEEIRRLKTENRLLIQRVDELEQESLNLADRLIQGQVTRAQEQEELYALKRELAITKRHDKDITA-----------ALREANKRIEELNMFKNHIVSELSQREADTPVSARDMKLIAMQAELEECRLREVKSN 406          
BLAST of Rab-GAP TBC domain-containing protein vs. Ensembl Nematostella
Match: EDO34083 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SQA7])

HSP 1 Score: 241.506 bits (615), Expect = 5.739e-67
Identity = 124/330 (37.58%), Postives = 198/330 (60.00%), Query Frame = 1
Query:  319 WSNVINNWNQFSRKKSQVKELMKQSNGVPHHYRPLIWQLITGCNEDNVNSVQLKAIYPEYLKQQSPCEKAIRRDIARTYPQHDLFKDPNGDGQERLFNIMKAYSIHDREVGYCQGSGFIGGLLLIQMPEEDAFVVLVSLMFEHQLRNLYKPNMSELGLCMYQLDCLVEEQLPKLALHFRSHNFHATVYASGWFLTLFTLSFSIELSSRVMDLFMVEGIDIIFKISLAYLTTFQDELLKLDMESMLRFLQSIGPQQL--ELDPNPLFDLAVQLKLNTRKMKKAEKEYLALKMEEEENHVELRRLRTENGLLLQRIDRLEKECELLNSNYIT 1302
            WS +++ W   S +  Q+ +L+++  G+P   R  +WQ++ G +E++    +L   Y     ++SP E+ I  DI RT+P HD FKD  G+GQE L+ I KAYS++D EVGYCQG  F   +LL+ MPEE AF VLV +M  + LR +++ +   L L  YQL+ ++E+ +P L  HF+ +N  A +YAS WFLT+FT  F + +   +MDL + EG  +IF+++LA L   + +LL++D E +L+F +   P++   E     L   A+ +K+  +K++K EKEY A+K +E +    + R + EN  L++   RLE E + L    +T
Sbjct:  376 WSELLSKWKDVSTRPRQLVQLVRK--GIPEPLRGQVWQMMAGLSEND----ELVDSYKHLFTKESPTEQVIVWDIHRTFPAHDYFKDSGGEGQEALYKISKAYSVYDEEVGYCQGLSFFIAVLLLHMPEEQAFAVLVKIMSAYGLREVFRNDFQLLHLKFYQLERMIEDSMPDLFSHFQHNNVEAHMYASQWFLTMFTARFPLPMVYSIMDLILCEGTHVIFQVALALLKDARKDLLQMDFEGILKFFRVSMPKKYMEEERYKQLLGCAIGIKVTPKKLRKYEKEYEAIKEKEAQLEDPVERFKRENKRLVEANMRLELENDYLAHELVT 699          
BLAST of Rab-GAP TBC domain-containing protein vs. Ensembl Nematostella
Match: EDO40482 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S777])

HSP 1 Score: 143.665 bits (361), Expect = 2.815e-36
Identity = 94/295 (31.86%), Postives = 147/295 (49.83%), Query Frame = 1
Query:  397 GVPHHYRPLIWQLITGCNEDNVNSVQLK------AIYPEYLKQQSPCEKAIRRDIARTYPQHDLFKDPNGDGQERLFNIMKAYSIHDREVGYCQGSGFIGGLLLIQMPEEDAFVVLVSLMFEHQLRNLYKPNMSELGLCMYQLDCLVEEQLPKLALHFRSHNFHATVYASGWFLTLFTLSFSIELSSRVMDLFMVEGIDIIFKISLAYLTTFQDELLKLD-MESMLRFLQSIGPQQLELDPNPL------FDLAVQLKLNTRKMKKAEKEYLALKMEEEENHVELRRLRTENGLL 1242
            GVP   R  IW+ +    + +V S   K        Y E        + +I  D+ RT+P+H  F    G GQ  LFN++KAYS+ D +VGYCQG  F+ G+LL+ M E  AF V+  L+F   LR LYK +M+EL +  Y L  L+ +    L       +   T+YA+ WFLTLF   F +    RVMD+  ++GI + FK+ L  L+  ++ +++ D  E  + ++++  P       + L       D+  +L+    +     +E L+L   EE  H   ++L  EN +L
Sbjct:   70 GVPKDKRGEIWEFLA--KQYSVRSPASKDAFWKAGSYEEMRDGSCNHQHSIFIDLGRTFPRHPYFTSQFGPGQLSLFNLLKAYSVLDTDVGYCQGLSFVAGILLMHMEEAKAFDVMRHLLFALDLRKLYKSDMTELQIQFYVLSRLLHDYHTPLYEFLEELDITPTLYAAAWFLTLFASQFPVGFVVRVMDMIFLQGITVCFKVMLLLLSRCKEGIMECDGFECAVDYIKTHVPPYAFAHMDSLVAQVLDMDICKELESYVIEYNVLREEDLSLASVEEFEHQRAKKLEQENKVL 362          
BLAST of Rab-GAP TBC domain-containing protein vs. Ensembl Nematostella
Match: EDO39400 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SA57])

HSP 1 Score: 122.094 bits (305), Expect = 1.918e-30
Identity = 66/235 (28.09%), Postives = 124/235 (52.77%), Query Frame = 1
Query:  316 KWSNVINNWNQF-SRKKSQVKELMKQSNGVPHHYRPLIWQLITGC---NEDNVNSVQLKAIYPEYLKQQSP-CEKAIRRDIARTYPQHDLFKDPNGDGQERLFNIMKAYSIHDREVGYCQGSGFIGGLLLIQMPEEDAFVVLVSLMFEHQLRNLYKPNMSELGLCMYQLDCLVEEQLPKLALHFRSHNFHATVYASGWFLTLFTLSFSIELSSRVMDLFMVEGIDIIFKISLAYL 1005
            KW  ++NN+ ++ ++K  +++E  ++  G+P   R L W+ ++G     + N N      ++ +   + SP  E  I +D+ R +P H+ F D  G GQ+ LF ++KAYS++D   GYCQ    +  +LL+ M  E+AF  LV +  ++ L   Y P +  + L       L+ + +P ++ H + H+    +Y + W++ L   +       RV D+F  EGI ++F+ ++A +
Sbjct:   64 KWLEMLNNYEKWITKKYKKLRERCRK--GIPPAVRGLAWRHLSGSIKMEKQNPN------LFEDLASKPSPEWENTIEKDLCRVFPYHEQFTDTGGQGQKDLFRVLKAYSLYDSHTGYCQAMAPVVAVLLMHMTAEEAFWCLVMICSKY-LPGYYGPKLEAIQLDGAIFGGLLSKTVPHISKHMKQHHIDPLMYMTEWYMCLLARNLPFATVLRVWDMFFCEGIKVLFRTTIAIM 289          
BLAST of Rab-GAP TBC domain-containing protein vs. Ensembl Nematostella
Match: EDO50024 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RF34])

HSP 1 Score: 116.701 bits (291), Expect = 3.512e-28
Identity = 77/258 (29.84%), Postives = 136/258 (52.71%), Query Frame = 1
Query:  310 LEKWSNVINNWNQFSRKKSQVKELMKQSNGVPHHYRPLIWQLITGCNEDNVNSVQLKAIYPEYLKQ----QSPCEKAIRRDIARTYPQHDLFKDPNGDGQERLFNIMKAYSIHDREVGYCQGSGFIGGLLLIQMPEEDAFVVLVSLMFE--HQLRNLYKPNMSELGLCMYQLDCLVEEQLPKLALHFRSHNFHATVYASGWFLTLFTLSFSIELSSRVMDLFMVEGIDIIFKISLAYLTTFQDELLKLDMESMLRFLQ 1065
            + KW  +I NW+++ R +   K + K   G+P+  R  IW+ + G     V+ +  +    E +K+    QSP  + I  D+ RTY  H +F++  G  Q+ LF+++ AYS+++ EVGYCQG   I  LLL+ + EEDAF  L  L+ +  H +   + P   +L       D ++++ L KL  H      H ++Y   WF+  F       L+ R+ D+F++EG  ++  ++   +   +   LK+++E +++FLQ
Sbjct:   59 ISKWLKMIKNWDKYVRSEKLRKRVYK---GIPNSMRGEIWKKLLG-----VDKIPNRTTTYETMKRIARLQSPDLRQIDLDVNRTYRDHIMFRERYGIKQQALFHVLAAYSMYNVEVGYCQGMSGIAALLLMYLNEEDAFWALSVLLTDRKHGMHGFFIPGFPKLLRFQEHHDKILKKLLSKLFKHLEREGCHTSLYTLKWFMQCFLDRLPFSLTLRMYDIFLLEGDRLLTAMAYNIIKMHKKIFLKMNLEEVVQFLQ 308          
BLAST of Rab-GAP TBC domain-containing protein vs. Ensembl Medaka
Match: evi5b (ecotropic viral integration site 5 [Source:NCBI gene;Acc:101174582])

HSP 1 Score: 461.07 bits (1185), Expect = 2.052e-148
Identity = 293/775 (37.81%), Postives = 459/775 (59.23%), Query Frame = 1
Query:   91 KMATDEQEILLAKLEEKNRSLQMDSKSVQSLTGLSRKNSVTSEMNVAFTLDDDKIXXXXXXXXXXXADINARHLEKWSNVINNWNQFSRKK-SQVKELMKQSNGVPHHYRPLIWQLITGCNEDNVNSVQLKAIYPEYLKQQSPCEKAIRRDIARTYPQHDLFKDPNGDGQERLFNIMKAYSIHDREVGYCQGSGFIGGLLLIQMPEEDAFVVLVSLMFEHQLRNLYKPNMSELGLCMYQLDCLVEEQLPKLALHFRSHNFHATVYASGWFLTLFTLSFSIELSSRVMDLFMVEGIDIIFKISLAYLTTFQDELLKLDMESMLRFLQSIGPQQLELDPNPLFDLAVQLKLNTRKMKKAEKEYLALKMEEEENHVELRRLRTENGLLLQRIDRLEKECELLNSNYITKNMAYLQQCDEIKILRIDISEAKRKVDNLKQNLSGTEIQLQLAVGQLNGRINEENNKDIIQKRRSVDVSSDLVHQLQTQLVNIRLKEAETNASFXXXXXXXXXXXXXXXXXXXTPTEEVAKLQEDLVAIKLREAETGLSLKDSLKRLNELNKLWMNHVDQCHQNLENVQTDSKKDRHSLYEGKDSTNKDIGILQLSRKLVEAEYASDLNAARQKIMETEARQQIYCRQVSRXXXXXXXXXXXXXXYIVIQKKLRLELKEAERRCIDLETKRKEDLMMWKIQKMEMGSIIAELKQKVARMETQREEISTSSRMGHNKNLPPQIEMKQTSTRLEHQPLSNKW-KDLPHTIMTDSIGPLDEICFNPDDPMITS 2409
            +++ DE E LLAKLEE+NR L+ DSKS++S+ G SR+NS +S ++ +    +       +                W  ++N W +  +KK  Q+K+L+++  G+PHH+R ++WQL+  C+  N+    +K  Y + LK  SPCEK IRRDIARTYP+H+ FK+ +  GQE LFN+MKAYS+ DREVGYCQGS FI GLLL+QMPEE+AF V   LM E++LR L+KP+M+ELGLCMYQ + +++EQLP+L +HF++ +FH ++YAS WFLT+F  SF +  ++R+ D+FM EG++I+F++ LA L   Q EL++LDME ML+  Q + P Q +  P+ +   A Q+K N +KMKK EKEY  +K +E E  VE++RLRTEN LL QRID LEKE   L    I   +   Q+ +E  ++       KR+V  LKQ       QL+ A   +     +   K   Q       S + V QL+ +LV  RLK+AE+  + +E+++K  E+E+ N  L       VA+LQE+L+ +KLREAE    LK+  +++  L + W  H+ +     +    D  K R++L E +D          +S +L EAE  ++L   RQ+++E E + QI+  Q+ R ++E   L+E+++      K + ++L+E +R+  ++E K KE++M  ++++ +  + +AEL+Q ++ +E Q+EE     ++ H  +     ++K     L+H+    K  + LP     D I  ++      DD   +S
Sbjct:   34 RLSPDEME-LLAKLEEQNRLLETDSKSLRSMNG-SRRNSGSSLVSSSSASSNLSHLEEDSWIM-------------WGRIVNEWEEVRKKKEKQLKDLVRR--GIPHHFRAIVWQLL--CSAQNMP---IKDQYSDLLKMTSPCEKLIRRDIARTYPEHEFFKEKDSLGQEVLFNVMKAYSLVDREVGYCQGSAFIVGLLLMQMPEEEAFCVFFKLMQEYRLRELFKPSMAELGLCMYQFESMIQEQLPELYVHFQAQSFHTSMYASSWFLTIFLTSFPLPFATRIFDIFMCEGLEIVFRVGLAILQMNQAELIQLDMEGMLQHFQRVIPHQFDSGPDKVIQAAYQVKYNAKKMKKLEKEYTTIKTKELEEQVEIKRLRTENRLLKQRIDTLEKESASLADRLIQGQVTRAQEAEENYLV-------KREVATLKQQCEEASAQLEQAKKTIRQLQQQSQAKGPSQ------FSEESVLQLERELVQARLKDAESQCALKEMQDKILEMEKRNSSLPDDTN--VARLQEELIGVKLREAEAVTGLKELKQQVRNLEEHWQRHLARTAGRWK----DGPK-RNTLSELQDEL--------MSVRLREAEAQAELRETRQRMLELETQNQIHSNQLRRAEQESRCLQERVQALTSQNKDMHVQLQEIKRKQAEIECKSKEEVMAVRLREADNIAAMAELQQHISELEIQKEEGKVQGQLNHTDSSQYIRDLKDQIEELKHEICCLKGQRGLPGQPTFDGIHIVNHYTGGVDDAYRSS 758          
BLAST of Rab-GAP TBC domain-containing protein vs. Ensembl Medaka
Match: evi5b (ecotropic viral integration site 5 [Source:NCBI gene;Acc:101174582])

HSP 1 Score: 461.07 bits (1185), Expect = 2.052e-148
Identity = 293/775 (37.81%), Postives = 459/775 (59.23%), Query Frame = 1
Query:   91 KMATDEQEILLAKLEEKNRSLQMDSKSVQSLTGLSRKNSVTSEMNVAFTLDDDKIXXXXXXXXXXXADINARHLEKWSNVINNWNQFSRKK-SQVKELMKQSNGVPHHYRPLIWQLITGCNEDNVNSVQLKAIYPEYLKQQSPCEKAIRRDIARTYPQHDLFKDPNGDGQERLFNIMKAYSIHDREVGYCQGSGFIGGLLLIQMPEEDAFVVLVSLMFEHQLRNLYKPNMSELGLCMYQLDCLVEEQLPKLALHFRSHNFHATVYASGWFLTLFTLSFSIELSSRVMDLFMVEGIDIIFKISLAYLTTFQDELLKLDMESMLRFLQSIGPQQLELDPNPLFDLAVQLKLNTRKMKKAEKEYLALKMEEEENHVELRRLRTENGLLLQRIDRLEKECELLNSNYITKNMAYLQQCDEIKILRIDISEAKRKVDNLKQNLSGTEIQLQLAVGQLNGRINEENNKDIIQKRRSVDVSSDLVHQLQTQLVNIRLKEAETNASFXXXXXXXXXXXXXXXXXXXTPTEEVAKLQEDLVAIKLREAETGLSLKDSLKRLNELNKLWMNHVDQCHQNLENVQTDSKKDRHSLYEGKDSTNKDIGILQLSRKLVEAEYASDLNAARQKIMETEARQQIYCRQVSRXXXXXXXXXXXXXXYIVIQKKLRLELKEAERRCIDLETKRKEDLMMWKIQKMEMGSIIAELKQKVARMETQREEISTSSRMGHNKNLPPQIEMKQTSTRLEHQPLSNKW-KDLPHTIMTDSIGPLDEICFNPDDPMITS 2409
            +++ DE E LLAKLEE+NR L+ DSKS++S+ G SR+NS +S ++ +    +       +                W  ++N W +  +KK  Q+K+L+++  G+PHH+R ++WQL+  C+  N+    +K  Y + LK  SPCEK IRRDIARTYP+H+ FK+ +  GQE LFN+MKAYS+ DREVGYCQGS FI GLLL+QMPEE+AF V   LM E++LR L+KP+M+ELGLCMYQ + +++EQLP+L +HF++ +FH ++YAS WFLT+F  SF +  ++R+ D+FM EG++I+F++ LA L   Q EL++LDME ML+  Q + P Q +  P+ +   A Q+K N +KMKK EKEY  +K +E E  VE++RLRTEN LL QRID LEKE   L    I   +   Q+ +E  ++       KR+V  LKQ       QL+ A   +     +   K   Q       S + V QL+ +LV  RLK+AE+  + +E+++K  E+E+ N  L       VA+LQE+L+ +KLREAE    LK+  +++  L + W  H+ +     +    D  K R++L E +D          +S +L EAE  ++L   RQ+++E E + QI+  Q+ R ++E   L+E+++      K + ++L+E +R+  ++E K KE++M  ++++ +  + +AEL+Q ++ +E Q+EE     ++ H  +     ++K     L+H+    K  + LP     D I  ++      DD   +S
Sbjct:   34 RLSPDEME-LLAKLEEQNRLLETDSKSLRSMNG-SRRNSGSSLVSSSSASSNLSHLEEDSWIM-------------WGRIVNEWEEVRKKKEKQLKDLVRR--GIPHHFRAIVWQLL--CSAQNMP---IKDQYSDLLKMTSPCEKLIRRDIARTYPEHEFFKEKDSLGQEVLFNVMKAYSLVDREVGYCQGSAFIVGLLLMQMPEEEAFCVFFKLMQEYRLRELFKPSMAELGLCMYQFESMIQEQLPELYVHFQAQSFHTSMYASSWFLTIFLTSFPLPFATRIFDIFMCEGLEIVFRVGLAILQMNQAELIQLDMEGMLQHFQRVIPHQFDSGPDKVIQAAYQVKYNAKKMKKLEKEYTTIKTKELEEQVEIKRLRTENRLLKQRIDTLEKESASLADRLIQGQVTRAQEAEENYLV-------KREVATLKQQCEEASAQLEQAKKTIRQLQQQSQAKGPSQ------FSEESVLQLERELVQARLKDAESQCALKEMQDKILEMEKRNSSLPDDTN--VARLQEELIGVKLREAEAVTGLKELKQQVRNLEEHWQRHLARTAGRWK----DGPK-RNTLSELQDEL--------MSVRLREAEAQAELRETRQRMLELETQNQIHSNQLRRAEQESRCLQERVQALTSQNKDMHVQLQEIKRKQAEIECKSKEEVMAVRLREADNIAAMAELQQHISELEIQKEEGKVQGQLNHTDSSQYIRDLKDQIEELKHEICCLKGQRGLPGQPTFDGIHIVNHYTGGVDDAYRSS 758          
BLAST of Rab-GAP TBC domain-containing protein vs. Ensembl Medaka
Match: evi5b (ecotropic viral integration site 5 [Source:NCBI gene;Acc:101174582])

HSP 1 Score: 445.277 bits (1144), Expect = 5.567e-143
Identity = 269/699 (38.48%), Postives = 420/699 (60.09%), Query Frame = 1
Query:  319 WSNVINNWNQFSRKK-SQVKELMKQSNGVPHHYRPLIWQLITGCNEDNVNSVQLKAIYPEYLKQQSPCEKAIRRDIARTYPQHDLFKDPNGDGQERLFNIMKAYSIHDREVGYCQGSGFIGGLLLIQMPEEDAFVVLVSLMFEHQLRNLYKPNMSELGLCMYQLDCLVEEQLPKLALHFRSHNFHATVYASGWFLTLFTLSFSIELSSRVMDLFMVEGIDIIFKISLAYLTTFQDELLKLDMESMLRFLQSIGPQQLELDPNPLFDLAVQLKLNTRKMKKAEKEYLALKMEEEENHVELRRLRTENGLLLQRIDRLEKECELLNSNYITKNMAYLQQCDEIKILRIDISEAKRKVDNLKQNLSGTEIQLQLAVGQLNGRINEENNKDIIQKRRSVDVSSDLVHQLQTQLVNIRLKEAETNASFXXXXXXXXXXXXXXXXXXXTPTEEVAKLQEDLVAIKLREAETGLSLKDSLKRLNELNKLWMNHVDQCHQNLENVQTDSKKDRHSLYEGKDSTNKDIGILQLSRKLVEAEYASDLNAARQKIMETEARQQIYCRQVSRXXXXXXXXXXXXXXYIVIQKKLRLELKEAERRCIDLETKRKEDLMMWKIQKMEMGSIIAELKQKVARMETQREEISTSSRMGHNKNLPPQIEMKQTSTRLEHQPLSNKW-KDLPHTIMTDSIGPLDEICFNPDDPMITS 2409
            W  ++N W +  +KK  Q+K+L+++  G+PHH+R ++WQL+  C+  N+    +K  Y + LK  SPCEK IRRDIARTYP+H+ FK+ +  GQE LFN+MKAYS+ DREVGYCQGS FI GLLL+QMPEE+AF V   LM E++LR L+KP+M+ELGLCMYQ + +++EQLP+L +HF++ +FH ++YAS WFLT+F  SF +  ++R+ D+FM EG++I+F++ LA L   Q EL++LDME ML+  Q + P Q +  P+ +   A Q+K N +KMKK EKEY  +K +E E  VE++RLRTEN LL QRID LEKE   L    I   +   Q+ +E  ++       KR+V  LKQ       QL+ A   +     +   K   Q       S + V QL+ +LV  RLK+AE+  + +E+++K  E+E+ N  L       VA+LQE+L+ +KLREAE    LK+  +++  L + W  H+ +     +    D  K R++L E +D          +S +L EAE  ++L   RQ+++E E + QI+  Q+ R ++E   L+E+++      K + ++L+E +R+  ++E K KE++M  ++++ +  + +AEL+Q ++ +E Q+EE     ++ H  +     ++K     L+H+    K  + LP     D I  ++      DD   +S
Sbjct:   49 WGRIVNEWEEVRKKKEKQLKDLVRR--GIPHHFRAIVWQLL--CSAQNMP---IKDQYSDLLKMTSPCEKLIRRDIARTYPEHEFFKEKDSLGQEVLFNVMKAYSLVDREVGYCQGSAFIVGLLLMQMPEEEAFCVFFKLMQEYRLRELFKPSMAELGLCMYQFESMIQEQLPELYVHFQAQSFHTSMYASSWFLTIFLTSFPLPFATRIFDIFMCEGLEIVFRVGLAILQMNQAELIQLDMEGMLQHFQRVIPHQFDSGPDKVIQAAYQVKYNAKKMKKLEKEYTTIKTKELEEQVEIKRLRTENRLLKQRIDTLEKESASLADRLIQGQVTRAQEAEENYLV-------KREVATLKQQCEEASAQLEQAKKTIRQLQQQSQAKGPSQ------FSEESVLQLERELVQARLKDAESQCALKEMQDKILEMEKRNSSLPDDTN--VARLQEELIGVKLREAEAVTGLKELKQQVRNLEEHWQRHLARTAGRWK----DGPK-RNTLSELQDEL--------MSVRLREAEAQAELRETRQRMLELETQNQIHSNQLRRAEQESRCLQERVQALTSQNKDMHVQLQEIKRKQAEIECKSKEEVMAVRLREADNIAAMAELQQHISELEIQKEEGKVQGQLNHTDSSQYIRDLKDQIEELKHEICCLKGQRGLPGQPTFDGIHIVNHYTGGVDDAYRSS 712          
BLAST of Rab-GAP TBC domain-containing protein vs. Ensembl Medaka
Match: evi5b (ecotropic viral integration site 5 [Source:NCBI gene;Acc:101174582])

HSP 1 Score: 399.438 bits (1025), Expect = 1.090e-125
Identity = 269/775 (34.71%), Postives = 430/775 (55.48%), Query Frame = 1
Query:   91 KMATDEQEILLAKLEEKNRSLQMDSKSVQSLTGLSRKNSVTSEMNVAFTLDDDKIXXXXXXXXXXXADINARHLEKWSNVINNWNQFSRKK-SQVKELMKQSNGVPHHYRPLIWQLITGCNEDNVNSVQLKAIYPEYLKQQSPCEKAIRRDIARTYPQHDLFKDPNGDGQERLFNIMKAYSIHDREVGYCQGSGFIGGLLLIQMPEEDAFVVLVSLMFEHQLRNLYKPNMSELGLCMYQLDCLVEEQLPKLALHFRSHNFHATVYASGWFLTLFTLSFSIELSSRVMDLFMVEGIDIIFKISLAYLTTFQDELLKLDMESMLRFLQSIGPQQLELDPNPLFDLAVQLKLNTRKMKKAEKEYLALKMEEEENHVELRRLRTENGLLLQRIDRLEKECELLNSNYITKNMAYLQQCDEIKILRIDISEAKRKVDNLKQNLSGTEIQLQLAVGQLNGRINEENNKDIIQKRRSVDVSSDLVHQLQTQLVNIRLKEAETNASFXXXXXXXXXXXXXXXXXXXTPTEEVAKLQEDLVAIKLREAETGLSLKDSLKRLNELNKLWMNHVDQCHQNLENVQTDSKKDRHSLYEGKDSTNKDIGILQLSRKLVEAEYASDLNAARQKIMETEARQQIYCRQVSRXXXXXXXXXXXXXXYIVIQKKLRLELKEAERRCIDLETKRKEDLMMWKIQKMEMGSIIAELKQKVARMETQREEISTSSRMGHNKNLPPQIEMKQTSTRLEHQPLSNKW-KDLPHTIMTDSIGPLDEICFNPDDPMITS 2409
            +++ DE E LLAKLEE+NR L+ DSKS++S+ G SR+NS +S ++ +    +       +                W  ++N W +  +KK  Q+K+L+++  G+PHH+R ++WQL+  C+  N+    +K  Y + LK  SPCEK IRRDIARTYP+H+ FK+ +  GQE LFN+MKAYS+ DREVGYCQGS FI GLLL+QMPEE+AF V   LM E++LR L+KP+M+ELGLCMYQ + +++EQLP+L +HF++ +FH ++YAS WFLT+F  SF +  ++R+ D+FM EG++I+F++ LA L   Q EL++LDME ML+  Q + P Q +  P+ +   A Q+K N +KMKK                                   LEKE       Y T     L++  EIK LR +    K+++D L                               +K+     S + V QL+ +LV  RLK+AE+  + +E+++K  E+E+ N  L       VA+LQE+L+ +KLREAE    LK+  +++  L + W  H+ +     +    D  K R++L E +D          +S +L EAE  ++L   RQ+++E E + QI+  Q+ R ++E   L+E+++      K + ++L+E +R+  ++E K KE++M  ++++ +  + +AEL+Q ++ +E Q+EE     ++ H  +     ++K     L+H+    K  + LP     D I  ++      DD   +S
Sbjct:   34 RLSPDEME-LLAKLEEQNRLLETDSKSLRSMNG-SRRNSGSSLVSSSSASSNLSHLEEDSWIM-------------WGRIVNEWEEVRKKKEKQLKDLVRR--GIPHHFRAIVWQLL--CSAQNMP---IKDQYSDLLKMTSPCEKLIRRDIARTYPEHEFFKEKDSLGQEVLFNVMKAYSLVDREVGYCQGSAFIVGLLLMQMPEEEAFCVFFKLMQEYRLRELFKPSMAELGLCMYQFESMIQEQLPELYVHFQAQSFHTSMYASSWFLTIFLTSFPLPFATRIFDIFMCEGLEIVFRVGLAILQMNQAELIQLDMEGMLQHFQRVIPHQFDSGPDKVIQAAYQVKYNAKKMKK-----------------------------------LEKE-------YTTIKTKELEEQVEIKRLRTENRLLKQRIDTL-------------------------------EKKGPSQFSEESVLQLERELVQARLKDAESQCALKEMQDKILEMEKRNSSLPDDTN--VARLQEELIGVKLREAEAVTGLKELKQQVRNLEEHWQRHLARTAGRWK----DGPK-RNTLSELQDEL--------MSVRLREAEAQAELRETRQRMLELETQNQIHSNQLRRAEQESRCLQERVQALTSQNKDMHVQLQEIKRKQAEIECKSKEEVMAVRLREADNIAAMAELQQHISELEIQKEEGKVQGQLNHTDSSQYIRDLKDQIEELKHEICCLKGQRGLPGQPTFDGIHIVNHYTGGVDDAYRSS 698          
BLAST of Rab-GAP TBC domain-containing protein vs. Ensembl Medaka
Match: si:ch211-239f4.1 (ecotropic viral integration site 5 like [Source:NCBI gene;Acc:101166849])

HSP 1 Score: 401.749 bits (1031), Expect = 1.719e-125
Identity = 244/647 (37.71%), Postives = 393/647 (60.74%), Query Frame = 1
Query:  319 WSNVINNWNQFSRKKSQV-KELMKQSNGVPHHYRPLIWQLITGCNEDNVNSVQLKAIYPEYLKQQSPCEKAIRRDIARTYPQHDLFKDPNGDGQERLFNIMKAYSIHDREVGYCQGSGFIGGLLLIQMPEEDAFVVLVSLMFEHQLRNLYKPNMSELGLCMYQLDCLVEEQLPKLALHFRSHNFHATVYASGWFLTLFTLSFSIELSSRVMDLFMVEGIDIIFKISLAYLTTFQDELLKLDMESMLRFLQSIGPQQLELDPNPLFDLAVQLKLNTRKMKKAEKEYLALKMEEEENHVELRRLRTENGLLLQRIDRLEKECELLNSNYITKNMAYLQQCDEIKILRIDISEAKRKVDNLKQNLSGTEIQLQLAVGQLNGRINEENNKDIIQKRRSVDVSSDLVHQLQTQLVNIRLKEAETNASFXXXXXXXXXXXXXXXXXXXTPTEE-VAKLQEDLVAIKLREAETGLSLKDSLKRLNELNKLWMNHVDQCHQNLENVQT--DSKKDRHSLYEGKDSTNKDIGILQLSRKLVEAEYASDLNAARQKIMETEARQQIYCRQVSRXXXXXXXXXXXXXXYIVIQKKLRLELKEAERRCIDLETKRKEDLMMWKIQKMEMGSIIAELKQKVARMETQREEISTSSRMGHN 2247
            W  ++N W ++ RKK ++ KEL+++  G+PHH+R ++WQL+      N   + +K  Y E LK  SPCEK IRRDIARTYP+H+ FK  +  GQE LFN+MKAYS+ DREVGYCQGS FI GLLL+QMPEE+AF V V LM E++LR L+KP+M+ELGLC+YQ + +++EQLP+L +HFRS +FH ++YAS WFLTLF     + +++R+ D+FM EG++IIF++ LA L   Q +L++LDME M +  Q + P Q +  P+ L   A Q+K N ++MKK EKEY  +K +E E  +E++RLRTEN LL QRI+ LEKE   L    I   +   Q+ +E  +++ +++  +++     +NL                    E  +D I++ +    + + V  LQTQL   RL EAE   +    KE   ++ +  +R S  P E  +A LQE++  +KL+E E   S ++    + +LN+ W +H+ +            +S K ++++ E +D          ++ +L EA+  ++L   + K ++ E++ QI+ + + R D+E   L+++L+      K L+ +L E +R+  +L+ K KE++M  ++++ +  +++AEL+Q+VA +E Q+EE     ++ H+
Sbjct:  123 WGRIVNEWEEWRRKKDKLLKELIRK--GIPHHFRAIVWQLLG-----NATDMPVKNQYSELLKMSSPCEKLIRRDIARTYPEHEFFKGQDSLGQEVLFNVMKAYSLVDREVGYCQGSAFIVGLLLMQMPEEEAFCVFVRLMQEYRLRELFKPSMAELGLCIYQFEYMLQEQLPELNVHFRSQSFHTSMYASSWFLTLFLTFLPLPVATRIFDIFMYEGLEIIFRVGLAILQYNQTDLIQLDMEGMSQHFQKVIPHQFDSCPDKLILRAYQVKYNPKRMKKLEKEYTTIKNKEMEEQIEIKRLRTENRLLKQRIETLEKESAALADRLIQGQVTRAQEAEENYVIKRELAVVRQQCSAASENL--------------------EKAQDTIRELQQQQYTEEFVSNLQTQLEQSRLHEAELLGAL---KEMQDKVLDLEKRSSCLPDESNMAALQEEVKQMKLKELEMLRSFREMQDSVTDLNQRWQHHMSRSSSTGGGGGPWKESPK-KNAMNELQDKL--------MTIRLREAQAQAELREVKLKALQLESQNQIHSKLIGRNDQERSALQDRLQMMANQNKALQTQLSEMKRKQAELDCKSKEEVMAVRLREADSMTVMAELRQRVAELEIQKEEGRIKGQLNHS 730          
BLAST of Rab-GAP TBC domain-containing protein vs. Planmine SMEST
Match: SMESG000003946.1 (SMESG000003946.1)

HSP 1 Score: 1609.35 bits (4166), Expect = 0.000e+0
Identity = 834/836 (99.76%), Postives = 834/836 (99.76%), Query Frame = 1
Query:   94 MATDEQEILLAKLEEKNRSLQMDSKSVQSLTGLSRKNSVTSEMNVAFTLDDDKIXXXXXXXXXXXADINARHLEKWSNVINNWNQFSRKKSQVKELMKQSNGVPHHYRPLIWQLITGCNEDNVNSVQLKAIYPEYLKQQSPCEKAIRRDIARTYPQHDLFKDPNGDGQERLFNIMKAYSIHDREVGYCQGSGFIGGLLLIQMPEEDAFVVLVSLMFEHQLRNLYKPNMSELGLCMYQLDCLVEEQLPKLALHFRSHNFHATVYASGWFLTLFTLSFSIELSSRVMDLFMVEGIDIIFKISLAYLTTFQDELLKLDMESMLRFLQSIGPQQLELDPNPLFDLAVQLKLNTRKMKKAEKEYLALKMEEEENHVELRRLRTENGLLLQRIDRLEKECELLNSNYITKNMAYLQQCDEIKILRIDISEAKRKVDNLKQNLSGTEIQLQLAVGQLNGRINEENNKDIIQKRRSVDVSSDLVHQLQTQLVNIRLKEAETNASFXXXXXXXXXXXXXXXXXXXTPTEEVAKLQEDLVAIKLREAETGLSLKDSLKRLNELNKLWMNHVDQCHQNLENVQTDSKKDRHSLYEGKDSTNKDIGILQLSRKLVEAEYASDLNAARQKIMETEARQQIYCRQVSRXXXXXXXXXXXXXXYIVIQKKLRLELKEAERRCIDLETKRKEDLMMWKIQKMEMGSIIAELKQKVARMETQREEISTSSRMGHNKNLPPQIEMKQTSTRLEHQPLSNKWKDLPHTIMTDSIGPLDEICFNPDDPMITSIYIHPSSSQPKLQCSDITRVNAEENYRRSIELEHSSASSNGYSVDRSVLTNRDSQDDSDIDAMS 2601
            MATDEQEILLAKLEEKNRSLQMDSKSVQSLTGLSRKNSVTSEMNVAFTLDDDKISLNSNNFSNSLADINARHLEKWSNVINNWNQFSRKKSQVKELMKQSNGVPHHYRPLIWQLITGCNEDNVNSVQLKAIYPEYLKQQSPCEKAIRRDIARTYPQHDLFKDPNGDGQERLFNIMKAYSIHDREVGYCQGSGFIGGLLLIQMPEEDAFVVLVSLMFEHQLRNLYKPNMSELGLCMYQLDCLVEEQLPKLALHFRSHNFHATVYASGWFLTLFTLSFSIELSSRVMDLFMVEGIDIIFKISLAYLTTFQDELLKLDMESMLRFLQSIGPQQLELDPNPLFDLAVQLKLNTRKMKKAEKEYLALKMEEEENHVELRRLRTENGLLLQRIDRLEKECELLNSNYITKNMAYLQQCDEIKILRIDISEAKRKVDNLKQNLSGTEIQLQLAVGQLNGRINEENNKDIIQKRRSVDVSSDLVHQLQTQLVNIRLKEAETNASFRELKEKYRELEEENRRLSKTPTEEVAKLQEDLVAIKLREAETGLSLKDSLKRLNELNKLWMNHVDQCHQNLENVQTDS KDRHSLYEGKDSTNKDIGILQLSRKLVEAEYASDLNAARQKIMETEARQQIYCRQVSRLDEEIIILKEKLEDYIVIQKKLRLELKEAERRCIDLETKRKEDLMMWKIQKMEMGSIIAELKQKVARMETQREEISTSSRMGHNKNLPPQIEMKQT TRLEHQPLSNKWKDLPHTIMTDSIGPLDEICFNPDDPMITSIYIHPSSSQPKLQCSDITRVNAEENYRRSIELEHSSASSNGYSVDRSVLTNRDSQDDSDIDAMS
Sbjct:    1 MATDEQEILLAKLEEKNRSLQMDSKSVQSLTGLSRKNSVTSEMNVAFTLDDDKISLNSNNFSNSLADINARHLEKWSNVINNWNQFSRKKSQVKELMKQSNGVPHHYRPLIWQLITGCNEDNVNSVQLKAIYPEYLKQQSPCEKAIRRDIARTYPQHDLFKDPNGDGQERLFNIMKAYSIHDREVGYCQGSGFIGGLLLIQMPEEDAFVVLVSLMFEHQLRNLYKPNMSELGLCMYQLDCLVEEQLPKLALHFRSHNFHATVYASGWFLTLFTLSFSIELSSRVMDLFMVEGIDIIFKISLAYLTTFQDELLKLDMESMLRFLQSIGPQQLELDPNPLFDLAVQLKLNTRKMKKAEKEYLALKMEEEENHVELRRLRTENGLLLQRIDRLEKECELLNSNYITKNMAYLQQCDEIKILRIDISEAKRKVDNLKQNLSGTEIQLQLAVGQLNGRINEENNKDIIQKRRSVDVSSDLVHQLQTQLVNIRLKEAETNASFRELKEKYRELEEENRRLSKTPTEEVAKLQEDLVAIKLREAETGLSLKDSLKRLNELNKLWMNHVDQCHQNLENVQTDS-KDRHSLYEGKDSTNKDIGILQLSRKLVEAEYASDLNAARQKIMETEARQQIYCRQVSRLDEEIIILKEKLEDYIVIQKKLRLELKEAERRCIDLETKRKEDLMMWKIQKMEMGSIIAELKQKVARMETQREEISTSSRMGHNKNLPPQIEMKQTLTRLEHQPLSNKWKDLPHTIMTDSIGPLDEICFNPDDPMITSIYIHPSSSQPKLQCSDITRVNAEENYRRSIELEHSSASSNGYSVDRSVLTNRDSQDDSDIDAMS 835          
BLAST of Rab-GAP TBC domain-containing protein vs. Planmine SMEST
Match: SMESG000061861.1 (SMESG000061861.1)

HSP 1 Score: 207.608 bits (527), Expect = 1.110e-55
Identity = 115/355 (32.39%), Postives = 204/355 (57.46%), Query Frame = 1
Query:  310 LEKWSNVINNW-NQFSRKKSQVKELMKQSNGVPHHYRPLIWQLI-TGCNEDNVNSVQLKAIYPEYLKQQSPCEKAIRRDIARTYPQHDLFKDPNGDGQERLFNIMKAYSIHDREVGYCQGSGFIGGLLLIQMPEEDAFVVLVSLMFEHQLRNLYKPNMSELGLCMYQLDCLVEEQLPKLALHFRSHNFHATVYASGWFLTLFTLSFSIELSSRVMDLFMVEGIDIIFKISLAYLTTFQDELLKLDMESMLRFLQSIGPQQLE-LDP-NPLFDLAVQLKLNTRKMKKAEKEYLALKMEEEENHVELRRLRTENGLLLQRIDRLEKECELLNSNYITKNMAYLQQCDEIKILRIDIS 1362
            + +W  ++  W N  + +   + EL+K   G+P   R  +WQL+ +  N++    +QL+ +Y   + +++  +  I+RD+ RT+  H LF   +G GQ+ LF++ KAY+ +D E+GYCQGS F+   L++ MPEE AF +LV++M ++Q+R+++K N   L +C+YQLD L+ E+L  L  HF      + +YA+ WF+TLFT+ F +     ++DLF+ EGI +IFK++LA L   + ELL +D E  L + +   P+    +D    L + A  +K++  K+ + EKE+  ++    E    +  L  E     +  +RL++E + L    ++  +A  +  D+++   ID+S
Sbjct:  447 ISRWGILLIEWQNDITSRPKGLYELVKH--GIPEALRGEVWQLMGSSLNKE----LQLQDVYRILITKETKYDAVIKRDMPRTFTAHPLFLQKDGHGQQALFHVCKAYASYDEEIGYCQGSAFLAAALILHMPEEQAFSLLVAIMNKYQIRDVFKNNFEGLHICLYQLDHLMAEKLTDLHQHFTELQLESHMYANQWFMTLFTMKFHLYAVYHILDLFLYEGITVIFKVALALLKLSRKELLTMDFEGALNYFRITLPKLYRNVDTCKELVNSAQNIKISNSKLSRLEKEWRKIQAVRAETEDPVDILNKELKKTKEEYNRLDQENDALAKELVSSKIALQRNIDKLERNNIDVS 795          
BLAST of Rab-GAP TBC domain-containing protein vs. Planmine SMEST
Match: SMESG000061861.1 (SMESG000061861.1)

HSP 1 Score: 208.379 bits (529), Expect = 3.180e-55
Identity = 124/363 (34.16%), Postives = 207/363 (57.02%), Query Frame = 1
Query:  310 LEKWSNVINNW-NQFSRKKSQVKELMKQSNGVPHHYRPLIWQLI-TGCNEDNVNSVQLKAIYPEYLKQQSPCEKAIRRDIARTYPQHDLFKDPNGDGQERLFNIMKAYSIHDREVGYCQGSGFIGGLLLIQMPEEDAFVVLVSLMFEHQLRNLYKPNMSELGLCMYQLDCLVEEQLPKLALHFRSHNFHATVYASGWFLTLFTLSFSIELSSRVMDLFMVEGIDIIFKISLAYLTTFQDELLKLDMESMLRFLQSIGPQQLE-LDP-NPLFDLAVQLKLNTRKMKKAEKEYL---ALKMEEEE-----------NHVELRRLRTENGLL----------LQR-IDRLEKECELLNSN-YITKN 1308
            + +W  ++  W N  + +   + EL+K  +G+P   R  +WQL+ +  N++    +QL+ +Y   + +++  +  I+RD+ RT+  H LF   +G GQ+ LF++ KAY+ +D E+GYCQGS F+   L++ MPEE AF +LV++M ++Q+R+++K N   L +C+YQLD L+ E+L  L  HF      + +YA+ WF+TLFT+ F +     ++DLF+ EGI +IFK++LA L   + ELL +D E  L + +   P+    +D    L + A  +K++  K+ + EKE+    A++ E E+              E  RL  EN  L          LQR ID+LE+  E+L+   ++TKN
Sbjct:  447 ISRWGILLIEWQNDITSRPKGLYELVK--HGIPEALRGEVWQLMGSSLNKE----LQLQDVYRILITKETKYDAVIKRDMPRTFTAHPLFLQKDGHGQQALFHVCKAYASYDEEIGYCQGSAFLAAALILHMPEEQAFSLLVAIMNKYQIRDVFKNNFEGLHICLYQLDHLMAEKLTDLHQHFTELQLESHMYANQWFMTLFTMKFHLYAVYHILDLFLYEGITVIFKVALALLKLSRKELLTMDFEGALNYFRITLPKLYRNVDTCKELVNSAQNIKISNSKLSRLEKEWRKIQAVRAETEDPVDILNKELKKTKEEYNRLDQENDALAKELVSSKIALQRNIDKLEETVEVLSKELFVTKN 803          
BLAST of Rab-GAP TBC domain-containing protein vs. Planmine SMEST
Match: SMESG000005104.1 (SMESG000005104.1)

HSP 1 Score: 139.813 bits (351), Expect = 5.754e-36
Identity = 94/300 (31.33%), Postives = 143/300 (47.67%), Query Frame = 1
Query:  316 KWSNVINNWNQFSRKKSQVKELMKQSNGVPHHYRPLIWQLITGCNEDNVNSVQLKAIYPEYLKQQSPCE--KAIRRDIARTYPQHDLFKDPNGDGQERLFNIMKAYSIHDREVGYCQGSGFIGGLLLIQMPEEDAFVVLVSLMFEHQLRNLYKPNMSELGLCMYQLDC-----LVEEQLPKLALHFRSHNFHATVYASGWFLTLFTLSFSIELSSRVMDLFMVEGIDIIFKISLAYLTTF----QDELLKLDMESMLRFLQSIGPQQLELDPNPLFDLAVQLKLNTRKMKKAEKEYLALK 1182
            KW  V++NW     K+   K   +   G+P   RP  WQ + G  +D     + K  Y   ++Q         I +D+ R YPQH++F    G GQ+ LFN++KAYSI     GYCQ    I   LLI MPEE+AF    ++  +H     Y P   + GL   QLD      L++  +P+   H   H      +   WF+ +FT +F      RV+D+F  EGI ++F+I+LA + T     + +      ES++ FL+++ P+       P F ++  LK  +  +  AE  Y  LK
Sbjct:   41 KWLEVLSNWELHMNKRFD-KVRTRCRKGIPEGIRPRAWQYLCGSRQD---IFRFKGRYNTLIQQDGDMAVIDQIGKDVGRQYPQHEIFGSQQGFGQQSLFNVLKAYSILHPVTGYCQAQAPIAAALLIHMPEEEAFWTFCAIC-QH-----YLPGYFDSGLERVQLDAKILYGLLKRHVPQAHKHLVLHEVEPVYFMIDWFMCIFTRNFPWATVVRVLDMFFCEGIKVVFRIALALIKTVAGSEEAKRAHNSTESIVAFLRNLPPEVT----TPDFIVSESLKFAS--IPAAEFVYEHLK 324          
BLAST of Rab-GAP TBC domain-containing protein vs. Planmine SMEST
Match: SMESG000071846.1 (SMESG000071846.1)

HSP 1 Score: 100.908 bits (250), Expect = 8.962e-23
Identity = 51/187 (27.27%), Postives = 96/187 (51.34%), Query Frame = 1
Query:  526 AIRRDIARTYPQHDLFKDPNGDGQERLFNIMKAYSIHDREVGYCQGSGFIGGLLLIQMPEEDAFVVLVSLMFEHQLRNLYKPNMSELGLCMYQLDCLVEEQLPKLALHFRSHNFHATVYASGWFLTLFTLSFSIELSSRVMDLFMVEGIDIIFKISLAYLTTFQDELLKLDMESMLRFLQSIGPQQL 1086
             I+ D++RT+P  +LF++  G   + L+ ++ AY+ +  ++GY QG  F+  +L++ M  EDAF+   +++        Y  + SE  + +      +   LP+LA HF  H     ++   W  T+++ +  ++ + RV D+F  +G   +F+  L  L  ++ +LL  D E M  FL    P+ L
Sbjct:   98 TIKLDVSRTFPNLNLFQN-GGPHHDLLYQLLGAYACYRPDIGYVQGMSFLAAILILVMNVEDAFICFANILELPCHHAFYALDESEFTVYLESFKLSLFTHLPQLAQHFFQHKLDVNIFLCDWLFTIYSRALPLDTALRVWDMFCRDGEAALFRAGLGILRCYEMQLLNSDFEEMAGFLTGQMPESL 283          
The following BLAST results are available for this feature:
BLAST of Rab-GAP TBC domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
EVI5L6.378e-13636.96ecotropic viral integration site 5 like [Source:HG... [more]
EVI5L3.475e-13236.94ecotropic viral integration site 5 like [Source:HG... [more]
EVI55.354e-13037.45ecotropic viral integration site 5 [Source:HGNC Sy... [more]
EVI54.794e-12439.10ecotropic viral integration site 5 [Source:HGNC Sy... [more]
RABGAP11.297e-6538.24RAB GTPase activating protein 1 [Source:HGNC Symbo... [more]
back to top
BLAST of Rab-GAP TBC domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
eat-174.655e-12136.42pep chromosome:WBcel235:X:16399210:16408873:-1 gen... [more]
eat-175.250e-12135.38pep chromosome:WBcel235:X:16399210:16413306:-1 gen... [more]
eat-171.195e-12035.38pep chromosome:WBcel235:X:16399210:16417063:-1 gen... [more]
eat-171.445e-12035.38pep chromosome:WBcel235:X:16399210:16417063:-1 gen... [more]
tbc-112.729e-6136.92TBC (Tre-2/Bub2/Cdc16) domain family [Source:UniP... [more]
back to top
BLAST of Rab-GAP TBC domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Evi52.441e-14839.06gene:FBgn0262740 transcript:FBtr0332620[more]
Evi52.441e-14839.06gene:FBgn0262740 transcript:FBtr0300732[more]
Evi52.854e-14839.28gene:FBgn0262740 transcript:FBtr0073547[more]
Evi53.471e-14838.93gene:FBgn0262740 transcript:FBtr0073546[more]
Evi54.099e-14839.42gene:FBgn0262740 transcript:FBtr0300733[more]
back to top
BLAST of Rab-GAP TBC domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
BX548019.17.552e-13840.13ecotropic viral integration site 5b [Source:NCBI g... [more]
evi5b7.655e-13739.97ecotropic viral integration site 5b [Source:ZFIN;A... [more]
BX548019.11.228e-13439.66ecotropic viral integration site 5b [Source:NCBI g... [more]
BX548019.11.526e-13439.66ecotropic viral integration site 5b [Source:NCBI g... [more]
evi5b2.245e-13439.53ecotropic viral integration site 5b [Source:ZFIN;A... [more]
back to top
BLAST of Rab-GAP TBC domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
EVI51.789e-14036.99ecotropic viral integration site 5 [Source:NCBI ge... [more]
EVI56.144e-13037.15ecotropic viral integration site 5 [Source:NCBI ge... [more]
evi5l5.521e-12636.97ecotropic viral integration site 5-like [Source:NC... [more]
EVI53.520e-12534.95ecotropic viral integration site 5 [Source:NCBI ge... [more]
EVI51.167e-12434.95ecotropic viral integration site 5 [Source:NCBI ge... [more]
back to top
BLAST of Rab-GAP TBC domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Evi51.324e-14040.12ecotropic viral integration site 5 [Source:MGI Sym... [more]
Evi5l6.948e-13837.69ecotropic viral integration site 5 like [Source:MG... [more]
Evi5l5.563e-13437.41ecotropic viral integration site 5 like [Source:MG... [more]
Evi54.113e-12736.32ecotropic viral integration site 5 [Source:MGI Sym... [more]
Evi5l3.092e-11535.24ecotropic viral integration site 5 like [Source:MG... [more]
back to top
BLAST of Rab-GAP TBC domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9VYY9|EVI5_DROME2.861e-14739.28Ecotropic viral integration site 5 ortholog OS=Dro... [more]
sp|Q96CN4|EVI5L_HUMAN1.669e-13136.94EVI5-like protein OS=Homo sapiens OX=9606 GN=EVI5L... [more]
sp|O60447|EVI5_HUMAN2.302e-12339.10Ecotropic viral integration site 5 protein homolog... [more]
sp|P97366|EVI5_MOUSE2.445e-11234.47Ecotropic viral integration site 5 protein OS=Mus ... [more]
sp|A2AWA9|RBGP1_MOUSE2.253e-7038.24Rab GTPase-activating protein 1 OS=Mus musculus OX... [more]
back to top
BLAST of Rab-GAP TBC domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
T1J7S39.418e-16441.12Rab-GAP TBC domain-containing protein OS=Strigamia... [more]
A0A0X3NSX42.525e-16338.24Ecotropic viral integration site 5 ortholog (Fragm... [more]
A0A2R2MQI67.179e-16042.22EVI5-like protein isoform X2 OS=Lingula unguis OX=... [more]
A0A1E1XJV92.138e-15940.53Rab-GAP TBC domain-containing protein (Fragment) O... [more]
A0A067RH379.792e-15941.30TBC1 domain family member (Fragment) OS=Zootermops... [more]
back to top
BLAST of Rab-GAP TBC domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
evi5b1.947e-14539.29ecotropic viral integration site 5 protein homolog... [more]
si:ch211-239f4.16.461e-13036.76ecotropic viral integration site 5 like [Source:NC... [more]
si:ch211-239f4.17.324e-13036.76ecotropic viral integration site 5 like [Source:NC... [more]
si:ch211-239f4.14.209e-12636.49ecotropic viral integration site 5 like [Source:NC... [more]
evi5b5.989e-12336.38ecotropic viral integration site 5 protein homolog... [more]
back to top
BLAST of Rab-GAP TBC domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000010479.16.617e-11244.34pep scaffold:Pmarinus_7.0:GL480469:1915:23479:-1 g... [more]
ENSPMAT00000000235.13.292e-7243.34pep scaffold:Pmarinus_7.0:GL476858:30488:54209:-1 ... [more]
ENSPMAT00000010399.11.246e-3128.24pep scaffold:Pmarinus_7.0:GL482471:634455:650213:1... [more]
ENSPMAT00000010396.11.283e-3128.24pep scaffold:Pmarinus_7.0:GL482471:634449:650210:1... [more]
tbc1d2b4.489e-3031.05TBC1 domain family, member 2B [Source:ZFIN;Acc:ZDB... [more]
back to top
BLAST of Rab-GAP TBC domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
GYP53.300e-3834.80GTPase-activating protein (GAP) for yeast Rab fami... [more]
GYL13.556e-2827.81Putative GTPase activating protein (GAP) with a ro... [more]
MDR19.557e-2529.74Cytoplasmic GTPase-activating protein; activates Y... [more]
MSB43.049e-1725.29GTPase-activating protein of the Ras superfamily; ... [more]
MSB34.510e-1024.73Rab GTPase-activating protein; regulates endocytos... [more]
back to top
BLAST of Rab-GAP TBC domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO346493.416e-10642.22Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO340835.739e-6737.58Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO404822.815e-3631.86Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO394001.918e-3028.09Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO500243.512e-2829.84Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Rab-GAP TBC domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
evi5b2.052e-14837.81ecotropic viral integration site 5 [Source:NCBI ge... [more]
evi5b2.052e-14837.81ecotropic viral integration site 5 [Source:NCBI ge... [more]
evi5b5.567e-14338.48ecotropic viral integration site 5 [Source:NCBI ge... [more]
evi5b1.090e-12534.71ecotropic viral integration site 5 [Source:NCBI ge... [more]
si:ch211-239f4.11.719e-12537.71ecotropic viral integration site 5 like [Source:NC... [more]
back to top
BLAST of Rab-GAP TBC domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000003946.10.000e+099.76SMESG000003946.1[more]
SMESG000061861.11.110e-5532.39SMESG000061861.1[more]
SMESG000061861.13.180e-5534.16SMESG000061861.1[more]
SMESG000005104.15.754e-3631.33SMESG000005104.1[more]
SMESG000071846.18.962e-2327.27SMESG000071846.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30000054 ID=SMED30000054|Name=Rab-GAP TBC domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=2895bp
AAATATTATATTTTGAATTAATTTTAACTTTTTCGTTTTACTTCAAATTT
TTGAATAAACACATTTAAGTTATATCATATAATATAATTTAAAATGGCTA
CCGATGAACAAGAAATACTTTTAGCTAAACTTGAAGAAAAAAATCGGTCA
CTTCAAATGGATAGTAAAAGTGTTCAATCACTTACTGGATTGAGCAGGAA
AAATTCTGTTACTAGCGAAATGAATGTAGCTTTTACTTTGGATGATGATA
AAATAAGTTTAAATTCTAATAATTTTTCGAACTCATTAGCTGATATAAAT
GCGCGACATTTGGAAAAATGGAGCAATGTTATTAATAATTGGAACCAATT
TTCCCGTAAAAAAAGCCAAGTTAAGGAATTAATGAAACAAAGCAATGGTG
TACCACATCACTACAGACCCCTTATTTGGCAGCTGATAACAGGGTGCAAT
GAAGACAATGTAAATTCTGTTCAACTGAAGGCAATTTATCCAGAATATCT
AAAACAGCAATCTCCATGCGAAAAGGCTATTCGAAGGGATATTGCAAGAA
CTTATCCACAACATGATTTATTTAAGGATCCTAATGGTGATGGTCAAGAA
AGATTATTTAATATTATGAAAGCCTATTCAATTCATGATAGAGAGGTTGG
ATACTGCCAAGGGTCTGGTTTCATAGGTGGCTTACTTCTTATACAAATGC
CAGAAGAGGATGCTTTTGTTGTACTGGTGTCTCTTATGTTTGAACATCAA
TTGCGTAATTTATACAAGCCAAACATGTCTGAATTGGGATTATGCATGTA
TCAATTGGACTGTTTAGTAGAAGAGCAACTTCCGAAATTGGCTCTCCATT
TCAGATCTCATAATTTCCACGCGACAGTTTATGCATCTGGCTGGTTTCTC
ACTCTTTTCACTCTTTCATTTTCTATCGAGCTTTCTAGCAGAGTTATGGA
CTTATTTATGGTGGAAGGGATCGATATAATTTTTAAAATTTCCCTCGCCT
ACCTAACAACGTTTCAGGATGAACTATTAAAATTAGATATGGAATCAATG
CTTCGATTTTTACAATCGATCGGCCCTCAACAGCTTGAACTTGATCCCAA
TCCGCTTTTTGATCTGGCTGTTCAACTGAAACTAAACACCAGAAAAATGA
AAAAAGCTGAAAAAGAATATCTCGCTCTAAAAATGGAAGAAGAGGAAAAT
CACGTAGAATTGAGAAGACTTCGAACAGAAAATGGACTTCTTTTACAGAG
AATTGACAGACTTGAAAAAGAATGTGAATTGCTAAATTCGAATTATATCA
CCAAAAACATGGCTTACTTGCAGCAATGCGATGAAATAAAAATCTTAAGA
ATAGATATTTCTGAAGCGAAGCGAAAAGTTGATAATTTGAAACAAAATCT
AAGTGGAACGGAAATTCAGCTTCAATTGGCTGTCGGACAATTAAACGGCA
GAATCAATGAGGAAAACAATAAGGATATTATTCAGAAAAGAAGATCTGTT
GATGTCTCCTCAGACCTTGTTCATCAATTGCAAACGCAACTTGTGAATAT
CAGATTAAAAGAAGCTGAAACAAATGCTTCATTTCGAGAACTTAAAGAAA
AATATAGAGAATTAGAAGAAGAAAACCGCCGGCTATCAAAAACACCTACA
GAAGAAGTGGCTAAGCTCCAAGAAGATTTAGTAGCCATAAAATTGCGTGA
GGCTGAAACTGGACTGTCTCTGAAAGATAGTTTAAAACGTTTGAACGAAC
TCAATAAGTTATGGATGAATCATGTCGATCAATGCCATCAAAATTTGGAA
AATGTGCAAACAGATTCTAAAAAGGATAGACATTCACTTTATGAGGGAAA
AGATTCCACCAACAAAGATATTGGCATTCTTCAATTATCCAGAAAATTGG
TCGAAGCAGAATACGCGTCTGATCTCAATGCTGCTCGACAAAAGATCATG
GAAACAGAAGCTCGGCAGCAAATTTATTGTCGCCAGGTTTCAAGGTTAGA
TGAAGAAATTATCATTTTAAAGGAAAAGCTCGAAGACTACATTGTCATAC
AGAAAAAATTAAGATTGGAATTGAAAGAAGCGGAACGACGGTGCATTGAC
CTTGAGACAAAAAGAAAAGAAGACCTGATGATGTGGAAAATCCAGAAAAT
GGAAATGGGGTCAATAATAGCAGAATTGAAACAGAAAGTCGCTCGTATGG
AAACTCAACGAGAAGAAATTTCAACGTCTTCTAGAATGGGTCATAATAAA
AATCTTCCGCCACAAATTGAAATGAAACAAACATCAACTCGACTGGAACA
TCAGCCTTTATCCAATAAGTGGAAAGACCTTCCTCATACAATAATGACAG
ACTCTATTGGACCGCTAGATGAAATATGTTTTAATCCTGATGATCCTATG
ATCACGAGTATCTACATTCACCCTAGCAGTTCCCAACCAAAACTACAATG
CAGCGACATAACACGTGTGAATGCTGAAGAGAATTATAGAAGGTCCATTG
AGCTGGAACATAGCAGTGCTTCTAGTAATGGTTATTCTGTTGATAGGTCT
GTTTTAACTAACAGGGACAGTCAAGATGATAGTGATATCGATGCAATGAG
TTGAAACACTAAGATTTTGTATTTATTAATATTATTGTCTGGATGCAATA
TTATTCTGTGATCGAAAAGAACTATTATTTTATAGTCAATTGATTCGAGT
GTGGTTAATTGCGGCTGTCCAATGTGGGCCGGCTGGTATCCGATTGATTC
CTCGGTGCTAGTTGTGTGATTGGTTCGTATCATTGGTCAGTTTGTCAACC
TCGCAGTTACACATCTAGATTCCGATTTAATCTTTTATTATGATTATTAT
TATTATATTGTAAATAATTTTTAATTTTTTTACTTTAAGTCATAA
back to top

protein sequence of SMED30000054-orf-1

>SMED30000054-orf-1 ID=SMED30000054-orf-1|Name=SMED30000054-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=837bp
MATDEQEILLAKLEEKNRSLQMDSKSVQSLTGLSRKNSVTSEMNVAFTLD
DDKISLNSNNFSNSLADINARHLEKWSNVINNWNQFSRKKSQVKELMKQS
NGVPHHYRPLIWQLITGCNEDNVNSVQLKAIYPEYLKQQSPCEKAIRRDI
ARTYPQHDLFKDPNGDGQERLFNIMKAYSIHDREVGYCQGSGFIGGLLLI
QMPEEDAFVVLVSLMFEHQLRNLYKPNMSELGLCMYQLDCLVEEQLPKLA
LHFRSHNFHATVYASGWFLTLFTLSFSIELSSRVMDLFMVEGIDIIFKIS
LAYLTTFQDELLKLDMESMLRFLQSIGPQQLELDPNPLFDLAVQLKLNTR
KMKKAEKEYLALKMEEEENHVELRRLRTENGLLLQRIDRLEKECELLNSN
YITKNMAYLQQCDEIKILRIDISEAKRKVDNLKQNLSGTEIQLQLAVGQL
NGRINEENNKDIIQKRRSVDVSSDLVHQLQTQLVNIRLKEAETNASFREL
KEKYRELEEENRRLSKTPTEEVAKLQEDLVAIKLREAETGLSLKDSLKRL
NELNKLWMNHVDQCHQNLENVQTDSKKDRHSLYEGKDSTNKDIGILQLSR
KLVEAEYASDLNAARQKIMETEARQQIYCRQVSRLDEEIIILKEKLEDYI
VIQKKLRLELKEAERRCIDLETKRKEDLMMWKIQKMEMGSIIAELKQKVA
RMETQREEISTSSRMGHNKNLPPQIEMKQTSTRLEHQPLSNKWKDLPHTI
MTDSIGPLDEICFNPDDPMITSIYIHPSSSQPKLQCSDITRVNAEENYRR
SIELEHSSASSNGYSVDRSVLTNRDSQDDSDIDAMS*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000020protonephridia
PLANA:0000099neuron
PLANA:0000101muscle cell
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR031214Evi5
IPR035969Rab-GTPase_TBC_sf
IPR000195Rab-GTPase-TBC_dom
Vocabulary: molecular function
TermDefinition
GO:0005096GTPase activator activity
Vocabulary: biological process
TermDefinition
GO:0043087regulation of GTPase activity
GO:0043547positive regulation of GTPase activity
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 3..30
NoneNo IPR availableCOILSCoilCoilcoord: 373..400
NoneNo IPR availableCOILSCoilCoilcoord: 345..365
NoneNo IPR availableCOILSCoilCoilcoord: 691..711
NoneNo IPR availableCOILSCoilCoilcoord: 645..672
NoneNo IPR availableCOILSCoilCoilcoord: 490..517
NoneNo IPR availableCOILSCoilCoilcoord: 603..623
NoneNo IPR availableCOILSCoilCoilcoord: 415..442
NoneNo IPR availableGENE3DG3DSA:1.10.8.270coord: 124..216
e-value: 9.0E-33
score: 114.1
NoneNo IPR availableGENE3DG3DSA:1.10.10.750coord: 70..118
e-value: 1.1E-6
score: 30.6
NoneNo IPR availableGENE3DG3DSA:1.10.472.80coord: 217..367
e-value: 2.0E-43
score: 149.7
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 803..820
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 803..835
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 821..835
NoneNo IPR availablePANTHERPTHR22957TBC1 DOMAIN FAMILY MEMBER GTPASE-ACTIVATING PROTEINcoord: 10..597
IPR000195Rab-GTPase-TBC domainSMARTSM00164tbc_4coord: 99..315
e-value: 2.4E-71
score: 253.0
IPR000195Rab-GTPase-TBC domainPFAMPF00566RabGAP-TBCcoord: 106..312
e-value: 1.5E-52
score: 178.4
IPR000195Rab-GTPase-TBC domainPROSITEPS50086TBC_RABGAPcoord: 102..292
score: 30.929
IPR031214Ecotropic viral integration site 5 proteinPANTHERPTHR22957:SF254EVI5-LIKE PROTEINcoord: 10..597
IPR035969Rab-GTPase-TBC domain superfamilySUPERFAMILYSSF47923Ypt/Rab-GAP domain of gyp1pcoord: 227..349
IPR035969Rab-GTPase-TBC domain superfamilySUPERFAMILYSSF47923Ypt/Rab-GAP domain of gyp1pcoord: 76..252