Fat inducing protein 1

Overview
NameFat inducing protein 1
Smed IDSMED30000043
Length (bp)2206
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Fat inducing protein 1 (SMED30000043) t-SNE clustered cells

Violin plots show distribution of expression levels for Fat inducing protein 1 (SMED30000043) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Fat inducing protein 1 (SMED30000043) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Fat inducing protein 1 (SMED30000043) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30000043

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
epidermisSMED30000043h1SMcG0006820 dd_Smed_v4_10388_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
posterior sideSMED30000043h1SMcG0006820 dd_Smed_v4_10388_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
posterior muscle cellSMED30000043h1SMcG0006820 dd_Smed_v4_10388_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Fat inducing protein 1 vs. Ensembl Human
Match: FITM2 (fat storage inducing transmembrane protein 2 [Source:HGNC Symbol;Acc:HGNC:16135])

HSP 1 Score: 134.035 bits (336), Expect = 1.876e-34
Identity = 85/246 (34.55%), Postives = 121/246 (49.19%), Query Frame = 1
Query:  334 VGSVYFDIFRMPSSYLSNKYNIFNQIFVKWAWGWTLSILFCFIVTTSYIYTGGNTSQMRRQVLRLFVGTIWWYICTGIFQTIENETGACHLKINNKYVYESSIANKRICKQKTGVWLGFDISGHVFLLVLCNMWIFEETKILHLWQRLDRFVLXXXXXXXXXXXXXXEIVNIRKSYRKLNINVKXXXXXXXXXXXXWDFMLIVTIIYFHDMPSKLTAVLIAVFCWFISYRFIFKSNLSFMPNLPEN 1071
             GS+  ++  +P SYLSNK N+ N  FVK AW WT  +L  FI  T+Y  TG     +RR +  L VGT  WYICT IF  IE+ TG+C+     + V +    +K+ C Q+ G W GFDISGH FLL  C + I EE  +LH                        E+   R     L+  +  +   L +L+ +W  M + T +YFH++  K+   L  +  W+ +Y F +    +F P LP  
Sbjct:   34 AGSLLKELSPLPESYLSNKRNVLNVYFVKVAWAWTFCLLLPFIALTNYHLTGKAGLVLRR-LSTLLVGTAIWYICTSIFSNIEHYTGSCYQSPALEGVRKEH-QSKQQCHQEGGFWHGFDISGHSFLLTFCALMIVEEMSVLH------------------------EVKTDRS--HCLHTAITTLVVALGILTFIWVLMFLCTAVYFHNLSQKVFGTLFGLLSWYGTYGFWYPK--AFSPGLPPQ 249          
BLAST of Fat inducing protein 1 vs. Ensembl Human
Match: FITM1 (fat storage inducing transmembrane protein 1 [Source:HGNC Symbol;Acc:HGNC:33714])

HSP 1 Score: 65.855 bits (159), Expect = 5.761e-11
Identity = 38/130 (29.23%), Postives = 60/130 (46.15%), Query Frame = 1
Query:  367 PSSYLSNKYNIFNQIFVKWAWGWTLSILFCFIVTTSYIYTGGNTSQMRRQVLRLFVGTIWWYICTGIFQTIENETGACHLKINNKYVYESSIANKRICKQKTGVWLGFDISGHVFLLVLCNMWIFEETKI 756
            P +  ++  N FN  FV  AWGWT + L  F++   ++ T    +   R + RL VG   W      F  IE+ TG+C   +    +    + ++R C      W G+ +S H FLL  C + + EE  +
Sbjct:   76 PRTIFASHGNFFNIKFVNSAWGWTCTFLGGFVLLVVFLAT-RRVAVTARHLSRLVVGAAVWRGAGRAFLLIEDLTGSCFEPLPQGLLLH-ELPDRRSCLAAGHQWRGYTVSSHTFLLTFCCLLMAEEAAV 203          
BLAST of Fat inducing protein 1 vs. Ensembl Human
Match: FITM1 (fat storage inducing transmembrane protein 1 [Source:HGNC Symbol;Acc:HGNC:33714])

HSP 1 Score: 65.855 bits (159), Expect = 5.761e-11
Identity = 38/130 (29.23%), Postives = 60/130 (46.15%), Query Frame = 1
Query:  367 PSSYLSNKYNIFNQIFVKWAWGWTLSILFCFIVTTSYIYTGGNTSQMRRQVLRLFVGTIWWYICTGIFQTIENETGACHLKINNKYVYESSIANKRICKQKTGVWLGFDISGHVFLLVLCNMWIFEETKI 756
            P +  ++  N FN  FV  AWGWT + L  F++   ++ T    +   R + RL VG   W      F  IE+ TG+C   +    +    + ++R C      W G+ +S H FLL  C + + EE  +
Sbjct:   76 PRTIFASHGNFFNIKFVNSAWGWTCTFLGGFVLLVVFLAT-RRVAVTARHLSRLVVGAAVWRGAGRAFLLIEDLTGSCFEPLPQGLLLH-ELPDRRSCLAAGHQWRGYTVSSHTFLLTFCCLLMAEEAAV 203          
BLAST of Fat inducing protein 1 vs. Ensembl Celegans
Match: fitm-2 (FIT family protein fitm-2 [Source:UniProtKB/Swiss-Prot;Acc:Q5CZ37])

HSP 1 Score: 95.5153 bits (236), Expect = 1.789e-21
Identity = 74/297 (24.92%), Postives = 128/297 (43.10%), Query Frame = 1
Query:  172 TNPATSKSQSAKKKNLPGPMNPLNFMIMAMFKFAKKPLLVDINYRIGIYLCVVSVGSVYFDIFRMPSSY-LSNKYNIFNQIFVKWAWGWTLSILFCFIVTTSYIYTGGNTSQMRRQVLRLFVGTIWWYICTGIFQTIENETGACHLKINNKYVYESSIANKRICKQKTGVWL-GFDISGHVFLLVLCNMWIFEETKILHLWQRLDRFVLXXXXXXXXXXXXXXEIVNIRKSYRKLNINVKXXXXXXXXXXXXWDFMLIVTIIYFHDMPSKLTAVLIAVFCWFISYRFIFKSNLSFMP 1056
            T  +++++ S  K+    P +  N  +      A++ L +D       YL  V+V S       + S+Y L  K+++ NQ  VK  W WTL I+  FI  +S  +   +  Q    V RL VGT  WY     F  +   T  C          +     +  C +K GVW  G+DISGH FL++   + I EE      +Q++   V               ++   R+ + +L   ++     +  L   W   +I++++Y+H    ++   + AV CWF++YR ++ +     P
Sbjct:    3 TRRSSTRADSTTKRP-ASPNSTPNAALGIFVAIARQILFIDARKVALFYLAFVTVLSFIESRIELDSTYYLVQKHSVLNQYGVKMGWFWTLVIVGPFIWFSSKAHNRRDRDQPIVDVCRLGVGTACWYFSVQFFHKVLALTSMCD---------KGRTLTRAQCSEKEGVWTPGYDISGHCFLMIYSILIITEEAIAYRHYQQVTDAV--------------HQMDGDREEHDRLTRCIQYFFVAMLFLHAFWFKQIIISVLYYHIFIEEILGAVAAVVCWFVTYRMLYPAGFLASP 275          
BLAST of Fat inducing protein 1 vs. Ensembl Celegans
Match: fitm-2 (FIT family protein fitm-2 [Source:UniProtKB/Swiss-Prot;Acc:Q5CZ37])

HSP 1 Score: 95.5153 bits (236), Expect = 1.789e-21
Identity = 74/297 (24.92%), Postives = 128/297 (43.10%), Query Frame = 1
Query:  172 TNPATSKSQSAKKKNLPGPMNPLNFMIMAMFKFAKKPLLVDINYRIGIYLCVVSVGSVYFDIFRMPSSY-LSNKYNIFNQIFVKWAWGWTLSILFCFIVTTSYIYTGGNTSQMRRQVLRLFVGTIWWYICTGIFQTIENETGACHLKINNKYVYESSIANKRICKQKTGVWL-GFDISGHVFLLVLCNMWIFEETKILHLWQRLDRFVLXXXXXXXXXXXXXXEIVNIRKSYRKLNINVKXXXXXXXXXXXXWDFMLIVTIIYFHDMPSKLTAVLIAVFCWFISYRFIFKSNLSFMP 1056
            T  +++++ S  K+    P +  N  +      A++ L +D       YL  V+V S       + S+Y L  K+++ NQ  VK  W WTL I+  FI  +S  +   +  Q    V RL VGT  WY     F  +   T  C          +     +  C +K GVW  G+DISGH FL++   + I EE      +Q++   V               ++   R+ + +L   ++     +  L   W   +I++++Y+H    ++   + AV CWF++YR ++ +     P
Sbjct:    3 TRRSSTRADSTTKRP-ASPNSTPNAALGIFVAIARQILFIDARKVALFYLAFVTVLSFIESRIELDSTYYLVQKHSVLNQYGVKMGWFWTLVIVGPFIWFSSKAHNRRDRDQPIVDVCRLGVGTACWYFSVQFFHKVLALTSMCD---------KGRTLTRAQCSEKEGVWTPGYDISGHCFLMIYSILIITEEAIAYRHYQQVTDAV--------------HQMDGDREEHDRLTRCIQYFFVAMLFLHAFWFKQIIISVLYYHIFIEEILGAVAAVVCWFVTYRMLYPAGFLASP 275          
BLAST of Fat inducing protein 1 vs. Ensembl Fly
Match: Fitm (gene:FBgn0035586 transcript:FBtr0077178)

HSP 1 Score: 142.895 bits (359), Expect = 2.310e-36
Identity = 90/322 (27.95%), Postives = 159/322 (49.38%), Query Frame = 1
Query:  136 PLKKFSFSNSNKTNPATSKSQSAKKKNLPGPMNPLNFMIMAMFKFAKKPLLVDINYRIGIYLCVVSVGSVYFDIFRMPSSYLSNKYNIFNQIFVKWAWGWTLSILFCFIVTTSYIYTGGNTSQM-RRQVLRLFVGTIWWYICTGIFQTIENETGACHLKINNKYVYESSIANKRICKQKTGVWLGFDISGHVFLLVLCNMWIFEETKILHLW---------QRLDRFVLXXXXXXXXXXXXXXEIVNIRKSYRKLNINVKXXXXXXXXXXXXWDFMLIVTIIYFHDMPSKLTAVLIAVFCWFISYRFIFKSNLSFMPNLPEN 1071
            P    S  N     P  ++S++   +    P +    ++M +    KK +  + + ++ +YL  + V SV  D    P +Y +   N+FNQ FVK  WGWTL  +  F+V ++Y  T G+  +M R    R+ + T +W+  T +F  +EN  G C  K           A K  C +   +W GFDISGH F+L+  ++ + EE + +  W         +R +R    NS T    T+   ++ +++  Y++L   ++ +   ++ L +LWD ML+ T++Y+H M  K+ + +IA+  W+ +YRF + +    +P  P N
Sbjct:   19 PSSSGSNMNFRPGGPDITRSEARGTRPTAAPTSIREILVMGVIHLCKKTIFFNTDLKVALYLGSLFVISVIGDFVPFPKTYFARSDNLFNQYFVKIGWGWTLLFVVPFLVLSAYTITCGDHKRMLRHHFPRIVIATFFWFFWTKLFNVVENSYGRCTTK---------GYATKSSCLKAGHLWKGFDISGHAFILIHSSLVLIEEARPIIRWETIKEHIRNERHNRSTAENSGTNPLRTLNEEQMRSLQFLYKRLTPIIRTLFIGMAALQLLWDIMLVGTMLYYHRMIEKVISGIIAILTWYFTYRFWYPTP-GLLPEAPGN 330          
BLAST of Fat inducing protein 1 vs. Ensembl Fly
Match: Fitm (gene:FBgn0035586 transcript:FBtr0077177)

HSP 1 Score: 143.28 bits (360), Expect = 4.102e-36
Identity = 90/322 (27.95%), Postives = 159/322 (49.38%), Query Frame = 1
Query:  136 PLKKFSFSNSNKTNPATSKSQSAKKKNLPGPMNPLNFMIMAMFKFAKKPLLVDINYRIGIYLCVVSVGSVYFDIFRMPSSYLSNKYNIFNQIFVKWAWGWTLSILFCFIVTTSYIYTGGNTSQM-RRQVLRLFVGTIWWYICTGIFQTIENETGACHLKINNKYVYESSIANKRICKQKTGVWLGFDISGHVFLLVLCNMWIFEETKILHLW---------QRLDRFVLXXXXXXXXXXXXXXEIVNIRKSYRKLNINVKXXXXXXXXXXXXWDFMLIVTIIYFHDMPSKLTAVLIAVFCWFISYRFIFKSNLSFMPNLPEN 1071
            P    S  N     P  ++S++   +    P +    ++M +    KK +  + + ++ +YL  + V SV  D    P +Y +   N+FNQ FVK  WGWTL  +  F+V ++Y  T G+  +M R    R+ + T +W+  T +F  +EN  G C  K           A K  C +   +W GFDISGH F+L+  ++ + EE + +  W         +R +R    NS T    T+   ++ +++  Y++L   ++ +   ++ L +LWD ML+ T++Y+H M  K+ + +IA+  W+ +YRF + +    +P  P N
Sbjct:   76 PSSSGSNMNFRPGGPDITRSEARGTRPTAAPTSIREILVMGVIHLCKKTIFFNTDLKVALYLGSLFVISVIGDFVPFPKTYFARSDNLFNQYFVKIGWGWTLLFVVPFLVLSAYTITCGDHKRMLRHHFPRIVIATFFWFFWTKLFNVVENSYGRCTTK---------GYATKSSCLKAGHLWKGFDISGHAFILIHSSLVLIEEARPIIRWETIKEHIRNERHNRSTAENSGTNPLRTLNEEQMRSLQFLYKRLTPIIRTLFIGMAALQLLWDIMLVGTMLYYHRMIEKVISGIIAILTWYFTYRFWYPTP-GLLPEAPGN 387          
BLAST of Fat inducing protein 1 vs. Ensembl Zebrafish
Match: fitm2 (fat storage inducing transmembrane protein 2 [Source:NCBI gene;Acc:552928])

HSP 1 Score: 105.531 bits (262), Expect = 6.806e-25
Identity = 75/257 (29.18%), Postives = 122/257 (47.47%), Query Frame = 1
Query:  301 YRIGIYLCVVSVGSVYFDIFRMPSSYLSNKYNIFNQIFVKWAWGWTLSILFCFIVTTSYIYTGGNTSQMRRQVLRLFVGTIWWYICTGIFQTIENETGACHLKINNKYVYESSIANKRICKQKTGVWLGFDISGHVFLLVLCNMWIFEETKILHLWQRLDRFVLXXXXXXXXXXXXXXEIVNIRKSYRKLNINVKXXXXXXXXXXXXWDFMLIVTIIYFHDMPSKLTAVLIAVFCWFISYRFIFKSNLSFMPNLPEN 1071
            Y   ++ C+  VGSV  +   +P SY S+  N+ N  FVK +WGWT+ +L  FI  +++ Y   +   +RR +  L V T+ WYICT  F  IE+ TG+C+ + N   V       K  C++    W GFDISGH F+L   ++ I EE                              +++I+ +YR  N  +  +   L+++  +W +M   T +YFHD+  K+      +  W+++Y+  +     F P LP  
Sbjct:   25 YLPHLFFCISLVGSVLKNAELVPESYFSSSRNVLNLYFVKVSWGWTIVLLLPFIAYSNF-YIKSHMFALRR-LTSLLVATLVWYICTETFFYIEDITGSCY-ESNTMVVIRGEFDTKAACRKAGFFWDGFDISGHSFILSYSSLVIMEE---------------------------MVPMLHIQPAYR--NPPLDCLYLALNVIVAIWIWMFGCTSVYFHDIIDKILGTSCGILGWYMTYKVWYLK--LFSPGLPPQ 247          
BLAST of Fat inducing protein 1 vs. Ensembl Zebrafish
Match: fitm2 (fat storage inducing transmembrane protein 2 [Source:NCBI gene;Acc:552928])

HSP 1 Score: 105.531 bits (262), Expect = 6.806e-25
Identity = 75/257 (29.18%), Postives = 122/257 (47.47%), Query Frame = 1
Query:  301 YRIGIYLCVVSVGSVYFDIFRMPSSYLSNKYNIFNQIFVKWAWGWTLSILFCFIVTTSYIYTGGNTSQMRRQVLRLFVGTIWWYICTGIFQTIENETGACHLKINNKYVYESSIANKRICKQKTGVWLGFDISGHVFLLVLCNMWIFEETKILHLWQRLDRFVLXXXXXXXXXXXXXXEIVNIRKSYRKLNINVKXXXXXXXXXXXXWDFMLIVTIIYFHDMPSKLTAVLIAVFCWFISYRFIFKSNLSFMPNLPEN 1071
            Y   ++ C+  VGSV  +   +P SY S+  N+ N  FVK +WGWT+ +L  FI  +++ Y   +   +RR +  L V T+ WYICT  F  IE+ TG+C+ + N   V       K  C++    W GFDISGH F+L   ++ I EE                              +++I+ +YR  N  +  +   L+++  +W +M   T +YFHD+  K+      +  W+++Y+  +     F P LP  
Sbjct:   25 YLPHLFFCISLVGSVLKNAELVPESYFSSSRNVLNLYFVKVSWGWTIVLLLPFIAYSNF-YIKSHMFALRR-LTSLLVATLVWYICTETFFYIEDITGSCY-ESNTMVVIRGEFDTKAACRKAGFFWDGFDISGHSFILSYSSLVIMEE---------------------------MVPMLHIQPAYR--NPPLDCLYLALNVIVAIWIWMFGCTSVYFHDIIDKILGTSCGILGWYMTYKVWYLK--LFSPGLPPQ 247          
BLAST of Fat inducing protein 1 vs. Ensembl Xenopus
Match: jagn1 (jagunal homolog 1 [Source:Xenbase;Acc:XB-GENE-5948803])

HSP 1 Score: 130.568 bits (327), Expect = 2.264e-33
Identity = 88/250 (35.20%), Postives = 130/250 (52.00%), Query Frame = 1
Query:  322 CVVSVGSVYFDIFRMPSSYLSNKYNIFNQIFVKWAWGWTLSILFCFIVTTSYIYTGGNTSQMRRQVLRLFVGTIWWYICTGIFQTIENETGACHLKINNKYVYESSIANKRICKQKTGVWLGFDISGHVFLLVLCNMWIFEETKILHLWQRLDRFVLXXXXXXXXXXXXXXEIVNIR--KSYRKLNINVKXXXXXXXXXXXXWDFMLIVTIIYFHDMPSKLTAVLIAVFCWFISYRFIFKSNLSFMPNLP 1065
            C+V  GS+  ++  +P SY +NK N+ N  FVK++WGWTL +L  FI  T+Y  T   T  +RR +  L V T+ WY+CT +F  IEN TG+C+         E    ++R C+  +G W GFDISGH FLL  C + I EET I                           I NIR  + + ++ IN +     LS+L I+W +M + T +YFH++  K+      +  W+I+YR+ +   +S  P LP
Sbjct:   33 CIVLGGSLLKELSPLPDSYWNNKRNVLNVYFVKFSWGWTLWLLLPFIALTNYKLTRSTTKVLRR-LSSLLVSTLIWYLCTNLFLYIENITGSCYESEAMSDPKEHQ--DRRECRLHSGYWHGFDISGHCFLLSYCILLILEETSI---------------------------ISNIRFERHWHRMAINAQ--FAALSILVIIWVWMFLCTAVYFHNIFQKVIGTAFGILAWYITYRWWYLQPIS--PGLP 248          
BLAST of Fat inducing protein 1 vs. Ensembl Xenopus
Match: kiaa0895 (KIAA0895 protein [Source:Xenbase;Acc:XB-GENE-5831988])

HSP 1 Score: 71.2478 bits (173), Expect = 6.691e-13
Identity = 42/133 (31.58%), Postives = 68/133 (51.13%), Query Frame = 1
Query:  367 PSSYLSNKYNIFNQIFVKWAWGWTLSILFCFIVTTSYIYTGGNTSQMRRQVLRLFVGTIWWYICTGI---FQTIENETGACHLKINNKYVYESSIANKRICKQKTGVWLGFDISGHVFLLVLCNMWIFEETKI 756
            P S  SN+ N FN  FV  + GWT  +L  F++  S++ TG         + RL VGT    +C GI   FQ +E+ TG+CH  +    +  + + ++  C+ +   W G+ IS   F L LC++ + +E  +
Sbjct:   52 PRSIFSNRNNFFNVKFVHCSCGWTFLLLSGFVLLVSFVPTG-RPFLTAMHLTRLAVGTA---LCQGIPHLFQLLEDLTGSCHQPLPPGTLLLTKLIDRASCQAEGHQWQGYHISPQTFTLTLCSLSMADELAV 180          
BLAST of Fat inducing protein 1 vs. Ensembl Mouse
Match: Fitm2 (fat storage-inducing transmembrane protein 2 [Source:MGI Symbol;Acc:MGI:2444508])

HSP 1 Score: 135.961 bits (341), Expect = 2.040e-35
Identity = 84/246 (34.15%), Postives = 125/246 (50.81%), Query Frame = 1
Query:  334 VGSVYFDIFRMPSSYLSNKYNIFNQIFVKWAWGWTLSILFCFIVTTSYIYTGGNTSQMRRQVLRLFVGTIWWYICTGIFQTIENETGACHLKINNKYVYESSIANKRICKQKTGVWLGFDISGHVFLLVLCNMWIFEETKILHLWQRLDRFVLXXXXXXXXXXXXXXEIVNIRKSYRKLNINVKXXXXXXXXXXXXWDFMLIVTIIYFHDMPSKLTAVLIAVFCWFISYRFIFKSNLSFMPNLPEN 1071
             GSV  ++  +P SYLSNK N+ N  FVK AW WT+ +L  FI  T+Y  T G TS + R++  L VGT  WYICT +F  IE+ TG+C+     + + +    +K+ C ++ G W GFDISGH FLL  C + I EE  +LH                        E+   R  +  L+  +  +   L  L+ +W +M + T +YFHD+  K+   +  +  W+ +Y + +    SF P LP  
Sbjct:   34 AGSVVKELSPLPESYLSNKRNVLNVYFVKLAWAWTVCLLLPFIALTNYHLT-GKTSLVLRRLSTLLVGTAIWYICTALFSNIEHYTGSCYQSPALEGIRQEH-RSKQQCHREGGFWHGFDISGHSFLLTFCALMIVEEMAVLH------------------------EVKTDRGHH--LHAAITTLVVALGFLTFIWVWMFLCTAVYFHDLTQKVFGTMFGLLGWYGTYGYWYLK--SFSPGLPPQ 249          
BLAST of Fat inducing protein 1 vs. Ensembl Mouse
Match: Fitm1 (fat storage-inducing transmembrane protein 1 [Source:MGI Symbol;Acc:MGI:1915930])

HSP 1 Score: 62.003 bits (149), Expect = 6.980e-10
Identity = 36/125 (28.80%), Postives = 58/125 (46.40%), Query Frame = 1
Query:  382 SNKYNIFNQIFVKWAWGWTLSILFCFIVTTSYIYTGGNTSQMRRQVLRLFVGTIWWYICTGIFQTIENETGACHLKINNKYVYESSIANKRICKQKTGVWLGFDISGHVFLLVLCNMWIFEETKI 756
            ++  N FN  FV  AWGWT + L  F++   ++ T    +   R + RL VG   W      F  IE+ TG+C   +    +    + +++ C      W G+ +S H FLL  C + + EE  +
Sbjct:   81 ASHGNFFNIKFVNSAWGWTCTFLGGFVLLVVFLAT-RRVAVTARHLSRLVVGAAVWRGAGRAFLLIEDLTGSCFEPLPQGLLLH-ELPDRKSCLAAGHQWRGYTVSSHTFLLTFCCLLMAEEAAV 203          
BLAST of Fat inducing protein 1 vs. UniProt/SwissProt
Match: sp|Q9VRJ2|FITM_DROME (Fat storage-inducing transmembrane protein OS=Drosophila melanogaster OX=7227 GN=Fitm PE=1 SV=1)

HSP 1 Score: 142.895 bits (359), Expect = 2.315e-35
Identity = 90/322 (27.95%), Postives = 159/322 (49.38%), Query Frame = 1
Query:  136 PLKKFSFSNSNKTNPATSKSQSAKKKNLPGPMNPLNFMIMAMFKFAKKPLLVDINYRIGIYLCVVSVGSVYFDIFRMPSSYLSNKYNIFNQIFVKWAWGWTLSILFCFIVTTSYIYTGGNTSQM-RRQVLRLFVGTIWWYICTGIFQTIENETGACHLKINNKYVYESSIANKRICKQKTGVWLGFDISGHVFLLVLCNMWIFEETKILHLW---------QRLDRFVLXXXXXXXXXXXXXXEIVNIRKSYRKLNINVKXXXXXXXXXXXXWDFMLIVTIIYFHDMPSKLTAVLIAVFCWFISYRFIFKSNLSFMPNLPEN 1071
            P    S  N     P  ++S++   +    P +    ++M +    KK +  + + ++ +YL  + V SV  D    P +Y +   N+FNQ FVK  WGWTL  +  F+V ++Y  T G+  +M R    R+ + T +W+  T +F  +EN  G C  K           A K  C +   +W GFDISGH F+L+  ++ + EE + +  W         +R +R    NS T    T+   ++ +++  Y++L   ++ +   ++ L +LWD ML+ T++Y+H M  K+ + +IA+  W+ +YRF + +    +P  P N
Sbjct:   19 PSSSGSNMNFRPGGPDITRSEARGTRPTAAPTSIREILVMGVIHLCKKTIFFNTDLKVALYLGSLFVISVIGDFVPFPKTYFARSDNLFNQYFVKIGWGWTLLFVVPFLVLSAYTITCGDHKRMLRHHFPRIVIATFFWFFWTKLFNVVENSYGRCTTK---------GYATKSSCLKAGHLWKGFDISGHAFILIHSSLVLIEEARPIIRWETIKEHIRNERHNRSTAENSGTNPLRTLNEEQMRSLQFLYKRLTPIIRTLFIGMAALQLLWDIMLVGTMLYYHRMIEKVISGIIAILTWYFTYRFWYPTP-GLLPEAPGN 330          
BLAST of Fat inducing protein 1 vs. UniProt/SwissProt
Match: sp|P59266|FITM2_MOUSE (Fat storage-inducing transmembrane protein 2 OS=Mus musculus OX=10090 GN=Fitm2 PE=1 SV=1)

HSP 1 Score: 135.961 bits (341), Expect = 1.427e-34
Identity = 84/246 (34.15%), Postives = 125/246 (50.81%), Query Frame = 1
Query:  334 VGSVYFDIFRMPSSYLSNKYNIFNQIFVKWAWGWTLSILFCFIVTTSYIYTGGNTSQMRRQVLRLFVGTIWWYICTGIFQTIENETGACHLKINNKYVYESSIANKRICKQKTGVWLGFDISGHVFLLVLCNMWIFEETKILHLWQRLDRFVLXXXXXXXXXXXXXXEIVNIRKSYRKLNINVKXXXXXXXXXXXXWDFMLIVTIIYFHDMPSKLTAVLIAVFCWFISYRFIFKSNLSFMPNLPEN 1071
             GSV  ++  +P SYLSNK N+ N  FVK AW WT+ +L  FI  T+Y  T G TS + R++  L VGT  WYICT +F  IE+ TG+C+     + + +    +K+ C ++ G W GFDISGH FLL  C + I EE  +LH                        E+   R  +  L+  +  +   L  L+ +W +M + T +YFHD+  K+   +  +  W+ +Y + +    SF P LP  
Sbjct:   34 AGSVVKELSPLPESYLSNKRNVLNVYFVKLAWAWTVCLLLPFIALTNYHLT-GKTSLVLRRLSTLLVGTAIWYICTALFSNIEHYTGSCYQSPALEGIRQEH-RSKQQCHREGGFWHGFDISGHSFLLTFCALMIVEEMAVLH------------------------EVKTDRGHH--LHAAITTLVVALGFLTFIWVWMFLCTAVYFHDLTQKVFGTMFGLLGWYGTYGYWYLK--SFSPGLPPQ 249          
BLAST of Fat inducing protein 1 vs. UniProt/SwissProt
Match: sp|Q8N6M3|FITM2_HUMAN (Fat storage-inducing transmembrane protein 2 OS=Homo sapiens OX=9606 GN=FITM2 PE=1 SV=1)

HSP 1 Score: 134.035 bits (336), Expect = 9.008e-34
Identity = 85/246 (34.55%), Postives = 121/246 (49.19%), Query Frame = 1
Query:  334 VGSVYFDIFRMPSSYLSNKYNIFNQIFVKWAWGWTLSILFCFIVTTSYIYTGGNTSQMRRQVLRLFVGTIWWYICTGIFQTIENETGACHLKINNKYVYESSIANKRICKQKTGVWLGFDISGHVFLLVLCNMWIFEETKILHLWQRLDRFVLXXXXXXXXXXXXXXEIVNIRKSYRKLNINVKXXXXXXXXXXXXWDFMLIVTIIYFHDMPSKLTAVLIAVFCWFISYRFIFKSNLSFMPNLPEN 1071
             GS+  ++  +P SYLSNK N+ N  FVK AW WT  +L  FI  T+Y  TG     +RR +  L VGT  WYICT IF  IE+ TG+C+     + V +    +K+ C Q+ G W GFDISGH FLL  C + I EE  +LH                        E+   R     L+  +  +   L +L+ +W  M + T +YFH++  K+   L  +  W+ +Y F +    +F P LP  
Sbjct:   34 AGSLLKELSPLPESYLSNKRNVLNVYFVKVAWAWTFCLLLPFIALTNYHLTGKAGLVLRR-LSTLLVGTAIWYICTSIFSNIEHYTGSCYQSPALEGVRKEH-QSKQQCHQEGGFWHGFDISGHSFLLTFCALMIVEEMSVLH------------------------EVKTDRS--HCLHTAITTLVVALGILTFIWVLMFLCTAVYFHNLSQKVFGTLFGLLSWYGTYGFWYPK--AFSPGLPPQ 249          
BLAST of Fat inducing protein 1 vs. UniProt/SwissProt
Match: sp|B2LYG4|FITM2_PIG (Fat storage-inducing transmembrane protein 2 OS=Sus scrofa OX=9823 GN=FITM2 PE=2 SV=1)

HSP 1 Score: 131.724 bits (330), Expect = 4.364e-33
Identity = 83/246 (33.74%), Postives = 121/246 (49.19%), Query Frame = 1
Query:  334 VGSVYFDIFRMPSSYLSNKYNIFNQIFVKWAWGWTLSILFCFIVTTSYIYTGGNTSQMRRQVLRLFVGTIWWYICTGIFQTIENETGACHLKINNKYVYESSIANKRICKQKTGVWLGFDISGHVFLLVLCNMWIFEETKILHLWQRLDRFVLXXXXXXXXXXXXXXEIVNIRKSYRKLNINVKXXXXXXXXXXXXWDFMLIVTIIYFHDMPSKLTAVLIAVFCWFISYRFIFKSNLSFMPNLPEN 1071
             GS+  ++  +P SYLSNK N+ N  FVK AW WT  +L  FI  T+Y  TG     +RR +  L VGT  WY+CT IF  +E+ TG+C+     + V    + +K+ C  + G W GFDISGH FLL  C + I EE  +LH                        E+   R     L++ +  +   L  L+ +W +M + T +YFH++  K+   L  +  W+ +Y F +    SF P LP  
Sbjct:   34 AGSLLKELSPLPESYLSNKRNVLNVYFVKVAWAWTFCLLLPFIALTNYHLTGKAGLVLRR-LSTLLVGTAIWYVCTAIFSNVEHYTGSCYQSPALEGVRNEPL-SKQQCHGQGGFWHGFDISGHSFLLTFCALMIVEEMAVLH------------------------EVKTDRS--HCLHVAITALVVALGFLTFIWVWMFLCTAVYFHNLSQKVFGTLFGLLGWYGTYGFWYLK--SFSPGLPPQ 249          
BLAST of Fat inducing protein 1 vs. UniProt/SwissProt
Match: sp|A0JP80|FITM2_XENTR (Fat storage-inducing transmembrane protein 2 OS=Xenopus tropicalis OX=8364 GN=fitm2 PE=2 SV=1)

HSP 1 Score: 130.568 bits (327), Expect = 1.350e-32
Identity = 88/250 (35.20%), Postives = 130/250 (52.00%), Query Frame = 1
Query:  322 CVVSVGSVYFDIFRMPSSYLSNKYNIFNQIFVKWAWGWTLSILFCFIVTTSYIYTGGNTSQMRRQVLRLFVGTIWWYICTGIFQTIENETGACHLKINNKYVYESSIANKRICKQKTGVWLGFDISGHVFLLVLCNMWIFEETKILHLWQRLDRFVLXXXXXXXXXXXXXXEIVNIR--KSYRKLNINVKXXXXXXXXXXXXWDFMLIVTIIYFHDMPSKLTAVLIAVFCWFISYRFIFKSNLSFMPNLP 1065
            C+V  GS+  ++  +P SY +NK N+ N  FVK++WGWTL +L  FI  T+Y  T   T  +RR +  L V T+ WY+CT +F  IEN TG+C+         E    ++R C+  +G W GFDISGH FLL  C + I EET I                           I NIR  + + ++ IN +     LS+L I+W +M + T +YFH++  K+      +  W+I+YR+ +   +S  P LP
Sbjct:   30 CIVLGGSLLKELCPLPDSYWNNKRNVLNVYFVKFSWGWTLWLLLPFIALTNYKLTRSTTKVLRR-LSSLLVSTLIWYLCTNLFLYIENITGSCYESEAMSDPKEHQ--DRRECRLHSGYWHGFDISGHCFLLSYCILLILEETSI---------------------------ISNIRFERHWHRMAINAQ--FAALSILVIIWVWMFLCTAVYFHNIFQKVIGTAFGILAWYITYRWWYLQPIS--PGLP 245          
BLAST of Fat inducing protein 1 vs. TrEMBL
Match: A0A068XZP3 (Fat inducing protein 1 OS=Echinococcus multilocularis OX=6211 GN=EmuJ_000497900 PE=4 SV=1)

HSP 1 Score: 254.603 bits (649), Expect = 1.426e-74
Identity = 128/318 (40.25%), Postives = 187/318 (58.81%), Query Frame = 1
Query:  124 LSMEPLKKFSFSNSNKTNPATSKSQSAKKKNLPGPMNPLNFMIMAMFKFAKKPLLVDINYRIGIYLCVVSVGSVYFDIFRMPSSYLSNKYNIFNQIFVKWAWGWTLSILFCFIVTTSYIYTGGNTSQMRRQVLRLFVGTIWWYICTGIFQTIENETGACHLKINNKYVYESSIA--NKRICKQKTGVWLGFDISGHVFLLVLCNMWIFEETKILHLWQRLDRFVLXXXXXXXXXXXXXXE-----------IVNIRKSYRKLNINVKXXXXXXXXXXXXWDFMLIVTIIYFHDMPSKLTAVLIAVFCWFISYRFIFKS 1038
            LS   L+KFS S S    PA   S+   + ++PGP +P  F  +  F   +KP+ VD + + G+YLC  + GS+ FD  +MP SY S+K N FN +FVKW WGWT   L  FI+ ++YIYTGGN   +R  ++RL VG+  WY CTG+F T+E   G+C+      +   SS+   N+R C+Q  G WLGFDISGH FLL + N+WI EE +++  W  L   +  ++ +    + T++            +  +R +Y +L +N++ +    + LS+LWDFML+ TI+YFH MPSKL    + + CWF+ YR IF S
Sbjct:    3 LSASSLRKFSKSGSKPLPPAEPGSR--PRHSIPGPTSPARFFSLFAFSLLRKPMFVDPSVKAGVYLCGAAAGSLIFDFLKMPGSYFSHKRNAFNILFVKWGWGWTFCCLSIFILISTYIYTGGNRRLIRAHLMRLLVGSACWYACTGVFNTVEYSFGSCYNPNGTLFRPPSSLRQFNRRSCRQAKGYWLGFDISGHCFLLTMSNLWILEELRVMRSWNVLGALLDVSTHSDDLDSSTATAAPRLPNVSPDTVQAMRSAYVRLTLNLRSVFCATACLSLLWDFMLLATIVYFHSMPSKLLGASVGISCWFVCYRGIFPS 318          
BLAST of Fat inducing protein 1 vs. TrEMBL
Match: U6JB17 (FIT family protein OS=Echinococcus granulosus OX=6210 GN=EGR_07787 PE=4 SV=1)

HSP 1 Score: 254.603 bits (649), Expect = 1.723e-74
Identity = 129/320 (40.31%), Postives = 190/320 (59.38%), Query Frame = 1
Query:  124 LSMEPLKKFSFSNSNKTNPATSKSQSAKKKNLPGPMNPLNFMIMAMFKFAKKPLLVDINYRIGIYLCVVSVGSVYFDIFRMPSSYLSNKYNIFNQIFVKWAWGWTLSILFCFIVTTSYIYTGGNTSQMRRQVLRLFVGTIWWYICTGIFQTIENETGACHLKINNKYVYESSIA----NKRICKQKTGVWLGFDISGHVFLLVLCNMWIFEETKILHLWQRLDRFVLXXXXXXXXXXXXXXE-----------IVNIRKSYRKLNINVKXXXXXXXXXXXXWDFMLIVTIIYFHDMPSKLTAVLIAVFCWFISYRFIFKS 1038
            LS   L+KFS S S    PA   S++  + ++PGP +P  F  +  F   +KP+ VD + + GIYLC  + GS+ FD  +MP+SY S+K N FN +FVKW WGWT   L  FI+ ++YIYTGGN   +R  ++RL VG+  WY CTG+F T+E   G+C+    N  ++ S  +    N+R C+Q  G WLGFDISGH FLL + N+WI EE +++  W  L   +  ++ +    + T++            +  +R +Y +L +N++ +    + LS+LWDFML+ TI+YFH MPSKL    + + CWF+ YR IF S
Sbjct:    3 LSASSLRKFSKSGSKPLPPAEPGSRA--RHSIPGPTSPARFFSLFAFSLLRKPMFVDPSVKAGIYLCGAAAGSLIFDFLKMPASYFSHKRNAFNLLFVKWGWGWTFCCLSIFILISTYIYTGGNRRLIRAHLMRLLVGSACWYACTGVFNTVEYSFGSCYNP--NGTLFRSPYSLRPFNRRSCRQAKGYWLGFDISGHCFLLTMSNLWILEELRVMRSWNVLGALLDVSTHSDDLDSSTATAAPRLPNVSPDTVQAMRSAYVRLTLNLRSVFCATACLSLLWDFMLLATIVYFHSMPSKLLGASVGISCWFVCYRGIFPS 318          
BLAST of Fat inducing protein 1 vs. TrEMBL
Match: A0A0R3X6V5 (Uncharacterized protein OS=Hydatigena taeniaeformis OX=6205 GN=TTAC_LOCUS9243 PE=4 SV=1)

HSP 1 Score: 254.603 bits (649), Expect = 1.908e-74
Identity = 135/324 (41.67%), Postives = 189/324 (58.33%), Query Frame = 1
Query:  121 KLSMEPLKKFSFSNSNKTNPATSKSQSAKKKNLPGPMNPLNFMIMAMFKFAKKPLLVDINYRIGIYLCVVSVGSVYFDIFRMPSSYLSNKYNIFNQIFVKWAWGWTLSILFCFIVTTSYIYTGGNTSQMRRQVLRLFVGTIWWYICTGIFQTIENETGACHLKINNKYVYESS---IANKRICKQKTGVWLGFDISGHVFLLVLCNMWIFEETKILHLWQRLDRFV---------------LXXXXXXXXXXXXXXEIVNIRKSYRKLNINVKXXXXXXXXXXXXWDFMLIVTIIYFHDMPSKLTAVLIAVFCWFISYRFIFKS 1038
             LS   L+KFS S S    PA S S++  + ++PGP +P  F  + MF   +KP+ VD   + GIYLC  + GS+ FD  +MP SY S K N FN +FVKW W WT   L  FI+ ++YIYTGGN   +R  ++RL VG+  WY CTG+F TIE   G C+   +N  ++ SS     N+R C+Q  G WLGFDISGH FLL + N+WI EE +++  W  L   +                  ++  R   ++S  +  +R +Y +L +N++ +  V + LS+LWDFML+VTI+YFH MPSKL    + + CWF+ YR IF S
Sbjct:    2 ALSASSLRKFSKSGSKPLPPAESGSRA--RHSIPGPTSPARFFGLFMFSLLRKPMFVDSTVKAGIYLCGAAGGSLIFDFLKMPPSYFSQKRNAFNLLFVKWGWAWTFCCLSTFILISTYIYTGGNRRLIRAHLMRLLVGSACWYACTGVFNTIEYSFGNCY--YSNGTLFRSSSFRPFNRRSCRQAKGYWLGFDISGHCFLLTMSNLWILEELRVMRSWNVLGALLNVSTHSDDLDSSANAAVKTEAPRLPNLSSDTVQAMRSAYARLTLNLRSVFCVTACLSLLWDFMLLVTIVYFHSMPSKLLGASVGISCWFVCYRGIFPS 321          
BLAST of Fat inducing protein 1 vs. TrEMBL
Match: A0A0R3WAU5 (Uncharacterized protein OS=Taenia asiatica OX=60517 GN=TASK_LOCUS7701 PE=4 SV=1)

HSP 1 Score: 253.832 bits (647), Expect = 4.049e-74
Identity = 129/325 (39.69%), Postives = 192/325 (59.08%), Query Frame = 1
Query:  124 LSMEPLKKFSFSNSNKTNPATSKSQSAKKKNLPGPMNPLNFMIMAMFKFAKKPLLVDINYRIGIYLCVVSVGSVYFDIFRMPSSYLSNKYNIFNQIFVKWAWGWTLSILFCFIVTTSYIYTGGNTSQMRRQVLRLFVGTIWWYICTGIFQTIENETGACHLKINNKYVYESSIA----NKRICKQKTGVWLGFDISGHVFLLVLCNMWIFEETKILHLWQRLDRFV--------LXXXXXXXXXXXXXXEIVNI--------RKSYRKLNINVKXXXXXXXXXXXXWDFMLIVTIIYFHDMPSKLTAVLIAVFCWFISYRFIFKS 1038
            L+   L+KFS S S    PA   S++  + ++PGP +P  F  + MF   +KP+ VD + + GIY+C  + GS+ FD  +MP SY S+K N FN +FVKW W WT   L  FI+ ++Y+YTGGN   +R  ++RL  G+  WY CTG+F T+E+  G+C+   +N  ++ S  +    N+R C+Q  G WLGFDISGH FLL++ N+WI EE +++  W  L   +        L +S    +    +  + N+        R +Y +L +N++ +  V + LS+LWDFML+VT++YFH MPSKL    + V CWF+ YR IF S
Sbjct:    3 LTASSLRKFSKSGSKPLPPAEPGSRA--RHSIPGPTSPARFFGLFMFSLLRKPMFVDPSVKAGIYICGAAAGSLIFDFLKMPPSYFSHKRNAFNLLFVKWGWAWTFCCLSTFILISTYVYTGGNRRLIRAHLMRLLFGSACWYACTGVFNTVEHSFGSCY--NSNGTLFHSPPSFRPFNRRSCRQAKGHWLGFDISGHCFLLIMSNLWILEELRVMRSWNVLGALLDVSAHSDDLVSSTASAAVKTEAPRLPNVKPDTVQAMRSAYARLTLNLRSVFCVTACLSLLWDFMLLVTVVYFHSMPSKLLGASVGVSCWFVCYRGIFPS 323          
BLAST of Fat inducing protein 1 vs. TrEMBL
Match: A0A0R3UIT1 (Uncharacterized protein OS=Mesocestoides corti OX=53468 GN=MCOS_LOCUS7363 PE=4 SV=1)

HSP 1 Score: 249.595 bits (636), Expect = 1.310e-72
Identity = 123/315 (39.05%), Postives = 178/315 (56.51%), Query Frame = 1
Query:  121 KLSMEPLKKFSFSNSNKTNPATSKSQSAKKKNLPGPMNPLNFMIMAMFKFAKKPLLVDINYRIGIYLCVVSVGSVYFDIFRMPSSYLSNKYNIFNQIFVKWAWGWTLSILFCFIVTTSYIYTGGNTSQMRRQVLRLFVGTIWWYICTGIFQTIENETGACHLKINNKYVYESSIANKRICKQKTGVWLGFDISGHVFLLVLCNMWIFEETKILHLWQRL----------DRFVLXXXXXXXXXXXXXXEIVNIRKSYRKLNINVKXXXXXXXXXXXXWDFMLIVTIIYFHDMPSKLTAVLIAVFCWFISYRFIFK 1035
             LS   L+KFS S S    PA   S+S  ++ +PGP +P  F  +  F   +KP+ VD + + G+YLC  + GS+ FD  +MP  Y SNK N  N IFVKW W WT   L  FI+ ++YIYTG N   +R  ++RL VG+  WY+CTG+F T+E+  G+C+ +             +R C+Q  G WLGFDISGH FLL + N+WI EE  ++  W  L          D    + +   R   V+   +  +R +Y +L +N++ +    + +S+LWDFM ++TIIYFH MPSKL    + + CWF+ YR +F 
Sbjct:    2 SLSAASLRKFSKSGSRPLPPAEPGSRS--RRPIPGPTSPAQFFSILAFSLLRKPMFVDPSVKAGLYLCAAAAGSLIFDFVKMPPCYFSNKRNALNLIFVKWGWAWTFCSLTAFIIISTYIYTGANKRLLRAHLMRLLVGSACWYVCTGVFNTVESTFGSCYNQNGTLLKAPFRTFTRRSCRQAKGFWLGFDISGHCFLLTMSNLWILEELCVMRSWGVLGALLDANTQNDELAKTPTAVPRLPNVSPETVQTMRSAYSRLTMNLRTVFCTTACISLLWDFMFLITIIYFHSMPSKLLGTSVGISCWFVCYRCLFP 314          
BLAST of Fat inducing protein 1 vs. Ensembl Cavefish
Match: fitm2 (fat storage inducing transmembrane protein 2 [Source:NCBI gene;Acc:103043781])

HSP 1 Score: 87.0409 bits (214), Expect = 1.252e-18
Identity = 71/246 (28.86%), Postives = 110/246 (44.72%), Query Frame = 1
Query:  337 GSVYFDIFRMPSSYLSNKYNIFNQIFVKWAWGWTLSILFCFIVTTSYIYTGGNTSQMRRQVLRLFVGTIWWYICTGIFQTIENETGACHLKINNKYVYESSIANKRICKQKTGVWLGFDISGHVFLLVLCNMWIFEE-TKILHLWQRLDRFVLXXXXXXXXXXXXXXEIVNIRKSYRKLNINVKXXXXXXXXXXXXWDFMLIVTIIYFHDMPSKLTAVLIAVFCWFISYRFIFKSNLSFMPNLPEN 1071
            GS+  ++  +P +Y S+  N+ N  FVK +WGW L +L    +  S  Y   +   ++R +  L V T  WYICT  F  IE+ TG C+ +  +  V     + K  C++   +W GFDISGH F+L      I EE   +LHL Q   +                     +   Y  LN  V           ++W +M   T +YFH+   K+     AV  W+++Y+  + +   F P LP +
Sbjct:   38 GSILKELDVVPQTYFSSSRNLLNLYFVKISWGWNLVLLL-PFLFLSNSYNRTHIYVLKR-LTALVVATAIWYICTETFFYIEDITGTCYGESESVQVVREEFSTKAECRRAGLMWDGFDISGHSFILAYSTFLIVEEMVPMLHLVQHNQK-----------------RTAVLDALYVALNAIV-----------VIWVWMFACTSVYFHETIHKILGTGCAVLGWYLTYKVWYLN--PFSPGLPPH 251          
BLAST of Fat inducing protein 1 vs. Ensembl Nematostella
Match: EDO46451 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RPV6])

HSP 1 Score: 140.198 bits (352), Expect = 8.247e-38
Identity = 85/243 (34.98%), Postives = 129/243 (53.09%), Query Frame = 1
Query:  334 VGSVYFDIFRMPSSYLSNKYNIFNQIFVKWAWGWTLSILFCFIVTTSYIYTGGNTSQMRRQVLRLFVGTIWWYICTGIFQTIENETGACHLKINNKYVYESSIANKRICKQKTGVWLGFDISGHVFLLVLCNMWIFEETKIL-HLWQRLDRFVLXXXXXXXXXXXXXXEIVNIRKSYRKLNINVKXXXXXXXXXXXXWDFMLIVTIIYFHDMPSKLTAVLIAVFCWFISYRFIFKSN-LSFMP 1056
             GS   D   +PSSYLSNK N+FN  FVK  WGWT  +L    +  S+++T GN   M R   RLFV T+ W++   +F+ IE+ TG C          +SS+ +K +C +K  +W GFDISGH FLL+ C + I EE +++ HL                         ++ +  Y+ L   +       + L +LW+ ML++T +YFH +  K+   LIA+F WF +Y +++K N + F+P
Sbjct:    3 AGSFLHDFLPIPSSYLSNKRNVFNVYFVKIGWGWTWGLLTAVTILASWVHTPGNLVSMLRHYSRLFVATLAWFLWVSLFEQIEHWTGVCK--------GQSSLDSKYVCHKKGFLWRGFDISGHCFLLIHCALTISEEIQVVRHL------------------------TMSGKYWYKILRPLIVTAFICTAALLVLWEAMLVLTCLYFHTVYQKILGALIAIFTWFGTYHYLYKENVIPFIP 213          
BLAST of Fat inducing protein 1 vs. Ensembl Medaka
Match: fitm2 (fat storage inducing transmembrane protein 2 [Source:NCBI gene;Acc:101174916])

HSP 1 Score: 102.834 bits (255), Expect = 4.954e-24
Identity = 78/253 (30.83%), Postives = 118/253 (46.64%), Query Frame = 1
Query:  313 IYLCVVSVGSVYFDIFRMPSSYLSNKYNIFNQIFVKWAWGWTLSILFCFIVTTSYIYTGGNTSQMRRQVLRLFVGTIWWYICTGIFQTIENETGACHLKINNKYVYESSIANKRICKQKTGVWLGFDISGHVFLLVLCNMWIFEETKILHLWQRLDRFVLXXXXXXXXXXXXXXEIVNIRKSYRKLNINVKXXXXXXXXXXXXWDFMLIVTIIYFHDMPSKLTAVLIAVFCWFISYRFIFKSNLSFMPNLPEN 1071
            ++L +  VGSV  D+  +P +Y S+  NIFN  FVK +WGWTL +L    +  S      + S + R++L L V T  WY+CT  F  IE+ TG+C  +     + + S  +K  C++    W G+DISGH F+L    + I EET  + L +      L  +                   Y  LN+ V           ++W +M   T +YFHD   KL   +  +  WF++YR  + +  S  P LP  
Sbjct:   27 LFLLISIVGSVLKDLELVPQTYFSSSKNIFNVYFVKISWGWTLLLLT-PFLLLSNASVSRSVSILGRRLLSLAVATAVWYVCTESFFYIEDATGSC-FESGASSLLKKSFTSKASCRRAGFHWHGYDISGHSFILAYSTLLIMEETAPMALVRTARLSALPGTVLALL--------------YVALNLIV-----------VMWVWMFACTSVYFHDTSHKLLGTICGLLGWFLTYRVWYLTPCS--PGLPPQ 250          
BLAST of Fat inducing protein 1 vs. Planmine SMEST
Match: SMESG000054987.1 (SMESG000054987.1)

HSP 1 Score: 584.719 bits (1506), Expect = 0.000e+0
Identity = 313/314 (99.68%), Postives = 313/314 (99.68%), Query Frame = 1
Query:  130 MEPLKKFSFSNSNKTNPATSKSQSAKKKNLPGPMNPLNFMIMAMFKFAKKPLLVDINYRIGIYLCVVSVGSVYFDIFRMPSSYLSNKYNIFNQIFVKWAWGWTLSILFCFIVTTSYIYTGGNTSQMRRQVLRLFVGTIWWYICTGIFQTIENETGACHLKINNKYVYESSIANKRICKQKTGVWLGFDISGHVFLLVLCNMWIFEETKILHLWQRLDRFVLXXXXXXXXXXXXXXEIVNIRKSYRKLNINVKXXXXXXXXXXXXWDFMLIVTIIYFHDMPSKLTAVLIAVFCWFISYRFIFKSNLSFMPNLPEN 1071
            MEPLKKFSFSNSNKTNP TSKSQSAKKKNLPGPMNPLNFMIMAMFKFAKKPLLVDINYRIGIYLCVVSVGSVYFDIFRMPSSYLSNKYNIFNQIFVKWAWGWTLSILFCFIVTTSYIYTGGNTSQMRRQVLRLFVGTIWWYICTGIFQTIENETGACHLKINNKYVYESSIANKRICKQKTGVWLGFDISGHVFLLVLCNMWIFEETKILHLWQRLDRFVLSNSDTVRSTTVTSSEIVNIRKSYRKLNINVKIISGVLSLLSILWDFMLIVTIIYFHDMPSKLTAVLIAVFCWFISYRFIFKSNLSFMPNLPEN
Sbjct:    1 MEPLKKFSFSNSNKTNPVTSKSQSAKKKNLPGPMNPLNFMIMAMFKFAKKPLLVDINYRIGIYLCVVSVGSVYFDIFRMPSSYLSNKYNIFNQIFVKWAWGWTLSILFCFIVTTSYIYTGGNTSQMRRQVLRLFVGTIWWYICTGIFQTIENETGACHLKINNKYVYESSIANKRICKQKTGVWLGFDISGHVFLLVLCNMWIFEETKILHLWQRLDRFVLSNSDTVRSTTVTSSEIVNIRKSYRKLNINVKIISGVLSLLSILWDFMLIVTIIYFHDMPSKLTAVLIAVFCWFISYRFIFKSNLSFMPNLPEN 314          
BLAST of Fat inducing protein 1 vs. Planmine SMEST
Match: SMESG000054987.1 (SMESG000054987.1)

HSP 1 Score: 533.487 bits (1373), Expect = 0.000e+0
Identity = 294/314 (93.63%), Postives = 294/314 (93.63%), Query Frame = 1
Query:  130 MEPLKKFSFSNSNKTNPATSKSQSAKKKNLPGPMNPLNFMIMAMFKFAKKPLLVDINYRIGIYLCVVSVGSVYFDIFRMPSSYLSNKYNIFNQIFVKWAWGWTLSILFCFIVTTSYIYTGGNTSQMRRQVLRLFVGTIWWYICTGIFQTIENETGACHLKINNKYVYESSIANKRICKQKTGVWLGFDISGHVFLLVLCNMWIFEETKILHLWQRLDRFVLXXXXXXXXXXXXXXEIVNIRKSYRKLNINVKXXXXXXXXXXXXWDFMLIVTIIYFHDMPSKLTAVLIAVFCWFISYRFIFKSNLSFMPNLPEN 1071
            MEPLKKFSFSNSNKTNP TSKSQSAKKKNLPGPMNPLNFMIMAMFKFAKKPLLVDINYRIGIYLCVVSVGSVYFDIFRMPSSYLSNKYNIFNQIFVKWAWGWTLSILFCFIVTTSYIYTGGNTSQMRRQ                   TIENETGACHLKINNKYVYESSIANKRICKQKTGVWLGFDISGHVFLLVLCNMWIFEETKILHLWQRLDRFVLSNSDTVRSTTVTSSEIVNIRKSYRKLNINVKIISGVLSLLSILWDFMLIVTIIYFHDMPSKLTAVLIAVFCWFISYRFIFKSNLSFMPNLPEN
Sbjct:    1 MEPLKKFSFSNSNKTNPVTSKSQSAKKKNLPGPMNPLNFMIMAMFKFAKKPLLVDINYRIGIYLCVVSVGSVYFDIFRMPSSYLSNKYNIFNQIFVKWAWGWTLSILFCFIVTTSYIYTGGNTSQMRRQ-------------------TIENETGACHLKINNKYVYESSIANKRICKQKTGVWLGFDISGHVFLLVLCNMWIFEETKILHLWQRLDRFVLSNSDTVRSTTVTSSEIVNIRKSYRKLNINVKIISGVLSLLSILWDFMLIVTIIYFHDMPSKLTAVLIAVFCWFISYRFIFKSNLSFMPNLPEN 295          
BLAST of Fat inducing protein 1 vs. Planmine SMEST
Match: SMESG000054987.1 (SMESG000054987.1)

HSP 1 Score: 291.582 bits (745), Expect = 4.722e-94
Identity = 173/179 (96.65%), Postives = 173/179 (96.65%), Query Frame = 1
Query:  544 WWYIC---TGIFQTIENETGACHLKINNKYVYESSIANKRICKQKTGVWLGFDISGHVFLLVLCNMWIFEETKILHLWQRLDRFVLXXXXXXXXXXXXXXEIVNIRKSYRKLNINVKXXXXXXXXXXXXWDFMLIVTIIYFHDMPSKLTAVLIAVFCWFISYRFIFKSNLSFMPNLPEN 1071
            W YI    T IFQTIENETGACHLKINNKYVYESSIANKRICKQKTGVWLGFDISGHVFLLVLCNMWIFEETKILHLWQRLDRFVLSNSDTVRSTTVTSSEIVNIRKSYRKLNINVKIISGVLSLLSILWDFMLIVTIIYFHDMPSKLTAVLIAVFCWFISYRFIFKSNLSFMPNLPEN
Sbjct:   24 WQYITNAKTSIFQTIENETGACHLKINNKYVYESSIANKRICKQKTGVWLGFDISGHVFLLVLCNMWIFEETKILHLWQRLDRFVLSNSDTVRSTTVTSSEIVNIRKSYRKLNINVKIISGVLSLLSILWDFMLIVTIIYFHDMPSKLTAVLIAVFCWFISYRFIFKSNLSFMPNLPEN 202          

HSP 2 Score: 72.7886 bits (177), Expect = 2.601e-14
Identity = 32/33 (96.97%), Postives = 33/33 (100.00%), Query Frame = 3
Query:  420 MGLGVDTFDIVLFHCYNKLYLYWWQYITNAKTS 518
            MGLG+DTFDIVLFHCYNKLYLYWWQYITNAKTS
Sbjct:    1 MGLGMDTFDIVLFHCYNKLYLYWWQYITNAKTS 33          
The following BLAST results are available for this feature:
BLAST of Fat inducing protein 1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 3
Match NameE-valueIdentityDescription
FITM21.876e-3434.55fat storage inducing transmembrane protein 2 [Sour... [more]
FITM15.761e-1129.23fat storage inducing transmembrane protein 1 [Sour... [more]
FITM15.761e-1129.23fat storage inducing transmembrane protein 1 [Sour... [more]
back to top
BLAST of Fat inducing protein 1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 2
Match NameE-valueIdentityDescription
fitm-21.789e-2124.92FIT family protein fitm-2 [Source:UniProtKB/Swiss... [more]
fitm-21.789e-2124.92FIT family protein fitm-2 [Source:UniProtKB/Swiss... [more]
back to top
BLAST of Fat inducing protein 1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Fitm2.310e-3627.95gene:FBgn0035586 transcript:FBtr0077178[more]
Fitm4.102e-3627.95gene:FBgn0035586 transcript:FBtr0077177[more]
back to top
BLAST of Fat inducing protein 1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
fitm26.806e-2529.18fat storage inducing transmembrane protein 2 [Sour... [more]
fitm26.806e-2529.18fat storage inducing transmembrane protein 2 [Sour... [more]
back to top
BLAST of Fat inducing protein 1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 2
Match NameE-valueIdentityDescription
jagn12.264e-3335.20jagunal homolog 1 [Source:Xenbase;Acc:XB-GENE-5948... [more]
kiaa08956.691e-1331.58KIAA0895 protein [Source:Xenbase;Acc:XB-GENE-58319... [more]
back to top
BLAST of Fat inducing protein 1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Fitm22.040e-3534.15fat storage-inducing transmembrane protein 2 [Sour... [more]
Fitm16.980e-1028.80fat storage-inducing transmembrane protein 1 [Sour... [more]
back to top
BLAST of Fat inducing protein 1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9VRJ2|FITM_DROME2.315e-3527.95Fat storage-inducing transmembrane protein OS=Dros... [more]
sp|P59266|FITM2_MOUSE1.427e-3434.15Fat storage-inducing transmembrane protein 2 OS=Mu... [more]
sp|Q8N6M3|FITM2_HUMAN9.008e-3434.55Fat storage-inducing transmembrane protein 2 OS=Ho... [more]
sp|B2LYG4|FITM2_PIG4.364e-3333.74Fat storage-inducing transmembrane protein 2 OS=Su... [more]
sp|A0JP80|FITM2_XENTR1.350e-3235.20Fat storage-inducing transmembrane protein 2 OS=Xe... [more]
back to top
BLAST of Fat inducing protein 1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A068XZP31.426e-7440.25Fat inducing protein 1 OS=Echinococcus multilocula... [more]
U6JB171.723e-7440.31FIT family protein OS=Echinococcus granulosus OX=6... [more]
A0A0R3X6V51.908e-7441.67Uncharacterized protein OS=Hydatigena taeniaeformi... [more]
A0A0R3WAU54.049e-7439.69Uncharacterized protein OS=Taenia asiatica OX=6051... [more]
A0A0R3UIT11.310e-7239.05Uncharacterized protein OS=Mesocestoides corti OX=... [more]
back to top
BLAST of Fat inducing protein 1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
fitm21.252e-1828.86fat storage inducing transmembrane protein 2 [Sour... [more]
back to top
BLAST of Fat inducing protein 1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Fat inducing protein 1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Fat inducing protein 1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO464518.247e-3834.98Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Fat inducing protein 1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
fitm24.954e-2430.83fat storage inducing transmembrane protein 2 [Sour... [more]
back to top
BLAST of Fat inducing protein 1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 3
Match NameE-valueIdentityDescription
SMESG000054987.10.000e+099.68SMESG000054987.1[more]
SMESG000054987.10.000e+093.63SMESG000054987.1[more]
SMESG000054987.14.722e-9496.65SMESG000054987.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30000043 ID=SMED30000043|Name=Fat inducing protein 1|organism=Schmidtea mediterranea sexual|type=transcript|length=2206bp
CACAGTACGTAATTTTATGTTTAAGCTAAATTTCAATTTAATTTTATTGT
TTTCTAACTATTTGTAAAAATTATTTAGCCAAATTTTATTTCATATTAAT
TAACAAAAATTTTGTTATTTAAACTTTCTATGGAACCTTTAAAAAAGTTT
AGCTTTTCAAATTCTAACAAAACTAATCCGGCTACTTCGAAATCGCAATC
AGCAAAGAAAAAGAATTTACCAGGACCAATGAATCCTCTTAACTTTATGA
TAATGGCCATGTTTAAATTTGCTAAAAAACCGTTACTAGTTGATATTAAT
TACAGAATAGGCATTTATTTATGCGTTGTGTCAGTTGGGTCAGTATATTT
TGATATTTTCAGAATGCCGTCAAGTTATCTTTCTAATAAATATAACATTT
TCAATCAAATTTTTGTAAAATGGGCTTGGGGGTGGACACTTTCGATATTG
TTTTGTTTCATTGTTACAACAAGTTATATTTATACTGGTGGCAATACATC
ACAAATGCGAAGACAAGTACTTCGGTTATTTGTAGGAACAATATGGTGGT
ATATATGTACAGGTATTTTCCAGACAATCGAAAATGAAACTGGTGCATGC
CATTTGAAAATAAACAACAAATACGTATACGAGTCATCAATTGCCAATAA
AAGAATTTGTAAACAAAAAACTGGTGTTTGGCTGGGTTTCGACATTTCTG
GACATGTATTTCTGTTGGTTTTATGCAATATGTGGATTTTTGAAGAAACT
AAGATTCTTCATTTGTGGCAACGGCTTGATCGGTTTGTGTTATCAAATAG
CGATACAGTGAGATCAACCACAGTAACAAGCAGCGAAATAGTCAATATTA
GAAAATCATATCGCAAGCTCAATATCAACGTTAAAATTATATCCGGAGTT
TTGAGCTTGTTATCTATTTTATGGGATTTTATGCTTATAGTGACTATTAT
CTATTTTCATGATATGCCGTCGAAATTGACTGCTGTTTTAATTGCTGTTT
TCTGTTGGTTTATTTCATATAGATTTATATTCAAATCCAACTTGAGCTTT
ATGCCGAATTTACCAGAAAATCTTTTGATGATCTTTTAGCGTTAATTTTT
AGTTTTTTTTATTATTTTATTGCATGCAAAATTTTTATTGATTTGCGATT
GTCGGTGGAGTTCAATTGTGATGCTCTCATTTAGTCATGCCGATTTATCA
ATTATAGGAGGAAATTATTATTTTTTTTAATACAAACTAATTTCCAAGCA
TTTTATTTTGGTTATTGATTTTTGGTAAATTTTCCGAAGCCGGAATAATG
ATTTATTTGTGGATTTTTGTTACCTCGTATGACGTCATTATTTATTGATT
TGTGCCATTATTTGTCTGCAGAATTACTTTTTATATTTGTTGGAACGCTA
AGCAACAAAACTCATCAATCAGGAAGTGTTATATATGTAACTTATATTAA
CTGTTAAAAAATTGTAATTCTATAATCGTGGTCTAAAAGCCCACCTTAAT
GACGTCCAACAGTAAAAGCCGTTTTGACTCGTTGTCCCCTTTGTCCTTTT
ACGCTCCTTTTCATGAGTCTCATATGTTCTCTTTGTAAATTCCGCACTTA
GGGTAAGTCTTTACTGAAGAAAAAACAATAAATAGGGAATCGCTTCGCAT
TCTGATTTTAAATCATTCAATTATTTTCAAGTCATTTATGCTCTTGTTGG
TGTGAAGCTATAAGCAGGGCTCAATCAAGTATATGTTGCTTTTTCTAGTT
GATGGTATTCCGATATGATAGTTGATATTTATCTGCAAGATTGGGTAATC
GACGTGATTGCTGGTATTTTTAGATATTAGCTTTATAATGTCTTCGGAGA
ACTACAGAATATTAATCTCCTTTGTATTAATAATGACGTTATCTTGACCA
TCCTTTTATAAATCCAGTGAGTAAGGGTTAAAATGATAATTAATAAGAGC
ATCAATAAATGTGTTTAAAAAATCGGCTATAGGTAATTCACTATCTATTA
AGGACGTCCAAAAAACAAGCAATTTTTGATCTCTGGACATTTCTTATTTT
ACAAAACCTACGCAAAGGATGTAAAAAAATTTCAGCTAAAAATTCCTGTA
CCAAAATATTATTATGTACATGTTAAGGGAAATGAGTTTTCAATGACAGT
GGTTCTTCACTTTACGATCGGTACCCATTTGCGGCGAAAATTAAGTTTTA
GCACCG
back to top

protein sequence of SMED30000043-orf-1

>SMED30000043-orf-1 ID=SMED30000043-orf-1|Name=SMED30000043-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=320bp
MEPLKKFSFSNSNKTNPATSKSQSAKKKNLPGPMNPLNFMIMAMFKFAKK
PLLVDINYRIGIYLCVVSVGSVYFDIFRMPSSYLSNKYNIFNQIFVKWAW
GWTLSILFCFIVTTSYIYTGGNTSQMRRQVLRLFVGTIWWYICTGIFQTI
ENETGACHLKINNKYVYESSIANKRICKQKTGVWLGFDISGHVFLLVLCN
MWIFEETKILHLWQRLDRFVLSNSDTVRSTTVTSSEIVNIRKSYRKLNIN
VKIISGVLSLLSILWDFMLIVTIIYFHDMPSKLTAVLIAVFCWFISYRFI
FKSNLSFMPNLPENLLMIF*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000101muscle cell
PLANA:0000142posterior region of the whole animal
PLANA:0002032epidermal cell
PLANA:0003001lateral region of the whole animal
Vocabulary: INTERPRO
TermDefinition
IPR019388FIT
Vocabulary: biological process
TermDefinition
GO:0019915lipid storage
GO:0007010cytoskeleton organization
GO:0008654phospholipid biosynthetic process
GO:0010866regulation of triglyceride biosynthetic process
GO:0010890positive regulation of sequestering of triglyceride
GO:0022604regulation of cell morphogenesis
GO:0030730sequestering of triglyceride
GO:0034389lipid particle organization
GO:0035356cellular triglyceride homeostasis
Vocabulary: cellular component
TermDefinition
GO:0005789endoplasmic reticulum membrane
GO:0005739mitochondrion
GO:0005783endoplasmic reticulum
GO:0016020membrane
GO:0016021integral component of membrane
GO:0030176integral component of endoplasmic reticulum membrane
Vocabulary: molecular function
TermDefinition
GO:0003674molecular_function
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR019388Fat storage-inducing transmembrane proteinPFAMPF10261Scs3pcoord: 82..297
e-value: 3.0E-31
score: 108.8
IPR019388Fat storage-inducing transmembrane proteinPANTHERPTHR23129UNCHARACTERIZEDcoord: 12..315
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1..28
NoneNo IPR availableTMHMMTMhelixcoord: 254..276
NoneNo IPR availableTMHMMTMhelixcoord: 182..204
NoneNo IPR availableTMHMMTMhelixcoord: 98..120
NoneNo IPR availableTMHMMTMhelixcoord: 56..78
NoneNo IPR availableTMHMMTMhelixcoord: 283..301