Transcription factor tau subunit sfc6 isoform 1

Overview
NameTranscription factor tau subunit sfc6 isoform 1
Smed IDSMED30000041
Length (bp)6049
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Transcription factor tau subunit sfc6 isoform 1 (SMED30000041) t-SNE clustered cells

Violin plots show distribution of expression levels for Transcription factor tau subunit sfc6 isoform 1 (SMED30000041) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Transcription factor tau subunit sfc6 isoform 1 (SMED30000041) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Transcription factor tau subunit sfc6 isoform 1 (SMED30000041) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30000041

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
nervous systemSMED30000041h1SMcG0011580 dd_Smed_v4_11007_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30000041h1SMcG0011580 dd_Smed_v4_11007_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30000041h1SMcG0011580 dd_Smed_v4_11007_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30000041h1SMcG0011580 dd_Smed_v4_11007_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Transcription factor tau subunit sfc6 isoform 1 vs. TrEMBL
Match: A0A0X3Q0Z3 (Uncharacterized protein OS=Schistocephalus solidus OX=70667 GN=TR121635 PE=4 SV=1)

HSP 1 Score: 114.775 bits (286), Expect = 7.140e-22
Identity = 117/476 (24.58%), Postives = 191/476 (40.13%), Query Frame = 3
Query:  702 VDQHGIFINSGSYIKKMSWAPI---NAELHTDQ--YLAVSVYKAPTDRSNFYESGISPNQIIQIYNCGPLTM-KTKSAARAQLEMILTHDWGKITDMAWSPQPLPAVGRRSDNL---------------------LIGHLALCCTDGFIRIVPIGKPSVANCLLKLDSNH------------------------PVICLGAIRNKQNKEVFPVTMHWRQEFPDRIVAGYNTGHVGTFVLEACVFLSVARIIGVNIYLKPAVFHRVFHSPFRSIQISPFNWQLVSCSSMTMSNAVVVDLGQPSDMILPSPIDMEAT----IGSKIIWPIPGDVVVLAAGKYLH---------------NKPGVL------------LCSAQKPAKRSRKLPLPDVSSIDLCVSLNILPIGTRSGQLRILSLNTNYVNSLLKSRSYSFKACREIPITSKFYLQYRLMQIDSNKNRK-PLIKSENGTPT 1880
            VD     + +G Y+K +SW+P    +A++  DQ  +LAVS +++  DR  + +   S   +IQI+ C  L++ K  S    +  + L HDWG + DM W P P+   GR+                         ++GHL + CTDG +RI+PI + +  + L    +NH                         V+ L       +   +PV +  R +FP ++  GYN+GH+  F L AC+    A+    +  L+P    ++   P  S+ + P    ++    +   +  V DL  P+ + L  P  + AT    IG  ++WP     V +   +Y+                 +P  L            +CS    +    ++ L   SS+D   SL  L +G  SG+++  S   N         SY         I  + YLQ  L  I     RK P  +S +G P 
Sbjct:   49 VDMVRNLMFAGGYVKCLSWSPCYISDADVQEDQPSFLAVSTFRSAADRPKYSDLMQSGPGVIQIWRCSGLSLCKRNSTPELRPYLFLAHDWGTLMDMQWLPLPVKMAGRQDRRCRLPPDLTYSRHPDEVAKAVASMLGHLIIACTDGLVRILPIPQTAALDALALKYANHVDRDRKFEPSSSRSFLPLFTFKPDSVLLLAPATRVPSWLGWPVCLAIRNDFPHQLAVGYNSGHLAVFNL-ACLHPFYAKY--SDNLLRPVFLAQLLPGPIVSLALHPLQNNVIIGLGLD-RDVHVWDLHDPACVHLSVPEMIWATPRSGIGGIVVWPRSTTTVWIGREEYITPFGALRRIPTELGSLKQPADLPTNLRSYTTAYPVCSPIDFSYWGMEMGLQPTSSMDFSDSLAYLVLGDGSGRIQFFSHPLN---------SYKLGY-----IKRRLYLQNHLSWIYQWSLRKLPPERSSSGPPV 506          
BLAST of Transcription factor tau subunit sfc6 isoform 1 vs. TrEMBL
Match: A0A0X3QCA4 (General transcription factor 3C polypeptide 2 OS=Schistocephalus solidus OX=70667 GN=TF3C2 PE=4 SV=1)

HSP 1 Score: 114.775 bits (286), Expect = 1.069e-21
Identity = 107/435 (24.60%), Postives = 179/435 (41.15%), Query Frame = 3
Query:  702 VDQHGIFINSGSYIKKMSWAPI---NAELHTDQ--YLAVSVYKAPTDRSNFYESGISPNQIIQIYNCGPLTM-KTKSAARAQLEMILTHDWGKITDMAWSPQPLPAVGRRSDNL---------------------LIGHLALCCTDGFIRIVPIGKPSVANCLLKLDSNH------------------------PVICLGAIRNKQNKEVFPVTMHWRQEFPDRIVAGYNTGHVGTFVLEACVFLSVARIIGVNIYLKPAVFHRVFHSPFRSIQISPFNWQLVSCSSMTMSNAVVVDLGQPSDMILPSPIDMEAT----IGSKIIWPIPGDVVVLAAGKYLH---------------NKPGVL------------LCSAQKPAKRSRKLPLPDVSSIDLCVSLNILPIGTRSGQLRILSLNTN-YVNSLLKSRSY 1757
            VD     + +G Y+K +SW+P    +A++  DQ  +LAVS +++  DR  + +   S   +IQI+ C  L++ K  S    +  + L HDWG + DM W P P+   GR+                         ++GHL + CTDG +RI+PI + +  + L    +NH                         V+ L       +   +PV +  R +FP ++  GYN+GH+  F L AC+    A+    +  L+P    ++   P  S+ + P    ++    +   +  V DL  P+ + L  P  + AT    IG  ++WP     V +   +Y+                 +P  L            +CS    +    ++ L   SS+D   SL  L +G  SG+++  S   N Y    +K R Y
Sbjct:  216 VDMVRNLMFAGGYVKCLSWSPCYISDADVQEDQPSFLAVSTFRSAADRPKYSDLMQSGPGVIQIWRCSGLSLCKRNSTPELRPYLFLAHDWGTLMDMQWLPLPVKMAGRQDRRCRLPPDLTYSRHPDEVAKAVASMLGHLIIACTDGLVRILPIPQTAALDALALKYANHVDRDRKFEPSSSRSFLPLFTFKPDSVLLLAPATRVPSWLGWPVCLAIRNDFPHQLAVGYNSGHLAVFNL-ACLHPFYAKY--SDNLLRPVFLAQLLPGPIVSLALHPLQNNVIIGLGLD-RDVHVWDLHDPACVHLSVPEMIWATPRSGIGGIVVWPRSTTTVWIGREEYITPFGALRRIPTELGSLKQPADLPTNLRSYTTAYPVCSPIDFSYWGMEMGLQPTSSMDFSDSLAYLVLGDGSGRIQFFSHPLNSYKLGYIKRRLY 646          
BLAST of Transcription factor tau subunit sfc6 isoform 1 vs. TrEMBL
Match: A0A0X3Q4N0 (General transcription factor 3C polypeptide 2 OS=Schistocephalus solidus OX=70667 GN=TF3C2 PE=4 SV=1)

HSP 1 Score: 113.62 bits (283), Expect = 2.852e-21
Identity = 107/435 (24.60%), Postives = 179/435 (41.15%), Query Frame = 3
Query:  702 VDQHGIFINSGSYIKKMSWAPI---NAELHTDQ--YLAVSVYKAPTDRSNFYESGISPNQIIQIYNCGPLTM-KTKSAARAQLEMILTHDWGKITDMAWSPQPLPAVGRRSDNL---------------------LIGHLALCCTDGFIRIVPIGKPSVANCLLKLDSNH------------------------PVICLGAIRNKQNKEVFPVTMHWRQEFPDRIVAGYNTGHVGTFVLEACVFLSVARIIGVNIYLKPAVFHRVFHSPFRSIQISPFNWQLVSCSSMTMSNAVVVDLGQPSDMILPSPIDMEAT----IGSKIIWPIPGDVVVLAAGKYLH---------------NKPGVL------------LCSAQKPAKRSRKLPLPDVSSIDLCVSLNILPIGTRSGQLRILSLNTN-YVNSLLKSRSY 1757
            VD     + +G Y+K +SW+P    +A++  DQ  +LAVS +++  DR  + +   S   +IQI+ C  L++ K  S    +  + L HDWG + DM W P P+   GR+                         ++GHL + CTDG +RI+PI + +  + L    +NH                         V+ L       +   +PV +  R +FP ++  GYN+GH+  F L AC+    A+    +  L+P    ++   P  S+ + P    ++    +   +  V DL  P+ + L  P  + AT    IG  ++WP     V +   +Y+                 +P  L            +CS    +    ++ L   SS+D   SL  L +G  SG+++  S   N Y    +K R Y
Sbjct:  216 VDMVRNLMFAGGYVKCLSWSPCYISDADVQEDQPSFLAVSTFRSAADRPKYSDLMQSGPGVIQIWRCSGLSLCKRNSTPELRPYLFLAHDWGTLMDMQWLPLPVKMAGRQDRRCRLPPDLTYSRHPDEVAKAVASMLGHLIIACTDGLVRILPIPQTAALDALALKYANHVDRDRKFEPSSSRSFLPLFTFKPDSVLLLAPATRVPSWLGWPVCLAIRNDFPHQLAVGYNSGHLAVFNL-ACLHPFYAKY--SDNLLRPVFLAQLLPGPIVSLALHPLQNNVIIGLGLD-RDVHVWDLHDPACVHLSVPEMIWATPRSGIGGIVVWPRSTTTVWIGREEYITPFGALRRIPTELGSLKQPADLPTNLRSYTTAYPVCSPIDFSYWGMEMGLQPTSSMDFSDSLAYLVLGDGSGRIQFFSHPLNSYKLGYIKRRLY 646          
BLAST of Transcription factor tau subunit sfc6 isoform 1 vs. TrEMBL
Match: A0A0X3P9W1 (Uncharacterized protein OS=Schistocephalus solidus OX=70667 GN=TR121635 PE=4 SV=1)

HSP 1 Score: 113.235 bits (282), Expect = 3.114e-21
Identity = 117/475 (24.63%), Postives = 191/475 (40.21%), Query Frame = 3
Query:  702 VDQHGIFINSGSYIKKMSWAPI---NAELHTDQ--YLAVSVYKAPTDRSNFYESGISPNQIIQIYNCGPLTM-KTKSAARAQLEMILTHDWGKITDMAWSPQPLPAVGRRSDNL---------------------LIGHLALCCTDGFIRIVPIGKPSVANCLLKLDSNH------------------------PVICLGAIRNKQNKEVFPVTMHWRQEFPDRIVAGYNTGHVGTFVLEACVFLSVARIIGVNIYLKPAVFHRVFHSPFRSIQISPFNWQLVSCSSMTMSNAVVVDLGQPSDMILPSPIDMEAT----IGSKIIWPIPGDVVVLAAGKYLH---------------NKPGVL------------LCSAQKPAKRSRKLPLPDVSSIDLCVSLNILPIGTRSGQLRILSLNTNYVNSLLKSRSYSFKACREIPITSKFYLQYRLMQIDSNKNRK-PLIKSENGTP 1877
            VD     + +G Y+K +SW+P    +A++  DQ  +LAVS +++  DR  + +   S   +IQI+ C  L++ K  S    +  + L HDWG + DM W P P+   GR+                         ++GHL + CTDG +RI+PI + +  + L    +NH                         V+ L       +   +PV +  R +FP ++  GYN+GH+  F L AC+    A+    +  L+P    ++   P  S+ + P    ++    +   +  V DL  P+ + L  P  + AT    IG  ++WP     V +   +Y+                 +P  L            +CS    +    ++ L   SS+D   SL  L +G  SG+++  S   N         SY         I  + YLQ  L  I     RK P  +S +G P
Sbjct:   49 VDMVRNLMFAGGYVKCLSWSPCYISDADVQEDQPSFLAVSTFRSAADRPKYSDLMQSGPGVIQIWRCSGLSLCKRNSTPELRPYLFLAHDWGTLMDMQWLPLPVKMAGRQDRRCRLPPDLTYSRHPDEVAKAVASMLGHLIIACTDGLVRILPIPQTAALDALALKYANHVDRDRKFEPSSSRSFLPLFTFKPDSVLLLAPATRVPSWLGWPVCLAIRNDFPHQLAVGYNSGHLAVFNL-ACLHPFYAKY--SDNLLRPVFLAQLLPGPIVSLALHPLQNNVIIGLGLD-RDVHVWDLHDPACVHLSVPEMIWATPRSGIGGIVVWPRSTTTVWIGREEYITPFGALRRIPTELGSLKQPADLPTNLRSYTTAYPVCSPIDFSYWGMEMGLQPTSSMDFSDSLAYLVLGDGSGRIQFFSHPLN---------SYKLGY-----IKRRLYLQNHLSWIYQWSLRKLPPERSSSGPP 505          
BLAST of Transcription factor tau subunit sfc6 isoform 1 vs. TrEMBL
Match: A0A158RA73 (Uncharacterized protein OS=Taenia asiatica OX=60517 GN=TASK_LOCUS8595 PE=4 SV=1)

HSP 1 Score: 107.842 bits (268), Expect = 1.501e-19
Identity = 130/574 (22.65%), Postives = 226/574 (39.37%), Query Frame = 3
Query:  723 INSGSYIKKMSWAP--INAE----LHTDQYLAVSVYKAPTDRSNFYESGISPNQIIQIYNCGPLTMKT-KSAARAQLEMILTHDWGKITDMAWSPQPLPAVGRRSD----------------------NLLIGHLALCCTDGFIRIVPIGKPSVANCLLKLDSNHPVICLGAIRNKQNKEVF----------------PVTMHW------RQEFPDRIVAGYNTGHVGTFVLEACVFLSVARIIGVNIYLKPAVFHRVFHSPFRSIQISPFNWQLVSCSSMTMSNAV-VVDLGQPSDMILPSP----IDMEATIGSKIIWPIPGDVVVLAAGKYL-----HNKPG--VLLCSAQKPAK-----RSRKLPLPDVSSID-------------LCV----SLNILPIGTRSGQLRILS--LNTNYV----------------NSLLKSRSYSFKACREIPITSKFYLQYRLMQIDSNKNRKPLIKSENGTPTVSSYNSCCSCPPKLQCVHKLSLKFSISVSKTPVDDRNNWQLDSMLNINEIATNPNPRCSTWIAVSLECGVIHIVPLTHFYRSELD 2135
            + +G Y+K +SW+P  I+ E         YLA++ +     R N  +   S + +I +++C  L +   +S  + +    L HDWG + D+ W P P+     RSD                        ++GHL + CTDGF+RI  +  P+V N    L     V+    I +   K V+                P  + W      R +FP R+V GY +GH+G + L     L+       +  L+P +   +   PF SI + P    +V    + +   V V DL  P  +    P      +    G  ++WP   D + +   +YL      N PG  V L S +KP+      R+  +  P VS +D              C+    SL  L  G  +GQ+   S  L+   V                  +++ R+ + +   E   T  F  ++  +++  N   +P  +       +   +    C  K++   +   +  + + K+  D  N     +  +I+++A +PNP  ++WIAV    GV+ ++    FY   +D
Sbjct:  174 LYTGGYVKCLSWSPPYIDEEGVSLSFVPGYLAIASHPNIGTRVNLSDPITSDSGLIHVWSCVDLALTAEQSCPQLKPHFFLAHDWGHVMDLRWLPVPV-HCANRSDGCEIARPMLPVDMTPKQIAQLIGAVVGHLIVACTDGFVRIFLV--PAVDN-RFNLPEEFKVVLPTKICDGVPKNVYQFKPKTVLRLAPSTDIPSWLGWPNVLAIRSDFPHRLVVGYTSGHLGLYNLST---LNAHFAKLNDCLLRPIILTHLIPGPFTSIALHPLYEGIV--VGLGLDREVNVWDLADPECVQYGLPELSWPTLRMGWGGHVVWPRASDSIWVGREEYLFPFTKKNTPGGAVTLASLKKPSDVPARMRAYTVCFPTVSPVDCSRYCFDRGFEATTCLDYSDSLGFLIQGDANGQINFHSWVLDPRRVMREKSRIAIQKKHRTYQWIMRKRTNTRECGNEASATRGFIGEHTALKL--NVLEEPFEEEIRWGCDICGESGQVLCWHKVEKYFEFVFREGVGLQKSKYDFVNA----TFSSISKVAVSPNPGSASWIAVGTGFGVVQLLCHEQFYHPGMD 732          
BLAST of Transcription factor tau subunit sfc6 isoform 1 vs. Ensembl Medaka
Match: gtf3c2 (general transcription factor IIIC subunit 2 [Source:NCBI gene;Acc:101167505])

HSP 1 Score: 54.299 bits (129), Expect = 1.607e-6
Identity = 54/228 (23.68%), Postives = 97/228 (42.54%), Query Frame = 3
Query:  717 IFINSGSYIKKMSWAPINAELHTDQYLAVSVYKAPTDRSNFYESGISPNQIIQIYNCGPLTMKTKSAARAQLEMILTHDWGKITDMAWSP----QPLPAVGRRSDNL-LIGHLALCCTDGFIRIVPIGKPS---VANCLLKLDSNHPVIC---------LGAIRNKQNKEVFPVTMHWRQEFPDRIVA-GYNTGHVGTFVLEACVFLSVARIIGVNIYLKPAVFHRVF 1346
            + + +G  +  + W P        QY+AV+ +    D      +   P  ++Q+++CG L    +  +   L   L  D G I  + W P    +P P+  R++  L  +G LA+  + G + I  +  P     +N L   ++N P I          LGAI+  +++    +++ W  + P  ++A G+  G VG + L     L   R    ++ L P   HR F
Sbjct:  401 MVLFTGGPVWALEWCPTPDGAPCRQYVAVASHAGMDDLHPVTRTSSGPG-LVQLWDCGELEYNCRPDSPPALVYGLAQDKGFIWGLKWCPSGAWEP-PSSNRKASVLPRLGLLAVASSSGVVSIYSLPHPDALLASNRLTSSENNRPPIFKADAVVTLKLGAIKAPRHESGLVLSLDWLPQKPHDVMAVGFYDGVVGLWDLTTKAALLRVREADRSLSLLP---HRCF 623          
BLAST of Transcription factor tau subunit sfc6 isoform 1 vs. Ensembl Medaka
Match: gtf3c2 (general transcription factor IIIC subunit 2 [Source:NCBI gene;Acc:101167505])

HSP 1 Score: 53.5286 bits (127), Expect = 2.992e-6
Identity = 53/227 (23.35%), Postives = 95/227 (41.85%), Query Frame = 3
Query:  717 IFINSGSYIKKMSWAPINAELHTDQYLAVSVYKAPTDRSNFYESGISPNQIIQIYNCGPLTMKTKSAARAQLEMILTHDWGKITDMAWSPQPL---PAVGRRSDNL-LIGHLALCCTDGFIRIVPIGKPS---VANCLLKLDSNHPVIC---------LGAIRNKQNKEVFPVTMHWRQEFPDRIVA-GYNTGHVGTFVLEACVFLSVARIIGVNIYLKPAVFHRVF 1346
            + + +G  +  + W P        QY+AV+ +    D      +   P  ++Q+++CG L    +  +   L   L  D G I  + W P      P+  R++  L  +G LA+  + G + I  +  P     +N L   ++N P I          LGAI+  +++    +++ W  + P  ++A G+  G VG + L     L   R    ++ L P   HR F
Sbjct:  401 MVLFTGGPVWALEWCPTPDGAPCRQYVAVASHAGMDDLHPVTRTSSGPG-LVQLWDCGELEYNCRPDSPPALVYGLAQDKGFIWGLKWCPSGAWEPPSSNRKASVLPRLGLLAVASSSGVVSIYSLPHPDALLASNRLTSSENNRPPIFKADAVVTLKLGAIKAPRHESGLVLSLDWLPQKPHDVMAVGFYDGVVGLWDLTTKAALLRVREADRSLSLLP---HRCF 623          
BLAST of Transcription factor tau subunit sfc6 isoform 1 vs. Planmine SMEST
Match: SMESG000063031.1 (SMESG000063031.1)

HSP 1 Score: 2234.14 bits (5788), Expect = 0.000e+0
Identity = 1156/1310 (88.24%), Postives = 1185/1310 (90.46%), Query Frame = 3
Query:   93 MRNKRLAAIQCIKNIHNSYKYNSQESSSVGDKSQYGILEDSSTNTDTISLKDDIENVIEEIPDLIIEKFNSVHESDNFPKSNRKYFSIENAALFWRAKNQNSNNGLSLLEWSFKKNLNYFNELSQSDYWADKILTDIDIELEIFQYLKEAFFPNRGYLVDISKTDKKREILGSLGKISILKDENELIHEVLLPCNSTPVLNPVVDQHGIFINSGSYIKKMSWAPINAELHTDQYLAVSVYKAPTDRSNFYESGISPNQIIQIYNCGPLTMKTKSAARAQLEMILTHDWGKITDMAWSPQPLPAVGRRSDNLLIGHLALCCTDGFIRIVPIGKPSVANCLLKLDSNHPVICLGAIRNKQNKEVFPVTMHWRQEFPDRIVAGYNTGHVGTFVLEACVFLSVARIIGVNIYLKPAVFHRVFHSPFRSIQISPFNWQLVSCSSMTMSNAVVVDLGQPSDMILPSPIDMEATIGSKIIWPIPGDVVVLAAGKYLHNKPGVLLCSAQKPAKRSRKLPLPDVSSIDLCVSLNILPIGTRSGQLRILSLNTNYVNSLLKSRSYSFKACREIPITSKFYLQYRLMQIDSNKNRKPLIKSENGTPTVSSYNSCCSCPPKLQCVHKLSLKFSISVSKTPVDDRNNWQLDSMLNINEIATNPNPRCSTWIAVSLECGVIHIVPLTHFYRSELDQISTGSCCNDLNESSNQLIDESLLPKNIVYAPKFGRPRKCPRSFTYQNLYQKKIALKSIGRSIKSEEVSANSSRNLSKPLSGIRDFSLRSKSTLITDYFVNSSAGNIGLNTFQCSTPKRQKLITNLSTPKVNNPSKSKSAKIAIQRTLRSNSNSTPIQNSESITVPFSDVKMSLVASTRQRLRSFTGFNVDSDALVKGNELIETRSPSFETVDFGSSSLEKDADPHRKLQSSQKPLNTTSVGDNSINKLTNEISDMRKRTRSFNQLDKFMXXXXXXXXXXXXXXXXXVETSINIDPGKKRNRSISFESSDLNISIDNTSIIKPMRDRLRSFDRPNISLVTRSDINPIIDNKSIAGSMRQRKLSIDLSDESVEKFXXXXE------------KPPKTXXXXXXXXXXXXXXXXXRKQTRSHSKSDN-MGNSSKSHMKTFAIIDLEIKANQSISCKSSDLNKIIDANKSIIEPMRKRTRSINQSDNIMTNCSKSLAKSNNYNKVPVKTSIKTDQGKPRNRSISCESSELNTSI----IEQPM--RLRSFD-----VYHNSDI-PDIALTCLGTSITIHEDPVKLSDN-----NNNNIKSLQKRKKSMS-NEHSQLNSSTEPLRKRLRSSEK 3929
            MRNKRLAAIQCIKNIHNSYKYNSQESSSVGDKSQYGILEDSSTNTDTISLKDDIENVIEEIPDLI EKFNSVHESDNFPKSNRKYFSIENAALFWRAKNQNSNNGLSLLEWSFKKNLNYFNELSQSDYWADKILTDIDIELEIFQYLKEAFFPNRGYLVDISKTDKKREILGSLGKISILKDENELIHEVLLPC+STPVLNPVVDQHGIFINSGSYIKKMSWAPINAELHTDQYLAVSVYKAPTDRSNFYESGISPNQIIQIYNCGPLTMKTKSAARAQLEMILTHDWGKITDMAWSPQPLPAVGR SDNLLIGHLALCCTDGFIRIVPIGKPS+ANCLLKLDSNHPVICLGAIRNKQNKEVFPVTMHWRQEFPDRIVAGYNTGHVGTFVLEACVF SVARIIGVNIYLKPAVFHRVFHSPFRSIQISPFNWQLVSCSSMTMSNAVVVDLGQPSDMILPSPIDMEATIGSKIIWPIPGDVVVLAAGKYLHNKPGVLLCSAQKPAKRSRKLPLPDVSSIDLCVSLNILPIGTRSGQLRILSLNTNYVNSLLKSRSYSFKACREIPITSKFYLQYRLMQIDSN+NRKPLIKSENGTPTVSSYNSCCSCPPKLQCVHKLSLKFSISVSKTPVDDRNNWQLDSMLNINEIATNPNPRCSTWIAVSLECGVIHIVPLTHFYRSELDQISTGSCCNDLNESSNQLIDESLLPKNIVYAPKFGRPRKCPRSFTYQNLYQKKIALKSIGRSIKSEEVSANSSRNL+KPLSGIRDFSLRSKSTLITDYFVNSSAGNIGLNTFQCSTPKRQKLITNLS PKVNNPSKSKSAKIAIQRTLRSNSNSTPIQNSESITVPFSDV M LVASTRQRLRSFTGFNVDSDALVKGNELIETRSPSFETVDFGSSSLEKDADPHRKLQSSQKPLNTTSVGDNSINKLTNEISDMRKRTRSFNQLDKFMNNHSKSPGKSNNNNGNPVETSINIDPGKKRNRS SFESSDLNIS+DN SIIKPMR+RLRS DRPNIS VTRSDINPIIDNKSIAGSMRQR LS D S ESVEKFNNN +            K      S    S    S DSIR +TRSH+KSDN MGN SKS MKTFAIIDLE+K NQSISCK+SDLNK I+ NKSI E  R+ + SI+QSD       KS  K NN N  PV+TSI  D GK RNRSIS ESS+LN SI    I +PM  RLRSFD     +   SDI P I    +  S+   +  + LSD      NNNN K     K S+S ++ S  N S + +RK+ RS  K
Sbjct:    1 MRNKRLAAIQCIKNIHNSYKYNSQESSSVGDKSQYGILEDSSTNTDTISLKDDIENVIEEIPDLIFEKFNSVHESDNFPKSNRKYFSIENAALFWRAKNQNSNNGLSLLEWSFKKNLNYFNELSQSDYWADKILTDIDIELEIFQYLKEAFFPNRGYLVDISKTDKKREILGSLGKISILKDENELIHEVLLPCDSTPVLNPVVDQHGIFINSGSYIKKMSWAPINAELHTDQYLAVSVYKAPTDRSNFYESGISPNQIIQIYNCGPLTMKTKSAARAQLEMILTHDWGKITDMAWSPQPLPAVGRLSDNLLIGHLALCCTDGFIRIVPIGKPSMANCLLKLDSNHPVICLGAIRNKQNKEVFPVTMHWRQEFPDRIVAGYNTGHVGTFVLEACVFSSVARIIGVNIYLKPAVFHRVFHSPFRSIQISPFNWQLVSCSSMTMSNAVVVDLGQPSDMILPSPIDMEATIGSKIIWPIPGDVVVLAAGKYLHNKPGVLLCSAQKPAKRSRKLPLPDVSSIDLCVSLNILPIGTRSGQLRILSLNTNYVNSLLKSRSYSFKACREIPITSKFYLQYRLMQIDSNENRKPLIKSENGTPTVSSYNSCCSCPPKLQCVHKLSLKFSISVSKTPVDDRNNWQLDSMLNINEIATNPNPRCSTWIAVSLECGVIHIVPLTHFYRSELDQISTGSCCNDLNESSNQLIDESLLPKNIVYAPKFGRPRKCPRSFTYQNLYQKKIALKSIGRSIKSEEVSANSSRNLNKPLSGIRDFSLRSKSTLITDYFVNSSAGNIGLNTFQCSTPKRQKLITNLSPPKVNNPSKSKSAKIAIQRTLRSNSNSTPIQNSESITVPFSDVNMPLVASTRQRLRSFTGFNVDSDALVKGNELIETRSPSFETVDFGSSSLEKDADPHRKLQSSQKPLNTTSVGDNSINKLTNEISDMRKRTRSFNQLDKFMNNHSKSPGKSNNNNGNPVETSINIDPGKKRNRSKSFESSDLNISVDNKSIIKPMRERLRSSDRPNISHVTRSDINPIIDNKSIAGSMRQRNLSNDQSGESVEKFNNNEKTSISIDQKSWRNKSISFECSDLNISEDKISIDSIRMRTRSHNKSDNDMGNFSKSPMKTFAIIDLEVKGNQSISCKTSDLNKTINNNKSITETTRQMSYSIDQSD-------KSPGKFNNNNGNPVETSINIDPGKKRNRSISFESSDLNISIDNKSIIKPMRDRLRSFDRPNISLVTRSDINPIIDNKSIAGSMRQRKLSIDLSDESVEKFNNNNEKP---PKTSISIDKKSGRNKSKDSIRKQTRSHSK 1300          

HSP 2 Score: 1607.42 bits (4161), Expect = 0.000e+0
Identity = 965/988 (97.67%), Postives = 971/988 (98.28%), Query Frame = 3
Query: 2997 VETSINIDPGKKRNRSISFESSDLNISIDNTSIIKPMRDRLRSFDRPNISLVTRSDINPIIDNKSIAGSMRQRKLSIDLSDESVEKFXXXXEKPPKTXXXXXXXXXXXXXXXXXRKQTRSHSKSDNMGNSSKSHMKTFAIIDLEIKANQSISCKSSDLNKIIDANKSIIEPMRKRTRSINQSDNIMTNCSKSLAKSNNYNKVPVKTSIKTDQGKPRNRSISCESSELNTSIIEQPMRLRSFDVYHNSDIPDIALTCLGTSITIHEDPVKLSDNNNNNIKSLQKRKKSMSNEHSQLNSSTEPLRKRLRSSEKRNPLVPADGSNDFDGKIEHSLRNRVYSFSSDNKLNMKPAVVLENLNLKMKSSPXXXXXXXXXXXXXXXXXXPLLTNQKTIKITKNPVKILKINETIENESKKHPKSFKIDKDFCQIQKDKEKASTKHKEIKKNQIGKDNGEIKETAGTESNLDSESKKQPNSLKIDKYSAQLASKEIAVNPARKSAIKDMKEYDQSRKSIVNEETPKMSISYENVPENDIERTGIGITEANAGSSNKELSQNFVDLQILNEKSSSHFKTINTNETSYKKPVPLTPFRRFLNTDIDEEDESDSVLINFSRKSTLSISSTHSTQEKINKIGSFDFSESHIDFQSTPKVSDTXXXXXXXXXXXXXRLNVSGFLSISHSTPXXXXXXXXXXXXXXXXXXFENDKKSISISEVXXXXXXXXXXXXSSENAQDPIGICKADGNTEKINKISRLNFSGLLSQSTPKASEVSEKHVKIKRQEKSIKNSLDDSKTELKKSKLQKASDERLQKLQVIMNSKRLALLNSQSTNINKIDPXXXXXXXXXXXXXXXRKITTPKSLVSTQKXXXXXXXXXXXXXXXXITAPTPLVNAPTPKITIQSPVSSVKSNWWGVNNKVDDLYLKTSFTASPKWKSIINTSCEDRMDKIKQVINRGLSQSNSDCLTXXXXXXXXXXXXDFPELLQPFRPLKASKSINT 5960
            VETSINIDPGKKRNRSISFESSDLNISIDN SIIKPMRDRLRSFDRPNISLVTRSDINPIIDNKSIAGSMRQRKLSIDLSDESVEKFNNNNEKPPKTSISIDKKSG NKSKDSIRKQTRSHSKSDNMGNSSKSHMKTFAIIDLEIKANQSISCKSSDLNK IDANKSIIEPMRKRTRSINQSDNIMT CSKSLAKSNNYNKVPVKTSIKTDQGKPRNRSISCESSELN SIIEQPMRLRSFDVYHNSDIPDIALTCLGTSITIHEDPVKL DNNN  IKSLQKRKKSMSNEHSQLNSSTEPLRKRLRSSEKRNPLVPADGSNDF+GKIEHSLRNRVYSFSSDNKLNMKPAVVLENLNLKMKSSPIKKVANKKKLKKIDKIKKPLLTNQKTIKITKNPVKILKINETIENESKKHPKSFKIDKDFCQIQKDKEKASTKHKEIKKNQIGKDNGEIKETAGTES+LDSESKKQPNSLKIDKYSAQLASKEIAVNPARKSAIKDMKEYDQSRKSIVNEETP MSI+YENVPENDIERTGIGITEANAGSSNKELSQNFVDLQILNEKSSSHFKTINTNETSYKKPVPLTPFRRFLNTDIDEEDESDSVLINFSRKSTLSISSTHSTQEKINKIGSFDFSESHIDFQSTPKVSDTKEKSEIINKNKISRLNVSGFLSISHSTPKISEAKEESEKINKNKISFENDKKSISISEVNKNTENI+KNKISSENAQDPIGICKADGNTEKINKISRLNFS LLSQSTPKASEVSEKHVKIK+QEKSIK SLDDSKTELKKSKLQKASDERLQKLQVIMNSKRLALLNSQSTN NKIDPVTSATTSTALVTA TRKITTP SLVSTQKPLVTVPNPLVTTPTS ITAPTPLVNAPTPKIT QSPVSSVKSNWWGVNNKVDDLYLKTSFTASPKWKSIINTSCEDRMDKIKQVINRGLSQSNSDCLT +YNNISNNSNSDFPELLQPFRPLKASKSINT
Sbjct: 1178 VETSINIDPGKKRNRSISFESSDLNISIDNKSIIKPMRDRLRSFDRPNISLVTRSDINPIIDNKSIAGSMRQRKLSIDLSDESVEKFNNNNEKPPKTSISIDKKSGRNKSKDSIRKQTRSHSKSDNMGNSSKSHMKTFAIIDLEIKANQSISCKSSDLNKTIDANKSIIEPMRKRTRSINQSDNIMTYCSKSLAKSNNYNKVPVKTSIKTDQGKPRNRSISCESSELNISIIEQPMRLRSFDVYHNSDIPDIALTCLGTSITIHEDPVKLPDNNN--IKSLQKRKKSMSNEHSQLNSSTEPLRKRLRSSEKRNPLVPADGSNDFNGKIEHSLRNRVYSFSSDNKLNMKPAVVLENLNLKMKSSPIKKVANKKKLKKIDKIKKPLLTNQKTIKITKNPVKILKINETIENESKKHPKSFKIDKDFCQIQKDKEKASTKHKEIKKNQIGKDNGEIKETAGTESDLDSESKKQPNSLKIDKYSAQLASKEIAVNPARKSAIKDMKEYDQSRKSIVNEETPIMSINYENVPENDIERTGIGITEANAGSSNKELSQNFVDLQILNEKSSSHFKTINTNETSYKKPVPLTPFRRFLNTDIDEEDESDSVLINFSRKSTLSISSTHSTQEKINKIGSFDFSESHIDFQSTPKVSDTKEKSEIINKNKISRLNVSGFLSISHSTPKISEAKEESEKINKNKISFENDKKSISISEVNKNTENIDKNKISSENAQDPIGICKADGNTEKINKISRLNFSELLSQSTPKASEVSEKHVKIKKQEKSIKKSLDDSKTELKKSKLQKASDERLQKLQVIMNSKRLALLNSQSTNNNKIDPVTSATTSTALVTAPTRKITTPNSLVSTQKPLVTVPNPLVTTPTSSITAPTPLVNAPTPKITTQSPVSSVKSNWWGVNNKVDDLYLKTSFTASPKWKSIINTSCEDRMDKIKQVINRGLSQSNSDCLTNDYNNISNNSNSDFPELLQPFRPLKASKSINT 2163          
BLAST of Transcription factor tau subunit sfc6 isoform 1 vs. Planmine SMEST
Match: SMESG000063031.1 (SMESG000063031.1)

HSP 1 Score: 2232.99 bits (5785), Expect = 0.000e+0
Identity = 1156/1310 (88.24%), Postives = 1185/1310 (90.46%), Query Frame = 3
Query:   93 MRNKRLAAIQCIKNIHNSYKYNSQESSSVGDKSQYGILEDSSTNTDTISLKDDIENVIEEIPDLIIEKFNSVHESDNFPKSNRKYFSIENAALFWRAKNQNSNNGLSLLEWSFKKNLNYFNELSQSDYWADKILTDIDIELEIFQYLKEAFFPNRGYLVDISKTDKKREILGSLGKISILKDENELIHEVLLPCNSTPVLNPVVDQHGIFINSGSYIKKMSWAPINAELHTDQYLAVSVYKAPTDRSNFYESGISPNQIIQIYNCGPLTMKTKSAARAQLEMILTHDWGKITDMAWSPQPLPAVGRRSDNLLIGHLALCCTDGFIRIVPIGKPSVANCLLKLDSNHPVICLGAIRNKQNKEVFPVTMHWRQEFPDRIVAGYNTGHVGTFVLEACVFLSVARIIGVNIYLKPAVFHRVFHSPFRSIQISPFNWQLVSCSSMTMSNAVVVDLGQPSDMILPSPIDMEATIGSKIIWPIPGDVVVLAAGKYLHNKPGVLLCSAQKPAKRSRKLPLPDVSSIDLCVSLNILPIGTRSGQLRILSLNTNYVNSLLKSRSYSFKACREIPITSKFYLQYRLMQIDSNKNRKPLIKSENGTPTVSSYNSCCSCPPKLQCVHKLSLKFSISVSKTPVDDRNNWQLDSMLNINEIATNPNPRCSTWIAVSLECGVIHIVPLTHFYRSELDQISTGSCCNDLNESSNQLIDESLLPKNIVYAPKFGRPRKCPRSFTYQNLYQKKIALKSIGRSIKSEEVSANSSRNLSKPLSGIRDFSLRSKSTLITDYFVNSSAGNIGLNTFQCSTPKRQKLITNLSTPKVNNPSKSKSAKIAIQRTLRSNSNSTPIQNSESITVPFSDVKMSLVASTRQRLRSFTGFNVDSDALVKGNELIETRSPSFETVDFGSSSLEKDADPHRKLQSSQKPLNTTSVGDNSINKLTNEISDMRKRTRSFNQLDKFMXXXXXXXXXXXXXXXXXVETSINIDPGKKRNRSISFESSDLNISIDNTSIIKPMRDRLRSFDRPNISLVTRSDINPIIDNKSIAGSMRQRKLSIDLSDESVEKFXXXXE------------KPPKTXXXXXXXXXXXXXXXXXRKQTRSHSKSDN-MGNSSKSHMKTFAIIDLEIKANQSISCKSSDLNKIIDANKSIIEPMRKRTRSINQSDNIMTNCSKSLAKSNNYNKVPVKTSIKTDQGKPRNRSISCESSELNTSI----IEQPM--RLRSFD-----VYHNSDI-PDIALTCLGTSITIHEDPVKLSDN-----NNNNIKSLQKRKKSMS-NEHSQLNSSTEPLRKRLRSSEK 3929
            MRNKRLAAIQCIKNIHNSYKYNSQESSSVGDKSQYGILEDSSTNTDTISLKDDIENVIEEIPDLI EKFNSVHESDNFPKSNRKYFSIENAALFWRAKNQNSNNGLSLLEWSFKKNLNYFNELSQSDYWADKILTDIDIELEIFQYLKEAFFPNRGYLVDISKTDKKREILGSLGKISILKDENELIHEVLLPC+STPVLNPVVDQHGIFINSGSYIKKMSWAPINAELHTDQYLAVSVYKAPTDRSNFYESGISPNQIIQIYNCGPLTMKTKSAARAQLEMILTHDWGKITDMAWSPQPLPAVGR SDNLLIGHLALCCTDGFIRIVPIGKPS+ANCLLKLDSNHPVICLGAIRNKQNKEVFPVTMHWRQEFPDRIVAGYNTGHVGTFVLEACVF SVARIIGVNIYLKPAVFHRVFHSPFRSIQISPFNWQLVSCSSMTMSNAVVVDLGQPSDMILPSPIDMEATIGSKIIWPIPGDVVVLAAGKYLHNKPGVLLCSAQKPAKRSRKLPLPDVSSIDLCVSLNILPIGTRSGQLRILSLNTNYVNSLLKSRSYSFKACREIPITSKFYLQYRLMQIDSN+NRKPLIKSENGTPTVSSYNSCCSCPPKLQCVHKLSLKFSISVSKTPVDDRNNWQLDSMLNINEIATNPNPRCSTWIAVSLECGVIHIVPLTHFYRSELDQISTGSCCNDLNESSNQLIDESLLPKNIVYAPKFGRPRKCPRSFTYQNLYQKKIALKSIGRSIKSEEVSANSSRNL+KPLSGIRDFSLRSKSTLITDYFVNSSAGNIGLNTFQCSTPKRQKLITNLS PKVNNPSKSKSAKIAIQRTLRSNSNSTPIQNSESITVPFSDV M LVASTRQRLRSFTGFNVDSDALVKGNELIETRSPSFETVDFGSSSLEKDADPHRKLQSSQKPLNTTSVGDNSINKLTNEISDMRKRTRSFNQLDKFMNNHSKSPGKSNNNNGNPVETSINIDPGKKRNRS SFESSDLNIS+DN SIIKPMR+RLRS DRPNIS VTRSDINPIIDNKSIAGSMRQR LS D S ESVEKFNNN +            K      S    S    S DSIR +TRSH+KSDN MGN SKS MKTFAIIDLE+K NQSISCK+SDLNK I+ NKSI E  R+ + SI+QSD       KS  K NN N  PV+TSI  D GK RNRSIS ESS+LN SI    I +PM  RLRSFD     +   SDI P I    +  S+   +  + LSD      NNNN K     K S+S ++ S  N S + +RK+ RS  K
Sbjct:    1 MRNKRLAAIQCIKNIHNSYKYNSQESSSVGDKSQYGILEDSSTNTDTISLKDDIENVIEEIPDLIFEKFNSVHESDNFPKSNRKYFSIENAALFWRAKNQNSNNGLSLLEWSFKKNLNYFNELSQSDYWADKILTDIDIELEIFQYLKEAFFPNRGYLVDISKTDKKREILGSLGKISILKDENELIHEVLLPCDSTPVLNPVVDQHGIFINSGSYIKKMSWAPINAELHTDQYLAVSVYKAPTDRSNFYESGISPNQIIQIYNCGPLTMKTKSAARAQLEMILTHDWGKITDMAWSPQPLPAVGRLSDNLLIGHLALCCTDGFIRIVPIGKPSMANCLLKLDSNHPVICLGAIRNKQNKEVFPVTMHWRQEFPDRIVAGYNTGHVGTFVLEACVFSSVARIIGVNIYLKPAVFHRVFHSPFRSIQISPFNWQLVSCSSMTMSNAVVVDLGQPSDMILPSPIDMEATIGSKIIWPIPGDVVVLAAGKYLHNKPGVLLCSAQKPAKRSRKLPLPDVSSIDLCVSLNILPIGTRSGQLRILSLNTNYVNSLLKSRSYSFKACREIPITSKFYLQYRLMQIDSNENRKPLIKSENGTPTVSSYNSCCSCPPKLQCVHKLSLKFSISVSKTPVDDRNNWQLDSMLNINEIATNPNPRCSTWIAVSLECGVIHIVPLTHFYRSELDQISTGSCCNDLNESSNQLIDESLLPKNIVYAPKFGRPRKCPRSFTYQNLYQKKIALKSIGRSIKSEEVSANSSRNLNKPLSGIRDFSLRSKSTLITDYFVNSSAGNIGLNTFQCSTPKRQKLITNLSPPKVNNPSKSKSAKIAIQRTLRSNSNSTPIQNSESITVPFSDVNMPLVASTRQRLRSFTGFNVDSDALVKGNELIETRSPSFETVDFGSSSLEKDADPHRKLQSSQKPLNTTSVGDNSINKLTNEISDMRKRTRSFNQLDKFMNNHSKSPGKSNNNNGNPVETSINIDPGKKRNRSKSFESSDLNISVDNKSIIKPMRERLRSSDRPNISHVTRSDINPIIDNKSIAGSMRQRNLSNDQSGESVEKFNNNEKTSISIDQKSWRNKSISFECSDLNISEDKISIDSIRMRTRSHNKSDNDMGNFSKSPMKTFAIIDLEVKGNQSISCKTSDLNKTINNNKSITETTRQMSYSIDQSD-------KSPGKFNNNNGNPVETSINIDPGKKRNRSISFESSDLNISIDNKSIIKPMRDRLRSFDRPNISLVTRSDINPIIDNKSIAGSMRQRKLSIDLSDESVEKFNNNNEKP---PKTSISIDKKSGRNKSKDSIRKQTRSHSK 1300          

HSP 2 Score: 1564.28 bits (4049), Expect = 0.000e+0
Identity = 949/988 (96.05%), Postives = 955/988 (96.66%), Query Frame = 3
Query: 2997 VETSINIDPGKKRNRSISFESSDLNISIDNTSIIKPMRDRLRSFDRPNISLVTRSDINPIIDNKSIAGSMRQRKLSIDLSDESVEKFXXXXEKPPKTXXXXXXXXXXXXXXXXXRKQTRSHSKSDNMGNSSKSHMKTFAIIDLEIKANQSISCKSSDLNKIIDANKSIIEPMRKRTRSINQSDNIMTNCSKSLAKSNNYNKVPVKTSIKTDQGKPRNRSISCESSELNTSIIEQPMRLRSFDVYHNSDIPDIALTCLGTSITIHEDPVKLSDNNNNNIKSLQKRKKSMSNEHSQLNSSTEPLRKRLRSSEKRNPLVPADGSNDFDGKIEHSLRNRVYSFSSDNKLNMKPAVVLENLNLKMKSSPXXXXXXXXXXXXXXXXXXPLLTNQKTIKITKNPVKILKINETIENESKKHPKSFKIDKDFCQIQKDKEKASTKHKEIKKNQIGKDNGEIKETAGTESNLDSESKKQPNSLKIDKYSAQLASKEIAVNPARKSAIKDMKEYDQSRKSIVNEETPKMSISYENVPENDIERTGIGITEANAGSSNKELSQNFVDLQILNEKSSSHFKTINTNETSYKKPVPLTPFRRFLNTDIDEEDESDSVLINFSRKSTLSISSTHSTQEKINKIGSFDFSESHIDFQSTPKVSDTXXXXXXXXXXXXXRLNVSGFLSISHSTPXXXXXXXXXXXXXXXXXXFENDKKSISISEVXXXXXXXXXXXXSSENAQDPIGICKADGNTEKINKISRLNFSGLLSQSTPKASEVSEKHVKIKRQEKSIKNSLDDSKTELKKSKLQKASDERLQKLQVIMNSKRLALLNSQSTNINKIDPXXXXXXXXXXXXXXXRKITTPKSLVSTQKXXXXXXXXXXXXXXXXITAPTPLVNAPTPKITIQSPVSSVKSNWWGVNNKVDDLYLKTSFTASPKWKSIINTSCEDRMDKIKQVINRGLSQSNSDCLTXXXXXXXXXXXXDFPELLQPFRPLKASKSINT 5960
            VETSINIDPGKKRNRSISFESSDLNISIDN SIIKPMRDRLRSFDRPNISLVTRSDINPIIDNKSIAGSMRQRKLSIDLSDESVEKFNNNNEKPPKTSISIDKKSG NKSKDSIRKQTRSHSKSDNM                EIKANQSISCKSSDLNK IDANKSIIEPMRKRTRSINQSDNIMT CSKSLAKSNNYNKVPVKTSIKTDQGKPRNRSISCESSELN SIIEQPMRLRSFDVYHNSDIPDIALTCLGTSITIHEDPVKL DNNN  IKSLQKRKKSMSNEHSQLNSSTEPLRKRLRSSEKRNPLVPADGSNDF+GKIEHSLRNRVYSFSSDNKLNMKPAVVLENLNLKMKSSPIKKVANKKKLKKIDKIKKPLLTNQKTIKITKNPVKILKINETIENESKKHPKSFKIDKDFCQIQKDKEKASTKHKEIKKNQIGKDNGEIKETAGTES+LDSESKKQPNSLKIDKYSAQLASKEIAVNPARKSAIKDMKEYDQSRKSIVNEETP MSI+YENVPENDIERTGIGITEANAGSSNKELSQNFVDLQILNEKSSSHFKTINTNETSYKKPVPLTPFRRFLNTDIDEEDESDSVLINFSRKSTLSISSTHSTQEKINKIGSFDFSESHIDFQSTPKVSDTKEKSEIINKNKISRLNVSGFLSISHSTPKISEAKEESEKINKNKISFENDKKSISISEVNKNTENI+KNKISSENAQDPIGICKADGNTEKINKISRLNFS LLSQSTPKASEVSEKHVKIK+QEKSIK SLDDSKTELKKSKLQKASDERLQKLQVIMNSKRLALLNSQSTN NKIDPVTSATTSTALVTA TRKITTP SLVSTQKPLVTVPNPLVTTPTS ITAPTPLVNAPTPKIT QSPVSSVKSNWWGVNNKVDDLYLKTSFTASPKWKSIINTSCEDRMDKIKQVINRGLSQSNSDCLT +YNNISNNSNSDFPELLQPFRPLKASKSINT
Sbjct: 1178 VETSINIDPGKKRNRSISFESSDLNISIDNKSIIKPMRDRLRSFDRPNISLVTRSDINPIIDNKSIAGSMRQRKLSIDLSDESVEKFNNNNEKPPKTSISIDKKSGRNKSKDSIRKQTRSHSKSDNM----------------EIKANQSISCKSSDLNKTIDANKSIIEPMRKRTRSINQSDNIMTYCSKSLAKSNNYNKVPVKTSIKTDQGKPRNRSISCESSELNISIIEQPMRLRSFDVYHNSDIPDIALTCLGTSITIHEDPVKLPDNNN--IKSLQKRKKSMSNEHSQLNSSTEPLRKRLRSSEKRNPLVPADGSNDFNGKIEHSLRNRVYSFSSDNKLNMKPAVVLENLNLKMKSSPIKKVANKKKLKKIDKIKKPLLTNQKTIKITKNPVKILKINETIENESKKHPKSFKIDKDFCQIQKDKEKASTKHKEIKKNQIGKDNGEIKETAGTESDLDSESKKQPNSLKIDKYSAQLASKEIAVNPARKSAIKDMKEYDQSRKSIVNEETPIMSINYENVPENDIERTGIGITEANAGSSNKELSQNFVDLQILNEKSSSHFKTINTNETSYKKPVPLTPFRRFLNTDIDEEDESDSVLINFSRKSTLSISSTHSTQEKINKIGSFDFSESHIDFQSTPKVSDTKEKSEIINKNKISRLNVSGFLSISHSTPKISEAKEESEKINKNKISFENDKKSISISEVNKNTENIDKNKISSENAQDPIGICKADGNTEKINKISRLNFSELLSQSTPKASEVSEKHVKIKKQEKSIKKSLDDSKTELKKSKLQKASDERLQKLQVIMNSKRLALLNSQSTNNNKIDPVTSATTSTALVTAPTRKITTPNSLVSTQKPLVTVPNPLVTTPTSSITAPTPLVNAPTPKITTQSPVSSVKSNWWGVNNKVDDLYLKTSFTASPKWKSIINTSCEDRMDKIKQVINRGLSQSNSDCLTNDYNNISNNSNSDFPELLQPFRPLKASKSINT 2147          
BLAST of Transcription factor tau subunit sfc6 isoform 1 vs. Planmine SMEST
Match: SMESG000063031.1 (SMESG000063031.1)

HSP 1 Score: 2204.48 bits (5711), Expect = 0.000e+0
Identity = 1142/1309 (87.24%), Postives = 1172/1309 (89.53%), Query Frame = 3
Query:   93 MRNKRLAAIQCIKNIHNSYKYNSQESSSVGDKSQYGILEDSSTNTDTISLKDDIENVIEEIPDLIIEKFNSVHESDNFPKSNRKYFSIENAALFWRAKNQNSNNGLSLLEWSFKKNLNYFNELSQSDYWADKILTDIDIELEIFQYLKEAFFPNRGYLVDISKTDKKREILGSLGKISILKDENELIHEVLLPCNSTPVLNPVVDQHGIFINSGSYIKKMSWAPINAELHTDQYLAVSVYKAPTDRSNFYESGISPNQIIQIYNCGPLTMKTKSAARAQLEMILTHDWGKITDMAWSPQPLPAVGRRSDNLLIGHLALCCTDGFIRIVPIGKPSVANCLLKLDSNHPVICLGAIRNKQNKEVFPVTMHWRQEFPDRIVAGYNTGHVGTFVLEACVFLSVARIIGVNIYLKPAVFHRVFHSPFRSIQISPFNWQLVSCSSMTMSNAVVVDLGQPSDMILPSPIDMEATIGSKIIWPIPGDVVVLAAGKYLHNKPGVLLCSAQKPAKRSRKLPLPDVSSIDLCVSLNILPIGTRSGQLRILSLNTNYVNSLLKSRSYSFKACREIPITSKFYLQYRLMQIDSNKNRKPLIKSENGTPTVSSYNSCCSCPPKLQCVHKLSLKFSISVSKTPVDDRNNWQLDSMLNINEIATNPNPRCSTWIAVSLECGVIHIVPLTHFYRSELDQISTGSCCNDLNESSNQLIDESLLPKNIVYAPKFGRPRKCPRSFTYQNLYQKKIALKSIGRSIKSEEVSANSSRNLSKPLSGIRDFSLRSKSTLITDYFVNSSAGNIGLNTFQCSTPKRQKLITNLSTPKVNNPSKSKSAKIAIQRTLRSNSNSTPIQNSESITVPFSDVKMSLVASTRQRLRSFTGFNVDSDALVKGNELIETRSPSFETVDFGSSSLEKDADPHRKLQSSQKPLNTTSVGDNSINKLTNEISDMRKRTRSFNQLDKFMXXXXXXXXXXXXXXXXXVETSINIDPGKKRNRSISFESSDLNISIDNTSIIKPMRDRLRSFDRPNISLVTRSDINPIIDNKSIAGSMRQRKLSIDLSDESVEKFXXXXE------------KPPKTXXXXXXXXXXXXXXXXXRKQTRSHSKSDNMGNSSKSHMKTFAIIDLEIKANQSISCKSSDLNKIIDANKSIIEPMRKRTRSINQSDNIMTNCSKSLAKSNNYNKVPVKTSIKTDQGKPRNRSISCESSELNTSI----IEQPM--RLRSFD-----VYHNSDI-PDIALTCLGTSITIHEDPVKLSDN-----NNNNIKSLQKRKKSMS-NEHSQLNSSTEPLRKRLRSSEK 3929
            MRNKRLAAIQCIKNIHNSYKYNSQESSSVGDKSQYGILEDSSTNTDTISLKDDIENVIEEIPDLI EKFNSVHESDNFPKSNRKYFSIENAALFWRAKNQNSNNGLSLLEWSFKKNLNYFNELSQSDYWADKILTDIDIELEIFQYLKEAFFPNRGYLVDISKTDKKREILGSLGKISILKDENELIHEVLLPC+STPVLNPVVDQHGIFINSGSYIKKMSWAPINAELHTDQYLAVSVYKAPTDRSNFYESGISPNQIIQIYNCGPLTMKTKSAARAQLEMILTHDWGKITDMAWSPQPLPAVGR SDNLLIGHLALCCTDGFIRIVPIGKPS+ANCLLKLDSNHPVICLGAIRNKQNKEVFPVTMHWRQEFPDRIVAGYNTGHVGTFVLEACVF SVARIIGVNIYLKPAVFHRVFHSPFRSIQISPFNWQLVSCSSMTMSNAVVVDLGQPSDMILPSPIDMEATIGSKIIWPIPGDVVVLAAGKYLHNKPGVLLCSAQKPAKRSRKLPLPDVSSIDLCVSLNILPIGTRSGQLRILSLNTNYVNSLLKSRSYSFKACREIPITSKFYLQYRLMQIDSN+NRKPLIKSENGTPTVSSYNSCCSCPPKLQCVHKLSLKFSISVSKTPVDDRNNWQLDSMLNINEIATNPNPRCSTWIAVSLECGVIHIVPLTHFYRSELDQISTGSCCNDLNESSNQLIDESLLPKNIVYAPKFGRPRKCPRSFTYQNLYQKKIALKSIGRSIKSEEVSANSSRNL+KPLSGIRDFSLRSKSTLITDYFVNSSAGNIGLNTFQCSTPKRQKLITNLS PKVNNPSKSKSAKIAIQRTLRSNSNSTPIQNSESITVPFSDV M LVASTRQRLRSFTGFNVDSDALVKGNELIETRSPSFETVDFGSSSLEKDADPHRKLQSSQKPLNTTSVGDNSINKLTNEISDMRKRTRSFNQLDKFMNNHSKSPGKSNNNNGNPVETSINIDPGKKRNRS SFESSDLNIS+DN SIIKPMR+RLRS DRPNIS VTRSDINPIIDNKSIAGSMRQR LS D S ESVEKFNNN +            K      S    S    S DSIR +TRSH+KSDN               D+E+K NQSISCK+SDLNK I+ NKSI E  R+ + SI+QSD       KS  K NN N  PV+TSI  D GK RNRSIS ESS+LN SI    I +PM  RLRSFD     +   SDI P I    +  S+   +  + LSD      NNNN K     K S+S ++ S  N S + +RK+ RS  K
Sbjct:    1 MRNKRLAAIQCIKNIHNSYKYNSQESSSVGDKSQYGILEDSSTNTDTISLKDDIENVIEEIPDLIFEKFNSVHESDNFPKSNRKYFSIENAALFWRAKNQNSNNGLSLLEWSFKKNLNYFNELSQSDYWADKILTDIDIELEIFQYLKEAFFPNRGYLVDISKTDKKREILGSLGKISILKDENELIHEVLLPCDSTPVLNPVVDQHGIFINSGSYIKKMSWAPINAELHTDQYLAVSVYKAPTDRSNFYESGISPNQIIQIYNCGPLTMKTKSAARAQLEMILTHDWGKITDMAWSPQPLPAVGRLSDNLLIGHLALCCTDGFIRIVPIGKPSMANCLLKLDSNHPVICLGAIRNKQNKEVFPVTMHWRQEFPDRIVAGYNTGHVGTFVLEACVFSSVARIIGVNIYLKPAVFHRVFHSPFRSIQISPFNWQLVSCSSMTMSNAVVVDLGQPSDMILPSPIDMEATIGSKIIWPIPGDVVVLAAGKYLHNKPGVLLCSAQKPAKRSRKLPLPDVSSIDLCVSLNILPIGTRSGQLRILSLNTNYVNSLLKSRSYSFKACREIPITSKFYLQYRLMQIDSNENRKPLIKSENGTPTVSSYNSCCSCPPKLQCVHKLSLKFSISVSKTPVDDRNNWQLDSMLNINEIATNPNPRCSTWIAVSLECGVIHIVPLTHFYRSELDQISTGSCCNDLNESSNQLIDESLLPKNIVYAPKFGRPRKCPRSFTYQNLYQKKIALKSIGRSIKSEEVSANSSRNLNKPLSGIRDFSLRSKSTLITDYFVNSSAGNIGLNTFQCSTPKRQKLITNLSPPKVNNPSKSKSAKIAIQRTLRSNSNSTPIQNSESITVPFSDVNMPLVASTRQRLRSFTGFNVDSDALVKGNELIETRSPSFETVDFGSSSLEKDADPHRKLQSSQKPLNTTSVGDNSINKLTNEISDMRKRTRSFNQLDKFMNNHSKSPGKSNNNNGNPVETSINIDPGKKRNRSKSFESSDLNISVDNKSIIKPMRERLRSSDRPNISHVTRSDINPIIDNKSIAGSMRQRNLSNDQSGESVEKFNNNEKTSISIDQKSWRNKSISFECSDLNISEDKISIDSIRMRTRSHNKSDN---------------DMEVKGNQSISCKTSDLNKTINNNKSITETTRQMSYSIDQSD-------KSPGKFNNNNGNPVETSINIDPGKKRNRSISFESSDLNISIDNKSIIKPMRDRLRSFDRPNISLVTRSDINPIIDNKSIAGSMRQRKLSIDLSDESVEKFNNNNEKP---PKTSISIDKKSGRNKSKDSIRKQTRSHSK 1284          

HSP 2 Score: 1607.42 bits (4161), Expect = 0.000e+0
Identity = 965/988 (97.67%), Postives = 971/988 (98.28%), Query Frame = 3
Query: 2997 VETSINIDPGKKRNRSISFESSDLNISIDNTSIIKPMRDRLRSFDRPNISLVTRSDINPIIDNKSIAGSMRQRKLSIDLSDESVEKFXXXXEKPPKTXXXXXXXXXXXXXXXXXRKQTRSHSKSDNMGNSSKSHMKTFAIIDLEIKANQSISCKSSDLNKIIDANKSIIEPMRKRTRSINQSDNIMTNCSKSLAKSNNYNKVPVKTSIKTDQGKPRNRSISCESSELNTSIIEQPMRLRSFDVYHNSDIPDIALTCLGTSITIHEDPVKLSDNNNNNIKSLQKRKKSMSNEHSQLNSSTEPLRKRLRSSEKRNPLVPADGSNDFDGKIEHSLRNRVYSFSSDNKLNMKPAVVLENLNLKMKSSPXXXXXXXXXXXXXXXXXXPLLTNQKTIKITKNPVKILKINETIENESKKHPKSFKIDKDFCQIQKDKEKASTKHKEIKKNQIGKDNGEIKETAGTESNLDSESKKQPNSLKIDKYSAQLASKEIAVNPARKSAIKDMKEYDQSRKSIVNEETPKMSISYENVPENDIERTGIGITEANAGSSNKELSQNFVDLQILNEKSSSHFKTINTNETSYKKPVPLTPFRRFLNTDIDEEDESDSVLINFSRKSTLSISSTHSTQEKINKIGSFDFSESHIDFQSTPKVSDTXXXXXXXXXXXXXRLNVSGFLSISHSTPXXXXXXXXXXXXXXXXXXFENDKKSISISEVXXXXXXXXXXXXSSENAQDPIGICKADGNTEKINKISRLNFSGLLSQSTPKASEVSEKHVKIKRQEKSIKNSLDDSKTELKKSKLQKASDERLQKLQVIMNSKRLALLNSQSTNINKIDPXXXXXXXXXXXXXXXRKITTPKSLVSTQKXXXXXXXXXXXXXXXXITAPTPLVNAPTPKITIQSPVSSVKSNWWGVNNKVDDLYLKTSFTASPKWKSIINTSCEDRMDKIKQVINRGLSQSNSDCLTXXXXXXXXXXXXDFPELLQPFRPLKASKSINT 5960
            VETSINIDPGKKRNRSISFESSDLNISIDN SIIKPMRDRLRSFDRPNISLVTRSDINPIIDNKSIAGSMRQRKLSIDLSDESVEKFNNNNEKPPKTSISIDKKSG NKSKDSIRKQTRSHSKSDNMGNSSKSHMKTFAIIDLEIKANQSISCKSSDLNK IDANKSIIEPMRKRTRSINQSDNIMT CSKSLAKSNNYNKVPVKTSIKTDQGKPRNRSISCESSELN SIIEQPMRLRSFDVYHNSDIPDIALTCLGTSITIHEDPVKL DNNN  IKSLQKRKKSMSNEHSQLNSSTEPLRKRLRSSEKRNPLVPADGSNDF+GKIEHSLRNRVYSFSSDNKLNMKPAVVLENLNLKMKSSPIKKVANKKKLKKIDKIKKPLLTNQKTIKITKNPVKILKINETIENESKKHPKSFKIDKDFCQIQKDKEKASTKHKEIKKNQIGKDNGEIKETAGTES+LDSESKKQPNSLKIDKYSAQLASKEIAVNPARKSAIKDMKEYDQSRKSIVNEETP MSI+YENVPENDIERTGIGITEANAGSSNKELSQNFVDLQILNEKSSSHFKTINTNETSYKKPVPLTPFRRFLNTDIDEEDESDSVLINFSRKSTLSISSTHSTQEKINKIGSFDFSESHIDFQSTPKVSDTKEKSEIINKNKISRLNVSGFLSISHSTPKISEAKEESEKINKNKISFENDKKSISISEVNKNTENI+KNKISSENAQDPIGICKADGNTEKINKISRLNFS LLSQSTPKASEVSEKHVKIK+QEKSIK SLDDSKTELKKSKLQKASDERLQKLQVIMNSKRLALLNSQSTN NKIDPVTSATTSTALVTA TRKITTP SLVSTQKPLVTVPNPLVTTPTS ITAPTPLVNAPTPKIT QSPVSSVKSNWWGVNNKVDDLYLKTSFTASPKWKSIINTSCEDRMDKIKQVINRGLSQSNSDCLT +YNNISNNSNSDFPELLQPFRPLKASKSINT
Sbjct: 1162 VETSINIDPGKKRNRSISFESSDLNISIDNKSIIKPMRDRLRSFDRPNISLVTRSDINPIIDNKSIAGSMRQRKLSIDLSDESVEKFNNNNEKPPKTSISIDKKSGRNKSKDSIRKQTRSHSKSDNMGNSSKSHMKTFAIIDLEIKANQSISCKSSDLNKTIDANKSIIEPMRKRTRSINQSDNIMTYCSKSLAKSNNYNKVPVKTSIKTDQGKPRNRSISCESSELNISIIEQPMRLRSFDVYHNSDIPDIALTCLGTSITIHEDPVKLPDNNN--IKSLQKRKKSMSNEHSQLNSSTEPLRKRLRSSEKRNPLVPADGSNDFNGKIEHSLRNRVYSFSSDNKLNMKPAVVLENLNLKMKSSPIKKVANKKKLKKIDKIKKPLLTNQKTIKITKNPVKILKINETIENESKKHPKSFKIDKDFCQIQKDKEKASTKHKEIKKNQIGKDNGEIKETAGTESDLDSESKKQPNSLKIDKYSAQLASKEIAVNPARKSAIKDMKEYDQSRKSIVNEETPIMSINYENVPENDIERTGIGITEANAGSSNKELSQNFVDLQILNEKSSSHFKTINTNETSYKKPVPLTPFRRFLNTDIDEEDESDSVLINFSRKSTLSISSTHSTQEKINKIGSFDFSESHIDFQSTPKVSDTKEKSEIINKNKISRLNVSGFLSISHSTPKISEAKEESEKINKNKISFENDKKSISISEVNKNTENIDKNKISSENAQDPIGICKADGNTEKINKISRLNFSELLSQSTPKASEVSEKHVKIKKQEKSIKKSLDDSKTELKKSKLQKASDERLQKLQVIMNSKRLALLNSQSTNNNKIDPVTSATTSTALVTAPTRKITTPNSLVSTQKPLVTVPNPLVTTPTSSITAPTPLVNAPTPKITTQSPVSSVKSNWWGVNNKVDDLYLKTSFTASPKWKSIINTSCEDRMDKIKQVINRGLSQSNSDCLTNDYNNISNNSNSDFPELLQPFRPLKASKSINT 2147          
BLAST of Transcription factor tau subunit sfc6 isoform 1 vs. Planmine SMEST
Match: SMESG000031140.1 (SMESG000031140.1)

HSP 1 Score: 75.0998 bits (183), Expect = 6.987e-13
Identity = 77/315 (24.44%), Postives = 128/315 (40.63%), Query Frame = 3
Query:  867 IIQIYNCGPLTMKTKSAARAQLEMILTHDWGKITDMAWSPQPLPAVGRRSDNL-------LIGHLALCCTDGFIRIVPIGK---------------PSVANCLLKLDSNHPVICLGAIRNKQNKEVF--PVTMHWRQEFPDRIVAGYNTGHVGTFVLEACVFLSVARIIGVNIYLKPAVFHRVFHSPFRSIQISPFNWQLVSCS------SMTMSNAVVVDLGQPSDMILPS-PIDMEATIGSKIIWPIPGDVVVLAAGKYLHNKPGVLLCSAQKPAKRSRKLPLPDVSSIDLCVSLNILPIGTRSGQLRILSLN 1718
            ++QI++ G L     ++++  L+     DWG I  M W   P    G + D++       L GH+   C +G ++I+PI +               P+  + L    +N   + +        K  F  P  + W+ +FP +I+ GY+ G+V  F L         R   VN YL P    R+ HS    + ISP +WQ  + +        T  N  +    +P D+I    P+         +IWP   DV++  A     NK  +    +Q        + +  ++SI  C   N + + T  G L  +SLN
Sbjct:  170 VLQIWDYGTLN---NNSSKPVLKYSQILDWGNIIKMLW-ISPDQVTGCQYDDMQFELPQSLYGHMLFVCANGKLKIIPIAEFLDSELNSMNLSPPDPNQLDVLQIASTNVMELGISTSHVNDTKARFGCPTCVDWKSKFPTKILVGYSKGYVAIFDLSIAHH---TRYNYVNHYLSPIYKKRLSHSAIICVAISPVDWQQFNVTVAPNPEGSTNFNVNISSNFKPIDVIKSDKPL-------WGVIWPSRADVLI--AVPISRNKVIIKSILSQDTV----TVQVNKITSICACDLFNSIIVTTECGSLVSISLN 464          
BLAST of Transcription factor tau subunit sfc6 isoform 1 vs. Planmine SMEST
Match: SMESG000031140.1 (SMESG000031140.1)

HSP 1 Score: 75.0998 bits (183), Expect = 7.106e-13
Identity = 77/315 (24.44%), Postives = 128/315 (40.63%), Query Frame = 3
Query:  867 IIQIYNCGPLTMKTKSAARAQLEMILTHDWGKITDMAWSPQPLPAVGRRSDNL-------LIGHLALCCTDGFIRIVPIGK---------------PSVANCLLKLDSNHPVICLGAIRNKQNKEVF--PVTMHWRQEFPDRIVAGYNTGHVGTFVLEACVFLSVARIIGVNIYLKPAVFHRVFHSPFRSIQISPFNWQLVSCS------SMTMSNAVVVDLGQPSDMILPS-PIDMEATIGSKIIWPIPGDVVVLAAGKYLHNKPGVLLCSAQKPAKRSRKLPLPDVSSIDLCVSLNILPIGTRSGQLRILSLN 1718
            ++QI++ G L     ++++  L+     DWG I  M W   P    G + D++       L GH+   C +G ++I+PI +               P+  + L    +N   + +        K  F  P  + W+ +FP +I+ GY+ G+V  F L         R   VN YL P    R+ HS    + ISP +WQ  + +        T  N  +    +P D+I    P+         +IWP   DV++  A     NK  +    +Q        + +  ++SI  C   N + + T  G L  +SLN
Sbjct:  170 VLQIWDYGTLN---NNSSKPVLKYSQILDWGNIIKMLW-ISPDQVTGCQYDDMQFELPQSLYGHMLFVCANGKLKIIPIAEFLDSELNSMNLSPPDPNQLDVLQIASTNVMELGISTSHVNDTKARFGCPTCVDWKSKFPTKILVGYSKGYVAIFDLSIAHH---TRYNYVNHYLSPIYKKRLSHSAIICVAISPVDWQQFNVTVAPNPEGSTNFNVNISSNFKPIDVIKSDKPL-------WGVIWPSRADVLI--AVPISRNKVIIKSILSQDTV----TVQVNKITSICACDLFNSIIVTTECGSLVSISLN 464          
The following BLAST results are available for this feature:
BLAST of Transcription factor tau subunit sfc6 isoform 1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Transcription factor tau subunit sfc6 isoform 1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Transcription factor tau subunit sfc6 isoform 1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Transcription factor tau subunit sfc6 isoform 1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Transcription factor tau subunit sfc6 isoform 1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Transcription factor tau subunit sfc6 isoform 1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Transcription factor tau subunit sfc6 isoform 1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Transcription factor tau subunit sfc6 isoform 1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0X3Q0Z37.140e-2224.58Uncharacterized protein OS=Schistocephalus solidus... [more]
A0A0X3QCA41.069e-2124.60General transcription factor 3C polypeptide 2 OS=S... [more]
A0A0X3Q4N02.852e-2124.60General transcription factor 3C polypeptide 2 OS=S... [more]
A0A0X3P9W13.114e-2124.63Uncharacterized protein OS=Schistocephalus solidus... [more]
A0A158RA731.501e-1922.65Uncharacterized protein OS=Taenia asiatica OX=6051... [more]
back to top
BLAST of Transcription factor tau subunit sfc6 isoform 1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Transcription factor tau subunit sfc6 isoform 1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Transcription factor tau subunit sfc6 isoform 1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Transcription factor tau subunit sfc6 isoform 1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Transcription factor tau subunit sfc6 isoform 1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 2
Match NameE-valueIdentityDescription
gtf3c21.607e-623.68general transcription factor IIIC subunit 2 [Sourc... [more]
gtf3c22.992e-623.35general transcription factor IIIC subunit 2 [Sourc... [more]
back to top
BLAST of Transcription factor tau subunit sfc6 isoform 1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000063031.10.000e+088.24SMESG000063031.1[more]
SMESG000063031.10.000e+088.24SMESG000063031.1[more]
SMESG000063031.10.000e+087.24SMESG000063031.1[more]
SMESG000031140.16.987e-1324.44SMESG000031140.1[more]
SMESG000031140.17.106e-1324.44SMESG000031140.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30000041 ID=SMED30000041|Name=Transcription factor tau subunit sfc6 isoform 1|organism=Schmidtea mediterranea sexual|type=transcript|length=6049bp
ATTTACTAAAGCATAAGATACATCTTTAAATAATTTGTGAATTTTTAATA
GCTGTTCTTTTTAATTGTAAAATTATAATAATATTGAAATAAATGCGAAA
TAAACGACTGGCTGCTATACAATGCATTAAAAACATTCACAATAGTTACA
AATATAATTCTCAAGAAAGTTCTTCAGTCGGCGATAAAAGTCAATATGGT
ATTTTAGAGGACTCCTCAACAAATACTGATACTATCTCTTTGAAGGATGA
TATAGAAAATGTCATTGAAGAAATTCCTGATCTAATTATTGAGAAATTTA
ATTCTGTACACGAATCAGACAATTTTCCAAAATCTAATAGGAAATATTTT
TCGATTGAAAATGCTGCTTTGTTTTGGCGTGCTAAAAATCAGAACAGCAA
CAATGGGCTATCACTGCTTGAATGGAGTTTCAAAAAGAATTTAAATTATT
TTAATGAACTATCCCAATCAGATTATTGGGCTGATAAAATTTTAACAGAT
ATTGACATCGAATTGGAAATATTTCAATATTTAAAAGAAGCATTTTTTCC
AAATCGTGGTTATTTAGTCGACATTTCCAAAACTGACAAGAAACGAGAAA
TTTTAGGTTCACTTGGTAAAATAAGCATTTTAAAAGATGAAAATGAATTA
ATTCACGAAGTCCTTTTGCCATGCAATTCAACACCGGTTCTAAATCCGGT
TGTTGATCAGCACGGGATATTTATCAACTCTGGCTCGTACATCAAAAAGA
TGTCCTGGGCACCGATCAATGCCGAATTGCACACAGATCAGTATCTGGCA
GTTTCTGTCTATAAAGCACCGACTGACAGAAGCAATTTTTACGAAAGTGG
GATTTCACCCAATCAAATCATTCAGATTTACAATTGCGGCCCATTAACAA
TGAAAACCAAAAGCGCCGCTCGAGCGCAATTGGAAATGATACTGACACAT
GATTGGGGCAAAATTACCGACATGGCTTGGTCCCCACAGCCTTTGCCGGC
AGTTGGTCGTCGGTCTGACAATTTGCTTATCGGGCATTTAGCGCTCTGCT
GTACCGATGGCTTCATTAGGATTGTTCCGATCGGGAAGCCGTCGGTGGCA
AATTGTCTATTGAAATTGGACAGTAACCATCCGGTGATTTGCCTTGGAGC
GATTCGCAATAAGCAAAACAAAGAAGTATTTCCTGTAACAATGCATTGGC
GCCAGGAATTTCCCGATCGAATCGTTGCCGGTTACAATACCGGTCACGTG
GGAACGTTCGTTCTTGAGGCTTGCGTATTTTTATCGGTGGCACGGATTAT
TGGAGTCAATATCTATCTGAAACCCGCAGTATTTCACCGGGTGTTCCACA
GTCCGTTTCGATCGATTCAGATAAGCCCTTTCAACTGGCAGTTGGTATCG
TGTTCTTCAATGACAATGAGCAATGCTGTCGTTGTTGATCTCGGCCAGCC
TTCAGACATGATTTTACCCAGTCCAATCGATATGGAGGCTACGATTGGTT
CTAAAATCATTTGGCCGATTCCCGGTGACGTCGTTGTGCTAGCGGCGGGA
AAATATCTCCACAACAAGCCCGGAGTGTTGCTGTGTTCAGCACAGAAACC
AGCAAAACGCAGCAGGAAACTTCCACTGCCCGATGTGTCGTCAATTGATT
TATGCGTGTCATTGAACATTTTACCGATTGGAACTCGTTCCGGTCAACTG
AGGATACTTTCTCTCAATACCAATTATGTGAATAGTCTACTAAAATCCAG
ATCGTATTCCTTTAAAGCCTGTAGAGAAATCCCAATAACCAGCAAATTTT
ATCTCCAATATCGATTAATGCAAATAGACTCGAATAAAAACCGGAAACCC
CTCATCAAATCGGAAAATGGCACCCCAACAGTTTCCTCCTATAATTCTTG
TTGCAGTTGCCCCCCAAAACTCCAATGTGTTCACAAACTCAGCCTGAAAT
TCTCCATTTCCGTATCTAAAACTCCCGTTGATGACAGAAACAATTGGCAA
CTTGATTCCATGCTGAACATCAATGAGATTGCAACCAATCCAAATCCTCG
ATGTAGCACTTGGATTGCTGTTTCCCTTGAATGTGGTGTCATACATATCG
TTCCGTTGACGCATTTCTATCGATCGGAACTCGACCAAATATCCACCGGA
TCTTGTTGTAATGACCTCAATGAATCGTCCAATCAACTGATAGATGAATC
ACTGCTGCCGAAAAATATCGTATACGCTCCAAAATTCGGAAGGCCCCGTA
AATGCCCTCGCAGCTTCACCTATCAAAACCTTTATCAGAAAAAAATAGCT
CTCAAAAGTATTGGACGATCAATTAAATCTGAAGAGGTTTCAGCCAATTC
CAGCAGGAATCTCAGTAAACCTTTGAGTGGCATTAGAGATTTTTCTTTGA
GAAGCAAATCGACTTTAATCACGGATTATTTCGTGAATTCCAGCGCTGGA
AACATCGGTTTGAACACATTCCAATGCAGCACTCCTAAAAGGCAGAAACT
AATCACCAATTTATCAACGCCGAAAGTCAATAATCCATCAAAATCAAAAA
GTGCAAAAATTGCTATTCAGAGAACTTTGAGATCGAATTCAAATTCAACT
CCAATACAAAACAGCGAATCAATAACCGTTCCGTTCAGCGATGTCAAAAT
GTCACTCGTTGCGTCCACTAGGCAACGGTTGCGATCTTTCACCGGGTTCA
ATGTCGACAGCGATGCATTGGTCAAAGGAAACGAACTCATTGAAACGAGA
TCTCCTTCGTTTGAAACTGTTGATTTTGGTAGTTCATCACTGGAAAAGGA
TGCCGATCCTCATAGGAAATTGCAATCATCACAAAAGCCGTTGAATACTA
CTTCCGTTGGTGATAATTCAATCAATAAATTGACTAATGAAATTTCGGAT
ATGAGAAAAAGAACACGATCTTTCAACCAATTAGATAAGTTTATGAATAA
TCATTCTAAATCTCCTGGGAAATCCAATAACAACAATGGAAACCCTGTAG
AAACTTCTATCAATATCGATCCAGGAAAAAAGAGAAATAGATCGATATCT
TTTGAAAGTTCAGATTTAAATATATCTATAGACAATACATCGATAATAAA
GCCAATGAGAGATAGATTAAGGTCTTTTGATAGACCGAATATTTCTCTTG
TTACTCGTTCAGATATAAATCCAATTATTGACAATAAATCGATTGCAGGG
TCAATGAGACAAAGAAAACTGTCAATTGACCTATCAGATGAATCTGTAGA
AAAATTCAATAATAACAATGAAAAACCGCCCAAAACCTCCATCAGTATCG
ATAAGAAATCAGGGGGAAATAAATCAAAAGATTCCATTAGAAAGCAAACA
CGTTCTCACAGCAAATCAGATAATATGGGTAATTCTTCTAAATCTCACAT
GAAAACATTTGCCATTATCGATTTAGAAATAAAGGCCAATCAATCGATAT
CTTGTAAAAGCTCAGATTTAAATAAAATTATTGATGCTAATAAATCAATA
ATTGAGCCTATGAGAAAAAGAACTCGTTCTATTAACCAATCAGACAATAT
TATGACAAATTGCTCTAAATCTCTCGCAAAATCTAATAATTACAATAAAG
TACCCGTGAAAACATCTATCAAAACCGATCAGGGAAAACCCAGAAATAGA
TCGATATCTTGTGAAAGTTCAGAACTAAATACATCGATAATAGAGCAGCC
AATGAGACTGAGGTCCTTTGATGTTTATCATAACTCAGATATTCCCGATA
TTGCTCTCACGTGCCTGGGAACATCGATAACCATTCACGAGGATCCTGTG
AAATTGTCTGATAATAATAATAATAATATCAAATCACTACAAAAGCGAAA
GAAATCCATGTCTAATGAGCATTCACAATTGAATAGCTCAACAGAGCCAT
TGAGAAAAAGATTGCGTTCCTCTGAAAAACGGAATCCTTTAGTTCCTGCT
GACGGTTCCAATGATTTCGATGGGAAAATTGAGCACAGTCTGAGAAACCG
AGTTTATTCCTTTAGCTCCGACAATAAACTGAACATGAAACCCGCTGTTG
TCCTAGAGAATCTTAACCTCAAGATGAAAAGTTCACCAATCAAAAAAGTT
GCCAATAAAAAAAAATTGAAAAAAATCGATAAAATCAAAAAACCATTATT
GACAAATCAAAAAACAATAAAAATAACAAAGAATCCAGTTAAAATATTGA
AAATCAATGAAACCATTGAAAATGAATCAAAGAAACACCCAAAATCATTT
AAAATTGATAAAGATTTTTGTCAAATACAAAAAGATAAAGAAAAGGCGTC
AACCAAGCATAAAGAAATTAAGAAAAATCAGATTGGTAAAGATAATGGAG
AAATCAAAGAAACTGCTGGAACTGAATCAAATTTGGATTCAGAATCAAAG
AAACAACCAAACTCATTGAAAATCGATAAATATTCTGCTCAGTTAGCAAG
CAAAGAAATAGCTGTAAATCCAGCTAGGAAGTCCGCGATAAAAGATATGA
AGGAATATGATCAATCAAGAAAATCAATAGTTAATGAAGAAACACCGAAA
ATGTCGATAAGTTATGAAAATGTTCCCGAAAATGACATTGAAAGAACTGG
AATAGGAATTACAGAAGCAAATGCAGGAAGCTCAAATAAAGAACTATCTC
AAAATTTTGTAGACTTGCAAATACTCAATGAAAAGTCATCTAGCCATTTC
AAAACAATTAATACTAATGAGACCTCTTATAAGAAGCCGGTGCCTTTGAC
CCCGTTTAGGAGATTCTTAAATACAGATATTGATGAAGAAGACGAAAGTG
ATTCAGTTCTAATAAATTTTTCTCGTAAATCTACGCTTTCAATAAGCAGT
ACTCATTCAACACAAGAAAAAATCAATAAAATTGGAAGTTTTGATTTTTC
AGAATCACATATTGACTTCCAGTCGACTCCGAAAGTTTCAGATACAAAAG
AAAAATCAGAAATAATTAATAAGAATAAAATCTCTCGATTGAATGTTTCA
GGATTCCTATCAATTTCTCATTCAACTCCAAAAATTTCAGAAGCCAAGGA
AGAATCAGAAAAAATCAATAAAAATAAAATCTCATTTGAAAATGATAAAA
AATCAATTTCAATTTCAGAAGTCAATAAAAACACAGAAAACATCAATAAA
AATAAAATCTCATCTGAAAATGCTCAAGATCCAATTGGAATTTGTAAAGC
CGATGGAAACACGGAAAAAATCAATAAAATCTCTCGACTGAATTTCTCAG
GATTGCTATCTCAATCAACTCCAAAAGCTTCAGAAGTAAGTGAAAAACAT
GTAAAAATTAAAAGACAAGAAAAAAGCATCAAGAATTCACTTGATGATTC
AAAAACAGAATTAAAGAAATCAAAACTTCAGAAAGCAAGCGATGAGAGAT
TACAGAAACTTCAAGTCATAATGAACTCGAAGAGATTGGCTCTGTTAAAC
AGTCAAAGCACGAATATTAATAAGATCGATCCAGTTACCTCGGCAACCAC
TTCAACTGCCTTGGTTACTGCTACAACTCGCAAGATTACCACCCCGAAGT
CCTTGGTTAGCACTCAAAAGCCCTTGGTTACCGTCCCAAATCCCTTGGTT
ACCACTCCAACGTCATTGATTACTGCTCCTACGCCATTGGTTAACGCTCC
AACTCCTAAGATTACAATCCAGTCGCCAGTATCGAGTGTCAAGTCCAACT
GGTGGGGGGTTAATAACAAAGTCGATGATCTTTATTTAAAAACCAGCTTC
ACCGCTTCTCCGAAATGGAAATCAATCATCAATACGTCCTGTGAAGATCG
GATGGATAAGATAAAACAAGTAATCAATCGTGGGCTTTCACAATCCAATT
CTGATTGCTTGACTATTAATTATAATAATATTAGTAATAACAGTAATAGT
GATTTCCCAGAATTATTGCAACCGTTTCGGCCGTTGAAAGCTTCCAAAAG
TATAAATACTTCGTTGTCAATCGATTCTTGATCACATTCGCGTATAATCC
GGGTTATTTAATTGGCAATGTAAATTGGAATTTTATTGATCAAGATCGG
back to top

protein sequence of SMED30000041-orf-1

>SMED30000041-orf-1 ID=SMED30000041-orf-1|Name=SMED30000041-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1963bp
MRNKRLAAIQCIKNIHNSYKYNSQESSSVGDKSQYGILEDSSTNTDTISL
KDDIENVIEEIPDLIIEKFNSVHESDNFPKSNRKYFSIENAALFWRAKNQ
NSNNGLSLLEWSFKKNLNYFNELSQSDYWADKILTDIDIELEIFQYLKEA
FFPNRGYLVDISKTDKKREILGSLGKISILKDENELIHEVLLPCNSTPVL
NPVVDQHGIFINSGSYIKKMSWAPINAELHTDQYLAVSVYKAPTDRSNFY
ESGISPNQIIQIYNCGPLTMKTKSAARAQLEMILTHDWGKITDMAWSPQP
LPAVGRRSDNLLIGHLALCCTDGFIRIVPIGKPSVANCLLKLDSNHPVIC
LGAIRNKQNKEVFPVTMHWRQEFPDRIVAGYNTGHVGTFVLEACVFLSVA
RIIGVNIYLKPAVFHRVFHSPFRSIQISPFNWQLVSCSSMTMSNAVVVDL
GQPSDMILPSPIDMEATIGSKIIWPIPGDVVVLAAGKYLHNKPGVLLCSA
QKPAKRSRKLPLPDVSSIDLCVSLNILPIGTRSGQLRILSLNTNYVNSLL
KSRSYSFKACREIPITSKFYLQYRLMQIDSNKNRKPLIKSENGTPTVSSY
NSCCSCPPKLQCVHKLSLKFSISVSKTPVDDRNNWQLDSMLNINEIATNP
NPRCSTWIAVSLECGVIHIVPLTHFYRSELDQISTGSCCNDLNESSNQLI
DESLLPKNIVYAPKFGRPRKCPRSFTYQNLYQKKIALKSIGRSIKSEEVS
ANSSRNLSKPLSGIRDFSLRSKSTLITDYFVNSSAGNIGLNTFQCSTPKR
QKLITNLSTPKVNNPSKSKSAKIAIQRTLRSNSNSTPIQNSESITVPFSD
VKMSLVASTRQRLRSFTGFNVDSDALVKGNELIETRSPSFETVDFGSSSL
EKDADPHRKLQSSQKPLNTTSVGDNSINKLTNEISDMRKRTRSFNQLDKF
MNNHSKSPGKSNNNNGNPVETSINIDPGKKRNRSISFESSDLNISIDNTS
IIKPMRDRLRSFDRPNISLVTRSDINPIIDNKSIAGSMRQRKLSIDLSDE
SVEKFNNNNEKPPKTSISIDKKSGGNKSKDSIRKQTRSHSKSDNMGNSSK
SHMKTFAIIDLEIKANQSISCKSSDLNKIIDANKSIIEPMRKRTRSINQS
DNIMTNCSKSLAKSNNYNKVPVKTSIKTDQGKPRNRSISCESSELNTSII
EQPMRLRSFDVYHNSDIPDIALTCLGTSITIHEDPVKLSDNNNNNIKSLQ
KRKKSMSNEHSQLNSSTEPLRKRLRSSEKRNPLVPADGSNDFDGKIEHSL
RNRVYSFSSDNKLNMKPAVVLENLNLKMKSSPIKKVANKKKLKKIDKIKK
PLLTNQKTIKITKNPVKILKINETIENESKKHPKSFKIDKDFCQIQKDKE
KASTKHKEIKKNQIGKDNGEIKETAGTESNLDSESKKQPNSLKIDKYSAQ
LASKEIAVNPARKSAIKDMKEYDQSRKSIVNEETPKMSISYENVPENDIE
RTGIGITEANAGSSNKELSQNFVDLQILNEKSSSHFKTINTNETSYKKPV
PLTPFRRFLNTDIDEEDESDSVLINFSRKSTLSISSTHSTQEKINKIGSF
DFSESHIDFQSTPKVSDTKEKSEIINKNKISRLNVSGFLSISHSTPKISE
AKEESEKINKNKISFENDKKSISISEVNKNTENINKNKISSENAQDPIGI
CKADGNTEKINKISRLNFSGLLSQSTPKASEVSEKHVKIKRQEKSIKNSL
DDSKTELKKSKLQKASDERLQKLQVIMNSKRLALLNSQSTNINKIDPVTS
ATTSTALVTATTRKITTPKSLVSTQKPLVTVPNPLVTTPTSLITAPTPLV
NAPTPKITIQSPVSSVKSNWWGVNNKVDDLYLKTSFTASPKWKSIINTSC
EDRMDKIKQVINRGLSQSNSDCLTINYNNISNNSNSDFPELLQPFRPLKA
SKSINTSLSIDS*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: INTERPRO
TermDefinition
IPR036322WD40_repeat_dom_sf
IPR017986WD40_repeat_dom
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 1646..1666
NoneNo IPR availableCOILSCoilCoilcoord: 1244..1264
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1065..1090
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 892..922
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 952..972
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1723..1762
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 952..981
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1247..1286
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1054..1101
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1729..1762
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1397..1439
NoneNo IPR availablePANTHERPTHR15052RNA POLYMERASE III TRANSCRIPTION INITIATION FACTOR COMPLEX SUBUNITcoord: 198..431
NoneNo IPR availablePANTHERPTHR15052:SF2GENERAL TRANSCRIPTION FACTOR 3C POLYPEPTIDE 2coord: 198..431
IPR036322WD40-repeat-containing domain superfamilySUPERFAMILYSSF50978WD40 repeat-likecoord: 216..551