Ribosome-binding protein 1

Overview
NameRibosome-binding protein 1
Smed IDSMED30000038
Length (bp)2845
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Ribosome-binding protein 1 (SMED30000038) t-SNE clustered cells

Violin plots show distribution of expression levels for Ribosome-binding protein 1 (SMED30000038) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Ribosome-binding protein 1 (SMED30000038) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Ribosome-binding protein 1 (SMED30000038) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30000038

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 20

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynxSMED30000038SMESG000031975.1 dd_Smed_v4_1111_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30000038SMESG000031975.1 dd_Smed_v4_1111_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30000038SMESG000031975.1 dd_Smed_v4_1111_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30000038SMESG000031975.1 dd_Smed_v4_1111_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30000038SMESG000031975.1 dd_Smed_v4_1111_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30000038SMESG000031975.1 dd_Smed_v4_1111_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parapharyngeal regionSMED30000038SMESG000031975.1 dd_Smed_v4_1111_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30000038SMESG000031975.1 dd_Smed_v4_1111_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30000038SMESG000031975.1 dd_Smed_v4_1111_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30000038SMESG000031975.1 dd_Smed_v4_1111_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30000038SMESG000031975.1 dd_Smed_v4_1111_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30000038SMESG000031975.1 Contig4127newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30000038SMESG000031975.1 Contig4127uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30000038SMESG000031975.1 SMESG000031976.1 Contig53906newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30000038SMESG000031975.1 SMESG000031976.1 Contig53906uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30000038SMESG000007868.1 Contig4127newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30000038SMESG000007868.1 Contig4127uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
parapharyngeal regionSMED30000038SMESG000031975.1 dd_Smed_v6_1111_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
intestinal phagocyteSMED30000038SMESG000031975.1 dd_Smed_v6_1111_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
secretory systemSMED30000038SMESG000031975.1 dd_Smed_v6_1111_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Ribosome-binding protein 1 vs. TrEMBL
Match: A0A1I8GEB2 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 88.5817 bits (218), Expect = 3.425e-14
Identity = 52/114 (45.61%), Postives = 75/114 (65.79%), Query Frame = 1
Query: 1756 YKTGLESTESILSKLQTSVNEEESKWRESLIXXXXXXXXXXXXXXIVYNDLMRIRNSRTDN-NELNFAYHCVDKSLSSLLDEMEARMIHFEKSLETVVQERDTALSQISSQING 2094
            YK  LE +E +L KL+ SV EEE++W+ +L  SE +VEK K  L    ++L R R S  D+  +LNFAYHCV+KSL++++DEME ++   E  L  V  ERD+A  QI +++ G
Sbjct:  454 YKLALEYSEGVLKKLEASVEEEEARWKSALCASEADVEKYKAALASAVSELRRYRGSSNDDLTDLNFAYHCVEKSLTNIVDEMEQKVKEMEDKLGKVSAERDSA-KQIQAKLQG 566          
BLAST of Ribosome-binding protein 1 vs. TrEMBL
Match: A0A267H9F3 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig001185g1 PE=4 SV=1)

HSP 1 Score: 87.4261 bits (215), Expect = 5.164e-14
Identity = 52/115 (45.22%), Postives = 76/115 (66.09%), Query Frame = 1
Query: 1753 QYKTGLESTESILSKLQTSVNEEESKWRESLIXXXXXXXXXXXXXXIVYNDLMRIRNSRTDN-NELNFAYHCVDKSLSSLLDEMEARMIHFEKSLETVVQERDTALSQISSQING 2094
            +YK  LE +E +L KL+ SV EEE++W+ +L  SE +VEK K  L    ++L R R S  D+  +LNFAYHCV+KSL++++DEME ++   E  L  V  ERD+A  QI +++ G
Sbjct:  258 KYKLALEYSEGVLKKLEASVEEEEARWKSALCASEADVEKYKAALASAVSELRRYRGSSNDDLTDLNFAYHCVEKSLTNIVDEMEQKVKEMEDKLGKVSAERDSA-KQIQAKLQG 371          
BLAST of Ribosome-binding protein 1 vs. TrEMBL
Match: A0A1I8HIP6 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 75.8702 bits (185), Expect = 3.038e-10
Identity = 41/87 (47.13%), Postives = 62/87 (71.26%), Query Frame = 1
Query: 1756 YKTGLESTESILSKLQTSVNEEESKWRESLIXXXXXXXXXXXXXXIVYNDLMRIRNSRTDN-NELNFAYHCVDKSLSSLLDEMEARM 2013
            YK  LE +E +L KL+ SV EEE++W+ +L  SE +VEK K  L    ++L R R S  D+  +LNFAYHCV+KSL++++DE++A++
Sbjct:  402 YKLALEYSEGVLKKLEASVEEEEARWKSALCASEADVEKYKAALASAVSELRRYRGSSNDDLTDLNFAYHCVEKSLTNIVDEIQAKL 488          
BLAST of Ribosome-binding protein 1 vs. TrEMBL
Match: A0A0B7BL77 (Uncharacterized protein OS=Arion vulgaris OX=1028688 GN=ORF192003 PE=4 SV=1)

HSP 1 Score: 73.9442 bits (180), Expect = 1.308e-9
Identity = 99/355 (27.89%), Postives = 180/355 (50.70%), Query Frame = 1
Query: 1300 DLLTAKSAH-TDLLEENLRLQKQCAELEQSTVLKQQDLADFDNKLKQNEEQITCLKKQI------NDLNT-MNINLSVLKSDLEKQVDQLHSSQSTVNSQEIIELTE-KVKILTQQLIDAKTELATRQMKL------EEFDSSCAQHLTQLKELTTERDNLLALVDQYKTGLESTESILSKLQTSVNEEESKWRESLIXXXXXXXXXXXXXXIVYNDLMRIRNSRTDNNELNFAYHCVDKSLSSLLDEMEARMIHFEKSLE-------TVVQERDTALSQIS-SQINGVSVNHEIVNGDDHSIQNDDSEKLIVE----LEHQTELNKSLENQCNKFKSLIDIGKDALESEKSRVR 2283
            ++LTAK     +L E+N R+ KQ  + E+  V    +L   + KLKQ E +   LK  +      N+  T +  + S LKSDLE             N   I+  TE K++ L ++ IDA+ +    ++K       E+ DS   Q + +L+ L  ++D   + V +Y+  L  TE  L + ++ +  +E  W+E L  +++++ ++K  +     ++   + S+ D ++L FAYHCV+KSL++++DEM+ ++   E  L         + +E++T ++Q++ +QI       ++ +GD  S+     EK +VE    LE + + NK L     K   +I  G+DAL  E++ V+
Sbjct:  418 NVLTAKGNKLIELEEQNKRIHKQLNDYEKQFV----ELNSQNEKLKQVEAENYQLKSSVTSKGGDNERYTQLETDNSRLKSDLE-------------NYHSIVAETENKLRQL-EKSIDAEEKKWQEKLKQAQSHPKEQGDSGLPQRIKELELLVAQQD---SQVQEYRRVLSLTEDRLREFESKIESQEKTWQEKLETAQSKLTQTKTPVSSSSQEIQVSQGSQEDLSDLGFAYHCVEKSLTTIVDEMQTKVAELEDELREAHEMIIVITKEKETVITQLTETQI-------QVSSGDTKSL-----EKELVEIRTILESERKKNKDLSLNVVKLNGIIKTGQDALSQEQNVVK 739          
BLAST of Ribosome-binding protein 1 vs. TrEMBL
Match: A0A0B7BLU2 (Uncharacterized protein OS=Arion vulgaris OX=1028688 GN=ORF192034 PE=4 SV=1)

HSP 1 Score: 73.9442 bits (180), Expect = 1.386e-9
Identity = 99/355 (27.89%), Postives = 180/355 (50.70%), Query Frame = 1
Query: 1300 DLLTAKSAH-TDLLEENLRLQKQCAELEQSTVLKQQDLADFDNKLKQNEEQITCLKKQI------NDLNT-MNINLSVLKSDLEKQVDQLHSSQSTVNSQEIIELTE-KVKILTQQLIDAKTELATRQMKL------EEFDSSCAQHLTQLKELTTERDNLLALVDQYKTGLESTESILSKLQTSVNEEESKWRESLIXXXXXXXXXXXXXXIVYNDLMRIRNSRTDNNELNFAYHCVDKSLSSLLDEMEARMIHFEKSLE-------TVVQERDTALSQIS-SQINGVSVNHEIVNGDDHSIQNDDSEKLIVE----LEHQTELNKSLENQCNKFKSLIDIGKDALESEKSRVR 2283
            ++LTAK     +L E+N R+ KQ  + E+  V    +L   + KLKQ E +   LK  +      N+  T +  + S LKSDLE             N   I+  TE K++ L ++ IDA+ +    ++K       E+ DS   Q + +L+ L  ++D   + V +Y+  L  TE  L + ++ +  +E  W+E L  +++++ ++K  +     ++   + S+ D ++L FAYHCV+KSL++++DEM+ ++   E  L         + +E++T ++Q++ +QI       ++ +GD  S+     EK +VE    LE + + NK L     K   +I  G+DAL  E++ V+
Sbjct:  418 NVLTAKGNKLIELEEQNKRIHKQLNDYEKQFV----ELNSQNEKLKQVEAENYQLKSSVTSKGGDNERYTQLETDNSRLKSDLE-------------NYHSIVAETENKLRQL-EKSIDAEEKKWQEKLKQAQSHPKEQGDSGLPQRIKELELLVAQQD---SQVQEYRRVLSLTEDRLREFESKIESQEKTWQEKLETAQSKLTQTKTPVSSSSQEIQVSQGSQEDLSDLGFAYHCVEKSLTTIVDEMQTKVAELEDELREAHEMIIVITKEKETVITQLTETQI-------QVSSGDTKSL-----EKELVEIRTILESERKKNKDLSLNVVKLNGIIKTGQDALSQEQNVVK 739          
BLAST of Ribosome-binding protein 1 vs. Planmine SMEST
Match: SMESG000031975.1 (SMESG000031975.1)

HSP 1 Score: 1400.96 bits (3625), Expect = 0.000e+0
Identity = 764/768 (99.48%), Postives = 765/768 (99.61%), Query Frame = 1
Query:   61 MISSFLELCLTFGLGILISGLAFLWTRRSLSVDDDIVLPKEDYKIKNKISKVPVKAKVTKKDFTTAKLKNNIKTAQKSTVNAVKNNETFKDVTENKVSAVERNRNDSTAEWXXXXXXXXXXXXESKSDSFDLSAQEESVKHSTLENNQKETVKSCDKPKVENPIKIELDKELKTEKVPEKPIEAVKNQTVKSKKFVTVEEEPKTLPQPEKIETKPTPVSPDSDNIQQKIAEMMVDLDKMRNNQKDDNKGNSQIXXXXXXXXXXXXTSQANEQKLLEDVKKKGQAVSDLKNQFLIIQSELTKNIVANQSINREKLSLENRLRSVEEQNALITEKCQQFENLKIENEGLEKNFKAIEQELKSVKLEYSDIIKSQEREMLTQINVLQSEKHRMQDQLVRVQNDLIGNNNKMQNVQQDLLTAKSAHTDLLEENLRLQKQCAELEQSTVLKQQDLADFDNKLKQNEEQITCLKKQINDLNTMNINLSVLKSDLEKQVDQLHSSQSTVNSQEIIELTEKVKILTQQLIDAKTELATRQMKLEEFDSSCAQHLTQLKELTTERDNLLALVDQYKTGLESTESILSKLQTSVNEEESKWRESLIXXXXXXXXXXXXXXIVYNDLMRIRNSRTDNNELNFAYHCVDKSLSSLLDEMEARMIHFEKSLETVVQERDTALSQISSQINGVSVNHEIVNGDDHSIQNDDSEKLIVELEHQTELNKSLENQCNKFKSLIDIGKDALESEKSRVRXXXXXXXXXXXXITNVSTNNVEVSLDA 2364
            MISSFLELCLTFGLGILISGLAFLWTRRSLSVDDDIVLPKEDYKIKNKISKVPVKAKVTKKDFTTAKLKNNIKTAQKSTVNAVKNNETFKDVTENKVSAVERNRNDSTAEWTKVTKPTKKPKKESKSDSFDLSAQEESVKHSTLENNQKETVKSCDKPKVENPIKIELDKELKTEKVPEKPIE VKNQTVKSKKFVTVEEEPKTLPQPEKIETKPT VS DSDNIQQKIAEMMVDLDKMRNNQKDDNKGNSQISKELESLKLKLKTSQANEQKLLEDVKKKGQAVSDLKNQFLIIQSELTKNIVANQSINREKLSLENRLRSVEEQNALITEKCQQFENLKIENEGLEKNFKAIEQELKSVKLEYSDIIKSQEREMLTQINVLQSEKHRMQDQLVRVQNDLIGNNNKMQNVQQDLLTAKSAHTDLLEENLRLQKQCAELEQSTVLKQQDLADFDNKLKQNEEQITCLKKQINDLNTMNINLSVLKSDLEKQVDQLHSSQSTVNSQEIIELTEKVKILTQQLIDAKTELATRQMKLEEFDSSCAQHLTQLKELTTERDNLLALVDQYKTGLESTESILSKLQTSVNEEESKWRESLIKSENEVEKSKKELEIVYNDLMRIRNSRTDNNELNFAYHCVDKSLSSLLDEMEARMIHFEKSLETVVQERDTALSQISSQINGVSVNHEIVNG+DHSIQNDDSEKLIVELEHQTELNKSLENQCNKFKSLIDIGKDALESEKSRVRELEQELSSLQSLITNVSTNNVEVSLDA
Sbjct:    1 MISSFLELCLTFGLGILISGLAFLWTRRSLSVDDDIVLPKEDYKIKNKISKVPVKAKVTKKDFTTAKLKNNIKTAQKSTVNAVKNNETFKDVTENKVSAVERNRNDSTAEWTKVTKPTKKPKKESKSDSFDLSAQEESVKHSTLENNQKETVKSCDKPKVENPIKIELDKELKTEKVPEKPIEPVKNQTVKSKKFVTVEEEPKTLPQPEKIETKPTLVSHDSDNIQQKIAEMMVDLDKMRNNQKDDNKGNSQISKELESLKLKLKTSQANEQKLLEDVKKKGQAVSDLKNQFLIIQSELTKNIVANQSINREKLSLENRLRSVEEQNALITEKCQQFENLKIENEGLEKNFKAIEQELKSVKLEYSDIIKSQEREMLTQINVLQSEKHRMQDQLVRVQNDLIGNNNKMQNVQQDLLTAKSAHTDLLEENLRLQKQCAELEQSTVLKQQDLADFDNKLKQNEEQITCLKKQINDLNTMNINLSVLKSDLEKQVDQLHSSQSTVNSQEIIELTEKVKILTQQLIDAKTELATRQMKLEEFDSSCAQHLTQLKELTTERDNLLALVDQYKTGLESTESILSKLQTSVNEEESKWRESLIKSENEVEKSKKELEIVYNDLMRIRNSRTDNNELNFAYHCVDKSLSSLLDEMEARMIHFEKSLETVVQERDTALSQISSQINGVSVNHEIVNGEDHSIQNDDSEKLIVELEHQTELNKSLENQCNKFKSLIDIGKDALESEKSRVRELEQELSSLQSLITNVSTNNVEVSLDA 768          
The following BLAST results are available for this feature:
BLAST of Ribosome-binding protein 1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Ribosome-binding protein 1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Ribosome-binding protein 1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Ribosome-binding protein 1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Ribosome-binding protein 1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Ribosome-binding protein 1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Ribosome-binding protein 1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Ribosome-binding protein 1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1I8GEB23.425e-1445.61Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A267H9F35.164e-1445.22Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A1I8HIP63.038e-1047.13Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A0B7BL771.308e-927.89Uncharacterized protein OS=Arion vulgaris OX=10286... [more]
A0A0B7BLU21.386e-927.89Uncharacterized protein OS=Arion vulgaris OX=10286... [more]
back to top
BLAST of Ribosome-binding protein 1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Ribosome-binding protein 1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Ribosome-binding protein 1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Ribosome-binding protein 1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Ribosome-binding protein 1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Ribosome-binding protein 1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000031975.10.000e+099.48SMESG000031975.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30000038 ID=SMED30000038|Name=Ribosome-binding protein 1|organism=Schmidtea mediterranea sexual|type=transcript|length=2845bp
ATATAATCTACGTCACTGACCTTTATCAATTCACAAATTGTGGTTTTATT
AGCAGATTTAATGATAAGTTCTTTTCTTGAATTATGTTTGACTTTTGGTC
TGGGAATACTAATATCAGGATTGGCATTTTTATGGACTCGAAGAAGTTTG
TCAGTAGATGATGACATAGTTTTGCCGAAAGAAGACTATAAAATTAAGAA
TAAAATTTCTAAAGTACCCGTGAAAGCTAAAGTTACCAAAAAAGATTTCA
CGACTGCAAAACTCAAAAATAATATTAAAACAGCACAGAAATCAACTGTA
AATGCCGTTAAAAATAATGAAACTTTCAAAGATGTTACTGAAAATAAAGT
ATCCGCAGTAGAACGAAACAGAAATGATTCAACAGCAGAGTGGACTAAAG
TAACTAAGCCAACAAAAAAACCCAAGAAGGAATCCAAATCTGATTCATTT
GATTTATCAGCCCAAGAGGAAAGTGTAAAACATTCTACGTTAGAAAATAA
CCAAAAAGAAACTGTTAAGTCTTGCGATAAACCTAAAGTTGAAAATCCAA
TCAAAATCGAACTAGATAAAGAATTGAAGACGGAAAAAGTTCCGGAAAAA
CCAATTGAAGCAGTAAAGAATCAGACAGTAAAATCAAAGAAATTCGTTAC
AGTTGAAGAAGAACCAAAAACTTTACCACAACCGGAGAAAATCGAAACAA
AACCAACTCCAGTTTCCCCTGACAGTGATAATATACAACAGAAAATCGCA
GAAATGATGGTGGACTTGGATAAAATGAGAAACAATCAGAAGGATGACAA
TAAAGGCAACAGTCAAATCAGTAAAGAATTGGAATCATTGAAATTGAAAT
TGAAAACCAGCCAAGCCAACGAACAAAAATTGCTTGAAGATGTCAAAAAG
AAAGGCCAGGCTGTTAGCGATTTGAAAAACCAATTTCTCATTATCCAATC
AGAATTGACGAAAAATATTGTTGCTAATCAATCGATTAACCGCGAAAAAT
TGAGTTTGGAAAATCGGCTCCGGTCTGTTGAGGAACAAAATGCATTAATA
ACCGAGAAGTGCCAACAGTTTGAAAATTTGAAAATCGAAAACGAAGGATT
GGAGAAAAATTTCAAGGCCATTGAACAAGAATTGAAAAGTGTCAAACTGG
AATATTCAGATATCATAAAATCCCAAGAACGAGAAATGCTGACCCAGATC
AATGTGTTGCAGTCAGAAAAACATCGAATGCAAGATCAATTAGTTCGTGT
GCAAAACGATCTCATTGGAAATAACAATAAAATGCAAAATGTGCAACAGG
ATTTACTGACGGCCAAGAGTGCGCATACTGATCTATTAGAGGAAAATTTA
CGATTGCAAAAACAATGTGCGGAGTTGGAACAATCGACGGTGTTGAAGCA
ACAGGACTTGGCAGATTTTGACAATAAATTAAAACAAAACGAAGAACAAA
TTACATGCCTAAAGAAACAGATCAATGACCTAAATACAATGAATATCAAT
CTTTCTGTATTGAAATCTGATCTTGAAAAACAGGTCGATCAGTTGCACAG
TTCACAATCGACTGTAAATAGCCAAGAAATCATTGAACTTACTGAGAAAG
TAAAAATTCTCACTCAACAGCTTATTGATGCAAAAACAGAATTGGCAACA
CGTCAAATGAAATTAGAAGAATTCGATTCTTCATGTGCACAACATTTGAC
ACAATTAAAAGAATTAACTACAGAACGAGATAATTTATTGGCATTAGTTG
ATCAATATAAAACCGGTCTGGAATCTACAGAATCAATCCTATCGAAATTG
CAAACATCTGTCAATGAAGAAGAGAGCAAATGGAGAGAAAGCCTAATAAA
ATCTGAGAATGAAGTTGAAAAGAGCAAAAAAGAATTAGAAATTGTTTACA
ATGACTTGATGAGAATTAGAAATTCACGAACCGACAATAACGAGTTGAAT
TTCGCTTATCACTGTGTTGACAAGAGTCTTTCTTCATTGCTTGATGAGAT
GGAAGCTAGAATGATCCATTTCGAGAAAAGTCTTGAAACAGTTGTACAGG
AGCGAGACACAGCTCTTTCTCAGATATCATCGCAAATTAACGGAGTGTCC
GTTAATCATGAAATTGTTAATGGCGACGACCATTCTATTCAGAATGATGA
TTCTGAGAAGCTAATAGTTGAGCTTGAACATCAAACAGAACTCAACAAAT
CCCTGGAAAATCAGTGCAATAAATTTAAATCATTAATTGATATTGGCAAA
GATGCTCTTGAATCTGAAAAATCCCGTGTTAGAGAACTCGAACAAGAACT
ATCATCATTGCAATCTTTGATTACAAATGTTTCCACTAATAATGTTGAAG
TTTCCTTAGATGCATAATGATTTTGCGCAGTCGTGAAATCAGTGACAACT
AAGTCATCGCAAAACAATCAGTCACTCTATTATTATTATTATTATTAATA
TTTCAATCTAAATCAAGTGTCAAAATAGTGTAAAGCTGTTAGTGATTTTG
CCAGTGAGGATCAGTGTGAATGTGCAGGCACAAGCTCATCAGATTATACA
TGTCATTTATCTTTTTTGATTAATTTTATGGAAATTCTCTCATAGAAATT
GTCAATGTAGAATTGCTACTGATCTGCATGTAGCTGGTATGCTTATATCA
GGCATTTTTGCATTGTGATTTTCTGAGTTTGTCTTTTGTGCCTTGGTCTA
GATTATTTTATCAGAATTTCCGTTCAAATAATTTGGAATCTGGGTATTGT
GTTGTTTTTGGGTACTTATTATTTGCTTTGTTCTCTTTGGACATTGGTTT
GTTGAATTGTATGATAAAATAAAGTTTTCTAAGTTCAAAAAAAAA
back to top

protein sequence of SMED30000038-orf-1

>SMED30000038-orf-1 ID=SMED30000038-orf-1|Name=SMED30000038-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=769bp
MISSFLELCLTFGLGILISGLAFLWTRRSLSVDDDIVLPKEDYKIKNKIS
KVPVKAKVTKKDFTTAKLKNNIKTAQKSTVNAVKNNETFKDVTENKVSAV
ERNRNDSTAEWTKVTKPTKKPKKESKSDSFDLSAQEESVKHSTLENNQKE
TVKSCDKPKVENPIKIELDKELKTEKVPEKPIEAVKNQTVKSKKFVTVEE
EPKTLPQPEKIETKPTPVSPDSDNIQQKIAEMMVDLDKMRNNQKDDNKGN
SQISKELESLKLKLKTSQANEQKLLEDVKKKGQAVSDLKNQFLIIQSELT
KNIVANQSINREKLSLENRLRSVEEQNALITEKCQQFENLKIENEGLEKN
FKAIEQELKSVKLEYSDIIKSQEREMLTQINVLQSEKHRMQDQLVRVQND
LIGNNNKMQNVQQDLLTAKSAHTDLLEENLRLQKQCAELEQSTVLKQQDL
ADFDNKLKQNEEQITCLKKQINDLNTMNINLSVLKSDLEKQVDQLHSSQS
TVNSQEIIELTEKVKILTQQLIDAKTELATRQMKLEEFDSSCAQHLTQLK
ELTTERDNLLALVDQYKTGLESTESILSKLQTSVNEEESKWRESLIKSEN
EVEKSKKELEIVYNDLMRIRNSRTDNNELNFAYHCVDKSLSSLLDEMEAR
MIHFEKSLETVVQERDTALSQISSQINGVSVNHEIVNGDDHSIQNDDSEK
LIVELEHQTELNKSLENQCNKFKSLIDIGKDALESEKSRVRELEQELSSL
QSLITNVSTNNVEVSLDA*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0030176integral component of endoplasmic reticulum membrane
GO:0016020membrane
GO:0016021integral component of membrane
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000026gut
PLANA:0000070intestinal phagocyte
PLANA:0000101muscle cell
PLANA:0000420parapharyngeal region
PLANA:0000484secretory system
PLANA:0002032epidermal cell
PLANA:0003116parenchymal cell
PLANA:0003117parapharyngeal cell
Vocabulary: INTERPRO
TermDefinition
IPR000489Pterin-binding_dom
Vocabulary: biological process
TermDefinition
GO:0042558pteridine-containing compound metabolic process
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 222..242
NoneNo IPR availableCOILSCoilCoilcoord: 422..442
NoneNo IPR availableCOILSCoilCoilcoord: 644..664
NoneNo IPR availableCOILSCoilCoilcoord: 250..277
NoneNo IPR availableCOILSCoilCoilcoord: 570..590
NoneNo IPR availableCOILSCoilCoilcoord: 380..400
NoneNo IPR availableCOILSCoilCoilcoord: 698..760
NoneNo IPR availableCOILSCoilCoilcoord: 450..477
NoneNo IPR availableCOILSCoilCoilcoord: 595..615
NoneNo IPR availableCOILSCoilCoilcoord: 306..364
NoneNo IPR availableCOILSCoilCoilcoord: 507..527
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 142..156
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 102..156
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 102..135
NoneNo IPR availableTMHMMTMhelixcoord: 5..27
IPR000489Pterin-binding domainPROSITEPS50972PTERIN_BINDINGcoord: 684..768
score: 9.151