SMED30000035

Overview
NameSMED30000035
Smed IDSMED30000035
Length (bp)1557
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SMED30000035 (SMED30000035) t-SNE clustered cells

Violin plots show distribution of expression levels for SMED30000035 (SMED30000035) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SMED30000035 (SMED30000035) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SMED30000035 (SMED30000035) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30000035

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 1

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
protonephridiaSMED30000035 dd_Smed_v4_8577_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Alignments
SMED30000035 aligns in the following genomic locations:
Alignment LocationAlignment Score
v31.001268:23901..26366 +7428
Homology
BLAST of SMED30000035 vs. Ensembl Human
Match: ACTA1 (actin alpha 1, skeletal muscle [Source:HGNC Symbol;Acc:HGNC:129])

HSP 1 Score: 50.0618 bits (118), Expect = 2.154e-13
Identity = 28/58 (48.28%), Postives = 34/58 (58.62%), Query Frame = -1
Query: 1165 ITECDFGIRNDM---------------IADCIRKEITSLGPSKMKIKIVVSPERKYSV 1293
            I +CD  IR D+               IAD ++KEIT+L PS MKIKI+  PERKYSV
Sbjct:  161 IMKCDIDIRKDLYANNVMSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSV 218          

HSP 2 Score: 45.8246 bits (107), Expect = 2.154e-13
Identity = 18/24 (75.00%), Postives = 20/24 (83.33%), Query Frame = -2
Query: 1077 FQQMWITKQEYEESAPEIVSRKCL 1148
            FQQMWITKQEY+E+ P IV RKC 
Sbjct:  231 FQQMWITKQEYDEAGPSIVHRKCF 254          
BLAST of SMED30000035 vs. Ensembl Human
Match: ACTA1 (actin alpha 1, skeletal muscle [Source:HGNC Symbol;Acc:HGNC:129])

HSP 1 Score: 50.0618 bits (118), Expect = 2.232e-13
Identity = 28/58 (48.28%), Postives = 34/58 (58.62%), Query Frame = -1
Query: 1165 ITECDFGIRNDM---------------IADCIRKEITSLGPSKMKIKIVVSPERKYSV 1293
            I +CD  IR D+               IAD ++KEIT+L PS MKIKI+  PERKYSV
Sbjct:  284 IMKCDIDIRKDLYANNVMSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSV 341          

HSP 2 Score: 45.8246 bits (107), Expect = 2.232e-13
Identity = 18/25 (72.00%), Postives = 20/25 (80.00%), Query Frame = -2
Query: 1077 NFQQMWITKQEYEESAPEIVSRKCL 1151
             FQQMWITKQEY+E+ P IV RKC 
Sbjct:  353 TFQQMWITKQEYDEAGPSIVHRKCF 377          
BLAST of SMED30000035 vs. Ensembl Human
Match: ACTB (actin beta [Source:HGNC Symbol;Acc:HGNC:132])

HSP 1 Score: 49.6766 bits (117), Expect = 2.876e-13
Identity = 28/58 (48.28%), Postives = 34/58 (58.62%), Query Frame = -1
Query: 1165 ITECDFGIRNDM---------------IADCIRKEITSLGPSKMKIKIVVSPERKYSV 1293
            I +CD  IR D+               IAD ++KEIT+L PS MKIKI+  PERKYSV
Sbjct:  282 IMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSV 339          

HSP 2 Score: 45.4394 bits (106), Expect = 2.876e-13
Identity = 18/25 (72.00%), Postives = 20/25 (80.00%), Query Frame = -2
Query: 1077 NFQQMWITKQEYEESAPEIVSRKCL 1151
             FQQMWI+KQEY+ES P IV RKC 
Sbjct:  351 TFQQMWISKQEYDESGPSIVHRKCF 375          
BLAST of SMED30000035 vs. Ensembl Human
Match: ACTB (actin beta [Source:HGNC Symbol;Acc:HGNC:132])

HSP 1 Score: 49.6766 bits (117), Expect = 2.876e-13
Identity = 28/58 (48.28%), Postives = 34/58 (58.62%), Query Frame = -1
Query: 1165 ITECDFGIRNDM---------------IADCIRKEITSLGPSKMKIKIVVSPERKYSV 1293
            I +CD  IR D+               IAD ++KEIT+L PS MKIKI+  PERKYSV
Sbjct:  282 IMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSV 339          

HSP 2 Score: 45.4394 bits (106), Expect = 2.876e-13
Identity = 18/25 (72.00%), Postives = 20/25 (80.00%), Query Frame = -2
Query: 1077 NFQQMWITKQEYEESAPEIVSRKCL 1151
             FQQMWI+KQEY+ES P IV RKC 
Sbjct:  351 TFQQMWISKQEYDESGPSIVHRKCF 375          
BLAST of SMED30000035 vs. Ensembl Human
Match: ACTG1 (actin gamma 1 [Source:HGNC Symbol;Acc:HGNC:144])

HSP 1 Score: 49.6766 bits (117), Expect = 3.020e-13
Identity = 28/58 (48.28%), Postives = 34/58 (58.62%), Query Frame = -1
Query: 1165 ITECDFGIRNDM---------------IADCIRKEITSLGPSKMKIKIVVSPERKYSV 1293
            I +CD  IR D+               IAD ++KEIT+L PS MKIKI+  PERKYSV
Sbjct:  282 IMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSV 339          

HSP 2 Score: 45.4394 bits (106), Expect = 3.020e-13
Identity = 18/25 (72.00%), Postives = 20/25 (80.00%), Query Frame = -2
Query: 1077 NFQQMWITKQEYEESAPEIVSRKCL 1151
             FQQMWI+KQEY+ES P IV RKC 
Sbjct:  351 TFQQMWISKQEYDESGPSIVHRKCF 375          
BLAST of SMED30000035 vs. Ensembl Celegans
Match: act-4 (Actin-4 [Source:UniProtKB/Swiss-Prot;Acc:P10986])

HSP 1 Score: 50.447 bits (119), Expect = 8.852e-14
Identity = 28/58 (48.28%), Postives = 34/58 (58.62%), Query Frame = -1
Query: 1165 ITECDFGIRNDM---------------IADCIRKEITSLGPSKMKIKIVVSPERKYSV 1293
            I +CD  IR D+               IAD ++KEIT+L PS MKIKI+  PERKYSV
Sbjct:  239 IMKCDIDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSV 296          

HSP 2 Score: 45.4394 bits (106), Expect = 8.852e-14
Identity = 18/25 (72.00%), Postives = 20/25 (80.00%), Query Frame = -2
Query: 1077 NFQQMWITKQEYEESAPEIVSRKCL 1151
             FQQMWI+KQEY+ES P IV RKC 
Sbjct:  308 TFQQMWISKQEYDESGPSIVHRKCF 332          
BLAST of SMED30000035 vs. Ensembl Celegans
Match: act-4 (Actin-4 [Source:UniProtKB/Swiss-Prot;Acc:P10986])

HSP 1 Score: 50.447 bits (119), Expect = 8.852e-14
Identity = 28/58 (48.28%), Postives = 34/58 (58.62%), Query Frame = -1
Query: 1165 ITECDFGIRNDM---------------IADCIRKEITSLGPSKMKIKIVVSPERKYSV 1293
            I +CD  IR D+               IAD ++KEIT+L PS MKIKI+  PERKYSV
Sbjct:  239 IMKCDIDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSV 296          

HSP 2 Score: 45.4394 bits (106), Expect = 8.852e-14
Identity = 18/25 (72.00%), Postives = 20/25 (80.00%), Query Frame = -2
Query: 1077 NFQQMWITKQEYEESAPEIVSRKCL 1151
             FQQMWI+KQEY+ES P IV RKC 
Sbjct:  308 TFQQMWISKQEYDESGPSIVHRKCF 332          
BLAST of SMED30000035 vs. Ensembl Celegans
Match: act-4 (Actin-4 [Source:UniProtKB/Swiss-Prot;Acc:P10986])

HSP 1 Score: 50.447 bits (119), Expect = 8.852e-14
Identity = 28/58 (48.28%), Postives = 34/58 (58.62%), Query Frame = -1
Query: 1165 ITECDFGIRNDM---------------IADCIRKEITSLGPSKMKIKIVVSPERKYSV 1293
            I +CD  IR D+               IAD ++KEIT+L PS MKIKI+  PERKYSV
Sbjct:  239 IMKCDIDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSV 296          

HSP 2 Score: 45.4394 bits (106), Expect = 8.852e-14
Identity = 18/25 (72.00%), Postives = 20/25 (80.00%), Query Frame = -2
Query: 1077 NFQQMWITKQEYEESAPEIVSRKCL 1151
             FQQMWI+KQEY+ES P IV RKC 
Sbjct:  308 TFQQMWISKQEYDESGPSIVHRKCF 332          
BLAST of SMED30000035 vs. Ensembl Celegans
Match: act-4 (Actin-4 [Source:UniProtKB/Swiss-Prot;Acc:P10986])

HSP 1 Score: 50.447 bits (119), Expect = 8.852e-14
Identity = 28/58 (48.28%), Postives = 34/58 (58.62%), Query Frame = -1
Query: 1165 ITECDFGIRNDM---------------IADCIRKEITSLGPSKMKIKIVVSPERKYSV 1293
            I +CD  IR D+               IAD ++KEIT+L PS MKIKI+  PERKYSV
Sbjct:  239 IMKCDIDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSV 296          

HSP 2 Score: 45.4394 bits (106), Expect = 8.852e-14
Identity = 18/25 (72.00%), Postives = 20/25 (80.00%), Query Frame = -2
Query: 1077 NFQQMWITKQEYEESAPEIVSRKCL 1151
             FQQMWI+KQEY+ES P IV RKC 
Sbjct:  308 TFQQMWISKQEYDESGPSIVHRKCF 332          
BLAST of SMED30000035 vs. Ensembl Celegans
Match: act-4 (Actin-4 [Source:UniProtKB/Swiss-Prot;Acc:P10986])

HSP 1 Score: 50.447 bits (119), Expect = 8.852e-14
Identity = 28/58 (48.28%), Postives = 34/58 (58.62%), Query Frame = -1
Query: 1165 ITECDFGIRNDM---------------IADCIRKEITSLGPSKMKIKIVVSPERKYSV 1293
            I +CD  IR D+               IAD ++KEIT+L PS MKIKI+  PERKYSV
Sbjct:  239 IMKCDIDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSV 296          

HSP 2 Score: 45.4394 bits (106), Expect = 8.852e-14
Identity = 18/25 (72.00%), Postives = 20/25 (80.00%), Query Frame = -2
Query: 1077 NFQQMWITKQEYEESAPEIVSRKCL 1151
             FQQMWI+KQEY+ES P IV RKC 
Sbjct:  308 TFQQMWISKQEYDESGPSIVHRKCF 332          
BLAST of SMED30000035 vs. Ensembl Fly
Match: Act42A (gene:FBgn0000043 transcript:FBtr0086029)

HSP 1 Score: 50.447 bits (119), Expect = 1.180e-13
Identity = 29/58 (50.00%), Postives = 34/58 (58.62%), Query Frame = -1
Query: 1165 ITECDFGIRNDM---------------IADCIRKEITSLGPSKMKIKIVVSPERKYSV 1293
            I +CD  IR D+               IAD ++KEIT+L PS MKIKIV  PERKYSV
Sbjct:  283 IMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIVAPPERKYSV 340          

HSP 2 Score: 45.4394 bits (106), Expect = 1.180e-13
Identity = 18/25 (72.00%), Postives = 20/25 (80.00%), Query Frame = -2
Query: 1077 NFQQMWITKQEYEESAPEIVSRKCL 1151
             FQQMWI+KQEY+ES P IV RKC 
Sbjct:  352 TFQQMWISKQEYDESGPSIVHRKCF 376          
BLAST of SMED30000035 vs. Ensembl Fly
Match: Act5C (gene:FBgn0000042 transcript:FBtr0070822)

HSP 1 Score: 49.6766 bits (117), Expect = 1.805e-13
Identity = 28/58 (48.28%), Postives = 34/58 (58.62%), Query Frame = -1
Query: 1165 ITECDFGIRNDM---------------IADCIRKEITSLGPSKMKIKIVVSPERKYSV 1293
            I +CD  IR D+               IAD ++KEIT+L PS MKIKI+  PERKYSV
Sbjct:  283 IMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSV 340          

HSP 2 Score: 45.4394 bits (106), Expect = 1.805e-13
Identity = 18/25 (72.00%), Postives = 20/25 (80.00%), Query Frame = -2
Query: 1077 NFQQMWITKQEYEESAPEIVSRKCL 1151
             FQQMWI+KQEY+ES P IV RKC 
Sbjct:  352 TFQQMWISKQEYDESGPSIVHRKCF 376          
BLAST of SMED30000035 vs. Ensembl Fly
Match: Act5C (gene:FBgn0000042 transcript:FBtr0100662)

HSP 1 Score: 49.6766 bits (117), Expect = 1.805e-13
Identity = 28/58 (48.28%), Postives = 34/58 (58.62%), Query Frame = -1
Query: 1165 ITECDFGIRNDM---------------IADCIRKEITSLGPSKMKIKIVVSPERKYSV 1293
            I +CD  IR D+               IAD ++KEIT+L PS MKIKI+  PERKYSV
Sbjct:  283 IMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSV 340          

HSP 2 Score: 45.4394 bits (106), Expect = 1.805e-13
Identity = 18/25 (72.00%), Postives = 20/25 (80.00%), Query Frame = -2
Query: 1077 NFQQMWITKQEYEESAPEIVSRKCL 1151
             FQQMWI+KQEY+ES P IV RKC 
Sbjct:  352 TFQQMWISKQEYDESGPSIVHRKCF 376          
BLAST of SMED30000035 vs. Ensembl Fly
Match: Act5C (gene:FBgn0000042 transcript:FBtr0345894)

HSP 1 Score: 49.6766 bits (117), Expect = 1.805e-13
Identity = 28/58 (48.28%), Postives = 34/58 (58.62%), Query Frame = -1
Query: 1165 ITECDFGIRNDM---------------IADCIRKEITSLGPSKMKIKIVVSPERKYSV 1293
            I +CD  IR D+               IAD ++KEIT+L PS MKIKI+  PERKYSV
Sbjct:  283 IMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSV 340          

HSP 2 Score: 45.4394 bits (106), Expect = 1.805e-13
Identity = 18/25 (72.00%), Postives = 20/25 (80.00%), Query Frame = -2
Query: 1077 NFQQMWITKQEYEESAPEIVSRKCL 1151
             FQQMWI+KQEY+ES P IV RKC 
Sbjct:  352 TFQQMWISKQEYDESGPSIVHRKCF 376          
BLAST of SMED30000035 vs. Ensembl Fly
Match: Act5C (gene:FBgn0000042 transcript:FBtr0070823)

HSP 1 Score: 49.6766 bits (117), Expect = 1.805e-13
Identity = 28/58 (48.28%), Postives = 34/58 (58.62%), Query Frame = -1
Query: 1165 ITECDFGIRNDM---------------IADCIRKEITSLGPSKMKIKIVVSPERKYSV 1293
            I +CD  IR D+               IAD ++KEIT+L PS MKIKI+  PERKYSV
Sbjct:  283 IMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSV 340          

HSP 2 Score: 45.4394 bits (106), Expect = 1.805e-13
Identity = 18/25 (72.00%), Postives = 20/25 (80.00%), Query Frame = -2
Query: 1077 NFQQMWITKQEYEESAPEIVSRKCL 1151
             FQQMWI+KQEY+ES P IV RKC 
Sbjct:  352 TFQQMWISKQEYDESGPSIVHRKCF 376          
BLAST of SMED30000035 vs. Ensembl Zebrafish
Match: actb2 (actin, beta 2 [Source:NCBI gene;Acc:57935])

HSP 1 Score: 50.8322 bits (120), Expect = 1.111e-13
Identity = 29/58 (50.00%), Postives = 34/58 (58.62%), Query Frame = -1
Query: 1165 ITECDFGIRNDM---------------IADCIRKEITSLGPSKMKIKIVVSPERKYSV 1293
            I +CD  IR D+               IAD ++KEITSL PS MKIKI+  PERKYSV
Sbjct:  282 IMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITSLAPSTMKIKIIAPPERKYSV 339          

HSP 2 Score: 45.4394 bits (106), Expect = 1.111e-13
Identity = 18/25 (72.00%), Postives = 20/25 (80.00%), Query Frame = -2
Query: 1077 NFQQMWITKQEYEESAPEIVSRKCL 1151
             FQQMWI+KQEY+ES P IV RKC 
Sbjct:  351 TFQQMWISKQEYDESGPSIVHRKCF 375          
BLAST of SMED30000035 vs. Ensembl Zebrafish
Match: actb2 (actin, beta 2 [Source:NCBI gene;Acc:57935])

HSP 1 Score: 50.8322 bits (120), Expect = 1.111e-13
Identity = 29/58 (50.00%), Postives = 34/58 (58.62%), Query Frame = -1
Query: 1165 ITECDFGIRNDM---------------IADCIRKEITSLGPSKMKIKIVVSPERKYSV 1293
            I +CD  IR D+               IAD ++KEITSL PS MKIKI+  PERKYSV
Sbjct:  282 IMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITSLAPSTMKIKIIAPPERKYSV 339          

HSP 2 Score: 45.4394 bits (106), Expect = 1.111e-13
Identity = 18/25 (72.00%), Postives = 20/25 (80.00%), Query Frame = -2
Query: 1077 NFQQMWITKQEYEESAPEIVSRKCL 1151
             FQQMWI+KQEY+ES P IV RKC 
Sbjct:  351 TFQQMWISKQEYDESGPSIVHRKCF 375          
BLAST of SMED30000035 vs. Ensembl Zebrafish
Match: actb2 (actin, beta 2 [Source:NCBI gene;Acc:57935])

HSP 1 Score: 50.8322 bits (120), Expect = 1.111e-13
Identity = 29/58 (50.00%), Postives = 34/58 (58.62%), Query Frame = -1
Query: 1165 ITECDFGIRNDM---------------IADCIRKEITSLGPSKMKIKIVVSPERKYSV 1293
            I +CD  IR D+               IAD ++KEITSL PS MKIKI+  PERKYSV
Sbjct:  282 IMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITSLAPSTMKIKIIAPPERKYSV 339          

HSP 2 Score: 45.4394 bits (106), Expect = 1.111e-13
Identity = 18/25 (72.00%), Postives = 20/25 (80.00%), Query Frame = -2
Query: 1077 NFQQMWITKQEYEESAPEIVSRKCL 1151
             FQQMWI+KQEY+ES P IV RKC 
Sbjct:  351 TFQQMWISKQEYDESGPSIVHRKCF 375          
BLAST of SMED30000035 vs. Ensembl Zebrafish
Match: actb1 (actin, beta 1 [Source:NCBI gene;Acc:57934])

HSP 1 Score: 50.8322 bits (120), Expect = 1.148e-13
Identity = 29/58 (50.00%), Postives = 34/58 (58.62%), Query Frame = -1
Query: 1165 ITECDFGIRNDM---------------IADCIRKEITSLGPSKMKIKIVVSPERKYSV 1293
            I +CD  IR D+               IAD ++KEITSL PS MKIKI+  PERKYSV
Sbjct:  282 IMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITSLAPSTMKIKIIAPPERKYSV 339          

HSP 2 Score: 45.4394 bits (106), Expect = 1.148e-13
Identity = 18/25 (72.00%), Postives = 20/25 (80.00%), Query Frame = -2
Query: 1077 NFQQMWITKQEYEESAPEIVSRKCL 1151
             FQQMWI+KQEY+ES P IV RKC 
Sbjct:  351 TFQQMWISKQEYDESGPSIVHRKCF 375          
BLAST of SMED30000035 vs. Ensembl Zebrafish
Match: actb1 (actin, beta 1 [Source:NCBI gene;Acc:57934])

HSP 1 Score: 50.8322 bits (120), Expect = 1.148e-13
Identity = 29/58 (50.00%), Postives = 34/58 (58.62%), Query Frame = -1
Query: 1165 ITECDFGIRNDM---------------IADCIRKEITSLGPSKMKIKIVVSPERKYSV 1293
            I +CD  IR D+               IAD ++KEITSL PS MKIKI+  PERKYSV
Sbjct:  282 IMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITSLAPSTMKIKIIAPPERKYSV 339          

HSP 2 Score: 45.4394 bits (106), Expect = 1.148e-13
Identity = 18/25 (72.00%), Postives = 20/25 (80.00%), Query Frame = -2
Query: 1077 NFQQMWITKQEYEESAPEIVSRKCL 1151
             FQQMWI+KQEY+ES P IV RKC 
Sbjct:  351 TFQQMWISKQEYDESGPSIVHRKCF 375          
BLAST of SMED30000035 vs. Ensembl Xenopus
Match: MGC75582 (MGC75582, possible similarity to act2 [Source:NCBI gene;Acc:394982])

HSP 1 Score: 50.0618 bits (118), Expect = 2.351e-13
Identity = 28/58 (48.28%), Postives = 34/58 (58.62%), Query Frame = -1
Query: 1165 ITECDFGIRNDM---------------IADCIRKEITSLGPSKMKIKIVVSPERKYSV 1293
            I +CD  IR D+               IAD ++KEIT+L PS MKIKI+  PERKYSV
Sbjct:  284 IMKCDIDIRKDLYANNVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSV 341          

HSP 2 Score: 45.8246 bits (107), Expect = 2.351e-13
Identity = 18/25 (72.00%), Postives = 20/25 (80.00%), Query Frame = -2
Query: 1077 NFQQMWITKQEYEESAPEIVSRKCL 1151
             FQQMWITKQEY+E+ P IV RKC 
Sbjct:  353 TFQQMWITKQEYDEAGPSIVHRKCF 377          
BLAST of SMED30000035 vs. Ensembl Xenopus
Match: acta1 (actin, alpha 1, skeletal muscle [Source:NCBI gene;Acc:448346])

HSP 1 Score: 50.0618 bits (118), Expect = 2.409e-13
Identity = 28/58 (48.28%), Postives = 34/58 (58.62%), Query Frame = -1
Query: 1165 ITECDFGIRNDM---------------IADCIRKEITSLGPSKMKIKIVVSPERKYSV 1293
            I +CD  IR D+               IAD ++KEIT+L PS MKIKI+  PERKYSV
Sbjct:  284 IMKCDIDIRKDLYANNVMSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSV 341          

HSP 2 Score: 45.8246 bits (107), Expect = 2.409e-13
Identity = 18/25 (72.00%), Postives = 20/25 (80.00%), Query Frame = -2
Query: 1077 NFQQMWITKQEYEESAPEIVSRKCL 1151
             FQQMWITKQEY+E+ P IV RKC 
Sbjct:  353 TFQQMWITKQEYDEAGPSIVHRKCF 377          
BLAST of SMED30000035 vs. Ensembl Xenopus
Match: actb (actin, beta [Source:NCBI gene;Acc:407952])

HSP 1 Score: 49.6766 bits (117), Expect = 3.155e-13
Identity = 28/58 (48.28%), Postives = 34/58 (58.62%), Query Frame = -1
Query: 1165 ITECDFGIRNDM---------------IADCIRKEITSLGPSKMKIKIVVSPERKYSV 1293
            I +CD  IR D+               IAD ++KEIT+L PS MKIKI+  PERKYSV
Sbjct:  282 IMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSV 339          

HSP 2 Score: 45.4394 bits (106), Expect = 3.155e-13
Identity = 18/25 (72.00%), Postives = 20/25 (80.00%), Query Frame = -2
Query: 1077 NFQQMWITKQEYEESAPEIVSRKCL 1151
             FQQMWI+KQEY+ES P IV RKC 
Sbjct:  351 TFQQMWISKQEYDESGPSIVHRKCF 375          
BLAST of SMED30000035 vs. Ensembl Xenopus
Match: actg1 (actin gamma 1 [Source:NCBI gene;Acc:394957])

HSP 1 Score: 49.6766 bits (117), Expect = 3.155e-13
Identity = 28/58 (48.28%), Postives = 34/58 (58.62%), Query Frame = -1
Query: 1165 ITECDFGIRNDM---------------IADCIRKEITSLGPSKMKIKIVVSPERKYSV 1293
            I +CD  IR D+               IAD ++KEIT+L PS MKIKI+  PERKYSV
Sbjct:  282 IMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSV 339          

HSP 2 Score: 45.4394 bits (106), Expect = 3.155e-13
Identity = 18/25 (72.00%), Postives = 20/25 (80.00%), Query Frame = -2
Query: 1077 NFQQMWITKQEYEESAPEIVSRKCL 1151
             FQQMWI+KQEY+ES P IV RKC 
Sbjct:  351 TFQQMWISKQEYDESGPSIVHRKCF 375          
BLAST of SMED30000035 vs. Ensembl Xenopus
Match: act3 (actin alpha 4 [Source:NCBI gene;Acc:394673])

HSP 1 Score: 50.0618 bits (118), Expect = 5.141e-13
Identity = 28/58 (48.28%), Postives = 34/58 (58.62%), Query Frame = -1
Query: 1165 ITECDFGIRNDM---------------IADCIRKEITSLGPSKMKIKIVVSPERKYSV 1293
            I +CD  IR D+               IAD ++KEIT+L PS MKIKI+  PERKYSV
Sbjct:  297 IMKCDIDIRKDLYANNVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSV 354          

HSP 2 Score: 44.669 bits (104), Expect = 5.141e-13
Identity = 17/24 (70.83%), Postives = 20/24 (83.33%), Query Frame = -2
Query: 1077 FQQMWITKQEYEESAPEIVSRKCL 1148
            FQQMWI+KQEY+E+ P IV RKC 
Sbjct:  367 FQQMWISKQEYDEAGPSIVHRKCF 390          
BLAST of SMED30000035 vs. Ensembl Mouse
Match: Acta1 (actin, alpha 1, skeletal muscle [Source:MGI Symbol;Acc:MGI:87902])

HSP 1 Score: 50.0618 bits (118), Expect = 1.617e-13
Identity = 28/58 (48.28%), Postives = 34/58 (58.62%), Query Frame = -1
Query: 1165 ITECDFGIRNDM---------------IADCIRKEITSLGPSKMKIKIVVSPERKYSV 1293
            I +CD  IR D+               IAD ++KEIT+L PS MKIKI+  PERKYSV
Sbjct:  284 IMKCDIDIRKDLYANNVMSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSV 341          

HSP 2 Score: 45.8246 bits (107), Expect = 1.617e-13
Identity = 18/25 (72.00%), Postives = 20/25 (80.00%), Query Frame = -2
Query: 1077 NFQQMWITKQEYEESAPEIVSRKCL 1151
             FQQMWITKQEY+E+ P IV RKC 
Sbjct:  353 TFQQMWITKQEYDEAGPSIVHRKCF 377          
BLAST of SMED30000035 vs. Ensembl Mouse
Match: Actb (actin, beta [Source:MGI Symbol;Acc:MGI:87904])

HSP 1 Score: 49.6766 bits (117), Expect = 2.083e-13
Identity = 28/58 (48.28%), Postives = 34/58 (58.62%), Query Frame = -1
Query: 1165 ITECDFGIRNDM---------------IADCIRKEITSLGPSKMKIKIVVSPERKYSV 1293
            I +CD  IR D+               IAD ++KEIT+L PS MKIKI+  PERKYSV
Sbjct:  282 IMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSV 339          

HSP 2 Score: 45.4394 bits (106), Expect = 2.083e-13
Identity = 18/25 (72.00%), Postives = 20/25 (80.00%), Query Frame = -2
Query: 1077 NFQQMWITKQEYEESAPEIVSRKCL 1151
             FQQMWI+KQEY+ES P IV RKC 
Sbjct:  351 TFQQMWISKQEYDESGPSIVHRKCF 375          
BLAST of SMED30000035 vs. Ensembl Mouse
Match: Actb (actin, beta [Source:MGI Symbol;Acc:MGI:87904])

HSP 1 Score: 49.6766 bits (117), Expect = 2.186e-13
Identity = 28/58 (48.28%), Postives = 34/58 (58.62%), Query Frame = -1
Query: 1165 ITECDFGIRNDM---------------IADCIRKEITSLGPSKMKIKIVVSPERKYSV 1293
            I +CD  IR D+               IAD ++KEIT+L PS MKIKI+  PERKYSV
Sbjct:  202 IMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSV 259          

HSP 2 Score: 45.8246 bits (107), Expect = 2.186e-13
Identity = 18/25 (72.00%), Postives = 20/25 (80.00%), Query Frame = -2
Query: 1077 NFQQMWITKQEYEESAPEIVSRKCL 1151
             FQQMWI+KQEY+ES P IV RKC 
Sbjct:  271 TFQQMWISKQEYDESGPSIVHRKCF 295          
BLAST of SMED30000035 vs. Ensembl Mouse
Match: Actg1 (actin, gamma, cytoplasmic 1 [Source:MGI Symbol;Acc:MGI:87906])

HSP 1 Score: 49.6766 bits (117), Expect = 2.187e-13
Identity = 28/58 (48.28%), Postives = 34/58 (58.62%), Query Frame = -1
Query: 1165 ITECDFGIRNDM---------------IADCIRKEITSLGPSKMKIKIVVSPERKYSV 1293
            I +CD  IR D+               IAD ++KEIT+L PS MKIKI+  PERKYSV
Sbjct:  282 IMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSV 339          

HSP 2 Score: 45.4394 bits (106), Expect = 2.187e-13
Identity = 18/25 (72.00%), Postives = 20/25 (80.00%), Query Frame = -2
Query: 1077 NFQQMWITKQEYEESAPEIVSRKCL 1151
             FQQMWI+KQEY+ES P IV RKC 
Sbjct:  351 TFQQMWISKQEYDESGPSIVHRKCF 375          
BLAST of SMED30000035 vs. Ensembl Mouse
Match: Actg1 (actin, gamma, cytoplasmic 1 [Source:MGI Symbol;Acc:MGI:87906])

HSP 1 Score: 49.6766 bits (117), Expect = 2.187e-13
Identity = 28/58 (48.28%), Postives = 34/58 (58.62%), Query Frame = -1
Query: 1165 ITECDFGIRNDM---------------IADCIRKEITSLGPSKMKIKIVVSPERKYSV 1293
            I +CD  IR D+               IAD ++KEIT+L PS MKIKI+  PERKYSV
Sbjct:  282 IMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSV 339          

HSP 2 Score: 45.4394 bits (106), Expect = 2.187e-13
Identity = 18/25 (72.00%), Postives = 20/25 (80.00%), Query Frame = -2
Query: 1077 NFQQMWITKQEYEESAPEIVSRKCL 1151
             FQQMWI+KQEY+ES P IV RKC 
Sbjct:  351 TFQQMWISKQEYDESGPSIVHRKCF 375          
BLAST of SMED30000035 vs. UniProt/SwissProt
Match: sp|P53459|ACT6_DIPDE (Actin-6 (Fragment) OS=Diphyllobothrium dendriticum OX=28845 GN=ACT6 PE=2 SV=1)

HSP 1 Score: 50.0618 bits (118), Expect = 4.486e-13
Identity = 28/58 (48.28%), Postives = 33/58 (56.90%), Query Frame = -1
Query: 1165 ITECDFGIRNDM---------------IADCIRKEITSLGPSKMKIKIVVSPERKYSV 1293
            I +CD  IR D+               IAD + KE+TSL PS MKIKI+  PERKYSV
Sbjct:  280 IMKCDLDIRKDLYSNIVLSGGSTMYPGIADRMNKELTSLAPSSMKIKIIAPPERKYSV 337          

HSP 2 Score: 46.9802 bits (110), Expect = 4.486e-13
Identity = 19/24 (79.17%), Postives = 20/24 (83.33%), Query Frame = -2
Query: 1077 FQQMWITKQEYEESAPEIVSRKCL 1148
            FQQMWITKQEY+ES P IV RKC 
Sbjct:  350 FQQMWITKQEYDESGPSIVHRKCF 373          
BLAST of SMED30000035 vs. UniProt/SwissProt
Match: sp|Q25472|ACT2_MOLOC (Actin, muscle-type OS=Molgula oculata OX=27575 PE=3 SV=1)

HSP 1 Score: 50.0618 bits (118), Expect = 4.709e-13
Identity = 28/58 (48.28%), Postives = 34/58 (58.62%), Query Frame = -1
Query: 1165 ITECDFGIRNDM---------------IADCIRKEITSLGPSKMKIKIVVSPERKYSV 1293
            I +CD  IR D+               IAD ++KEIT+L PS MKIKI+  PERKYSV
Sbjct:  285 IMKCDIDIRKDLYANNVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSV 342          

HSP 2 Score: 46.9802 bits (110), Expect = 4.709e-13
Identity = 19/25 (76.00%), Postives = 20/25 (80.00%), Query Frame = -2
Query: 1077 NFQQMWITKQEYEESAPEIVSRKCL 1151
             FQQMWITKQEY+ES P IV RKC 
Sbjct:  354 TFQQMWITKQEYDESGPSIVHRKCF 378          
BLAST of SMED30000035 vs. UniProt/SwissProt
Match: sp|P68555|ACT_TAESO (Actin OS=Taenia solium OX=6204 GN=ACT1 PE=3 SV=1)

HSP 1 Score: 51.6026 bits (122), Expect = 4.866e-13
Identity = 30/58 (51.72%), Postives = 34/58 (58.62%), Query Frame = -1
Query: 1165 ITECDFGIRNDM---------------IADCIRKEITSLGPSKMKIKIVVSPERKYSV 1293
            I +CD  IR D+               IAD ++KEITSL PS MKIKIV  PERKYSV
Sbjct:  283 IMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITSLAPSTMKIKIVAPPERKYSV 340          

HSP 2 Score: 45.4394 bits (106), Expect = 4.866e-13
Identity = 18/25 (72.00%), Postives = 20/25 (80.00%), Query Frame = -2
Query: 1077 NFQQMWITKQEYEESAPEIVSRKCL 1151
             FQQMWI+KQEY+ES P IV RKC 
Sbjct:  352 TFQQMWISKQEYDESGPGIVHRKCF 376          
BLAST of SMED30000035 vs. UniProt/SwissProt
Match: sp|P68556|ACT1_DIPDE (Actin-1/4 OS=Diphyllobothrium dendriticum OX=28845 GN=ACT1 PE=2 SV=1)

HSP 1 Score: 51.6026 bits (122), Expect = 4.866e-13
Identity = 30/58 (51.72%), Postives = 34/58 (58.62%), Query Frame = -1
Query: 1165 ITECDFGIRNDM---------------IADCIRKEITSLGPSKMKIKIVVSPERKYSV 1293
            I +CD  IR D+               IAD ++KEITSL PS MKIKIV  PERKYSV
Sbjct:  283 IMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITSLAPSTMKIKIVAPPERKYSV 340          

HSP 2 Score: 45.4394 bits (106), Expect = 4.866e-13
Identity = 18/25 (72.00%), Postives = 20/25 (80.00%), Query Frame = -2
Query: 1077 NFQQMWITKQEYEESAPEIVSRKCL 1151
             FQQMWI+KQEY+ES P IV RKC 
Sbjct:  352 TFQQMWISKQEYDESGPGIVHRKCF 376          
BLAST of SMED30000035 vs. UniProt/SwissProt
Match: sp|P53456|ACT2_DIPDE (Actin-2 OS=Diphyllobothrium dendriticum OX=28845 GN=ACT2 PE=2 SV=1)

HSP 1 Score: 51.6026 bits (122), Expect = 5.028e-13
Identity = 30/58 (51.72%), Postives = 34/58 (58.62%), Query Frame = -1
Query: 1165 ITECDFGIRNDM---------------IADCIRKEITSLGPSKMKIKIVVSPERKYSV 1293
            I +CD  IR D+               IAD ++KEITSL PS MKIKIV  PERKYSV
Sbjct:  283 IMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITSLAPSTMKIKIVAPPERKYSV 340          

HSP 2 Score: 45.4394 bits (106), Expect = 5.028e-13
Identity = 18/25 (72.00%), Postives = 20/25 (80.00%), Query Frame = -2
Query: 1077 NFQQMWITKQEYEESAPEIVSRKCL 1151
             FQQMWI+KQEY+ES P IV RKC 
Sbjct:  352 TFQQMWISKQEYDESGPGIVHRKCF 376          
BLAST of SMED30000035 vs. TrEMBL
Match: A0A1V4JKX8 (Nuclear pore complex protein Nup133 OS=Patagioenas fasciata monilis OX=372326 GN=NUP133 PE=3 SV=1)

HSP 1 Score: 53.1434 bits (126), Expect = 2.382e-11
Identity = 28/58 (48.28%), Postives = 34/58 (58.62%), Query Frame = -1
Query: 1165 ITECDFGIRNDM---------------IADCIRKEITSLGPSKMKIKIVVSPERKYSV 1293
            I +CD  IR D+               IAD ++KEIT+L PS MKIKI+  PERKYSV
Sbjct: 1446 IMKCDIDIRKDLYANNVMSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSV 1503          

HSP 2 Score: 45.8246 bits (107), Expect = 2.382e-11
Identity = 18/24 (75.00%), Postives = 20/24 (83.33%), Query Frame = -2
Query: 1077 FQQMWITKQEYEESAPEIVSRKCL 1148
            FQQMWITKQEY+E+ P IV RKC 
Sbjct: 1516 FQQMWITKQEYDEAGPSIVHRKCF 1539          
BLAST of SMED30000035 vs. TrEMBL
Match: M1T220 (Actin-like protein (Fragment) OS=Stylophora pistillata OX=50429 PE=3 SV=1)

HSP 1 Score: 50.447 bits (119), Expect = 2.969e-11
Identity = 28/58 (48.28%), Postives = 34/58 (58.62%), Query Frame = -1
Query: 1165 ITECDFGIRNDM---------------IADCIRKEITSLGPSKMKIKIVVSPERKYSV 1293
            I +CD  IR D+               IAD ++KEIT+L PS MKIKI+  PERKYSV
Sbjct:  256 IMKCDVDIRKDLYANTVLSGGSTMYSGIADRMQKEITALAPSTMKIKIIAPPERKYSV 313          

HSP 2 Score: 48.521 bits (114), Expect = 2.969e-11
Identity = 20/33 (60.61%), Postives = 23/33 (69.70%), Query Frame = -2
Query: 1053 NFQQMWITKQEYEESAPEIVSRKCL*WIPFIVY 1151
             FQQMWI+KQEY+ES P IV RKC    P + Y
Sbjct:  325 TFQQMWISKQEYDESGPAIVHRKCFSLSPLLSY 357          
BLAST of SMED30000035 vs. TrEMBL
Match: A0A3P6HDK1 (Uncharacterized protein OS=Mesocestoides corti OX=53468 GN=MCOS_LOCUS2441 PE=3 SV=1)

HSP 1 Score: 53.5286 bits (127), Expect = 3.421e-11
Identity = 29/58 (50.00%), Postives = 34/58 (58.62%), Query Frame = -1
Query: 1165 ITECDFGIRNDM---------------IADCIRKEITSLGPSKMKIKIVVSPERKYSV 1293
            I +CD  IR D+               IAD ++KEIT+L PS MKIKIV  PERKYSV
Sbjct:  901 IMKCDVDIRKDLYANTVLSGGSTMYPGIADRMQKEITALAPSTMKIKIVAPPERKYSV 958          

HSP 2 Score: 44.669 bits (104), Expect = 3.421e-11
Identity = 18/24 (75.00%), Postives = 20/24 (83.33%), Query Frame = -2
Query: 1077 FQQMWITKQEYEESAPEIVSRKCL 1148
            FQQMWI+KQEY+ES P IV RKC 
Sbjct:  971 FQQMWISKQEYDESGPSIVHRKCF 994          
BLAST of SMED30000035 vs. TrEMBL
Match: A0A183TGM4 (Uncharacterized protein OS=Schistocephalus solidus OX=70667 GN=SSLN_LOCUS15622 PE=3 SV=1)

HSP 1 Score: 50.447 bits (119), Expect = 4.737e-11
Identity = 28/58 (48.28%), Postives = 33/58 (56.90%), Query Frame = -1
Query: 1165 ITECDFGIRNDM---------------IADCIRKEITSLGPSKMKIKIVVSPERKYSV 1293
            I +CD  IR D+               IAD + KE+TSL PS MKIKI+  PERKYSV
Sbjct:  254 IMKCDLDIRKDLYSNIVLSGGSTMYPGIADRMNKELTSLAPSSMKIKIIAPPERKYSV 311          

HSP 2 Score: 47.7506 bits (112), Expect = 4.737e-11
Identity = 19/24 (79.17%), Postives = 21/24 (87.50%), Query Frame = -2
Query: 1077 FQQMWITKQEYEESAPEIVSRKCL 1148
            FQQMWITKQEY+ES P+IV RKC 
Sbjct:  324 FQQMWITKQEYDESGPQIVHRKCF 347          
BLAST of SMED30000035 vs. TrEMBL
Match: A0A183S955 (Uncharacterized protein OS=Schistocephalus solidus OX=70667 GN=SSLN_LOCUS753 PE=3 SV=1)

HSP 1 Score: 50.447 bits (119), Expect = 5.889e-11
Identity = 28/58 (48.28%), Postives = 33/58 (56.90%), Query Frame = -1
Query: 1165 ITECDFGIRNDM---------------IADCIRKEITSLGPSKMKIKIVVSPERKYSV 1293
            I +CD  IR D+               IAD + KE+TSL PS MKIKI+  PERKYSV
Sbjct:  282 IMKCDLDIRKDLYSNIVMSGGSTMYPGIADRMNKELTSLAPSSMKIKIIAPPERKYSV 339          

HSP 2 Score: 47.3654 bits (111), Expect = 5.889e-11
Identity = 19/25 (76.00%), Postives = 21/25 (84.00%), Query Frame = -2
Query: 1077 NFQQMWITKQEYEESAPEIVSRKCL 1151
             FQQMWITKQEY+ES P+IV RKC 
Sbjct:  351 TFQQMWITKQEYDESGPQIVHRKCF 375          
BLAST of SMED30000035 vs. Ensembl Cavefish
Match: actb2 (actin beta [Source:NCBI gene;Acc:103030443])

HSP 1 Score: 50.8322 bits (120), Expect = 9.663e-14
Identity = 29/58 (50.00%), Postives = 34/58 (58.62%), Query Frame = -1
Query: 1165 ITECDFGIRNDM---------------IADCIRKEITSLGPSKMKIKIVVSPERKYSV 1293
            I +CD  IR D+               IAD ++KEITSL PS MKIKI+  PERKYSV
Sbjct:  282 IMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITSLAPSTMKIKIIAPPERKYSV 339          

HSP 2 Score: 45.4394 bits (106), Expect = 9.663e-14
Identity = 18/25 (72.00%), Postives = 20/25 (80.00%), Query Frame = -2
Query: 1077 NFQQMWITKQEYEESAPEIVSRKCL 1151
             FQQMWI+KQEY+ES P IV RKC 
Sbjct:  351 TFQQMWISKQEYDESGPSIVHRKCF 375          
BLAST of SMED30000035 vs. Ensembl Cavefish
Match: actb1 (actin, cytoplasmic 1 [Source:NCBI gene;Acc:103039558])

HSP 1 Score: 50.8322 bits (120), Expect = 9.984e-14
Identity = 29/58 (50.00%), Postives = 34/58 (58.62%), Query Frame = -1
Query: 1165 ITECDFGIRNDM---------------IADCIRKEITSLGPSKMKIKIVVSPERKYSV 1293
            I +CD  IR D+               IAD ++KEITSL PS MKIKI+  PERKYSV
Sbjct:  282 IMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITSLAPSTMKIKIIAPPERKYSV 339          

HSP 2 Score: 45.4394 bits (106), Expect = 9.984e-14
Identity = 18/25 (72.00%), Postives = 20/25 (80.00%), Query Frame = -2
Query: 1077 NFQQMWITKQEYEESAPEIVSRKCL 1151
             FQQMWI+KQEY+ES P IV RKC 
Sbjct:  351 TFQQMWISKQEYDESGPSIVHRKCF 375          
BLAST of SMED30000035 vs. Ensembl Cavefish
Match: actb1 (actin, cytoplasmic 1 [Source:NCBI gene;Acc:103039558])

HSP 1 Score: 50.8322 bits (120), Expect = 1.040e-13
Identity = 29/58 (50.00%), Postives = 34/58 (58.62%), Query Frame = -1
Query: 1165 ITECDFGIRNDM---------------IADCIRKEITSLGPSKMKIKIVVSPERKYSV 1293
            I +CD  IR D+               IAD ++KEITSL PS MKIKI+  PERKYSV
Sbjct:  284 IMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITSLAPSTMKIKIIAPPERKYSV 341          

HSP 2 Score: 45.4394 bits (106), Expect = 1.040e-13
Identity = 18/25 (72.00%), Postives = 20/25 (80.00%), Query Frame = -2
Query: 1077 NFQQMWITKQEYEESAPEIVSRKCL 1151
             FQQMWI+KQEY+ES P IV RKC 
Sbjct:  353 TFQQMWISKQEYDESGPSIVHRKCF 377          
BLAST of SMED30000035 vs. Ensembl Cavefish
Match: acta1b (actin, alpha skeletal muscle 2 [Source:NCBI gene;Acc:103031709])

HSP 1 Score: 50.0618 bits (118), Expect = 1.328e-13
Identity = 28/58 (48.28%), Postives = 34/58 (58.62%), Query Frame = -1
Query: 1165 ITECDFGIRNDM---------------IADCIRKEITSLGPSKMKIKIVVSPERKYSV 1293
            I +CD  IR D+               IAD ++KEIT+L PS MKIKI+  PERKYSV
Sbjct:  284 IMKCDIDIRKDLYANNVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSV 341          

HSP 2 Score: 45.8246 bits (107), Expect = 1.328e-13
Identity = 18/25 (72.00%), Postives = 20/25 (80.00%), Query Frame = -2
Query: 1077 NFQQMWITKQEYEESAPEIVSRKCL 1151
             FQQMWITKQEY+E+ P IV RKC 
Sbjct:  353 TFQQMWITKQEYDEAGPSIVHRKCF 377          
BLAST of SMED30000035 vs. Ensembl Cavefish
Match: ENSAMXT00000013099.2 (actin, alpha skeletal muscle 2 [Source:NCBI gene;Acc:103031709])

HSP 1 Score: 50.0618 bits (118), Expect = 1.328e-13
Identity = 28/58 (48.28%), Postives = 34/58 (58.62%), Query Frame = -1
Query: 1165 ITECDFGIRNDM---------------IADCIRKEITSLGPSKMKIKIVVSPERKYSV 1293
            I +CD  IR D+               IAD ++KEIT+L PS MKIKI+  PERKYSV
Sbjct:  284 IMKCDIDIRKDLYANNVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSV 341          

HSP 2 Score: 45.8246 bits (107), Expect = 1.328e-13
Identity = 18/25 (72.00%), Postives = 20/25 (80.00%), Query Frame = -2
Query: 1077 NFQQMWITKQEYEESAPEIVSRKCL 1151
             FQQMWITKQEY+E+ P IV RKC 
Sbjct:  353 TFQQMWITKQEYDEAGPSIVHRKCF 377          
BLAST of SMED30000035 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004586.1 (pep scaffold:Pmarinus_7.0:GL479516:23873:27955:-1 gene:ENSPMAG00000004161.1 transcript:ENSPMAT00000004586.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 49.6766 bits (117), Expect = 3.420e-14
Identity = 28/58 (48.28%), Postives = 34/58 (58.62%), Query Frame = -1
Query: 1165 ITECDFGIRNDM---------------IADCIRKEITSLGPSKMKIKIVVSPERKYSV 1293
            I +CD  IR D+               IAD ++KEIT+L PS MKIKI+  PERKYSV
Sbjct:  283 IMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSV 340          

HSP 2 Score: 45.8246 bits (107), Expect = 3.420e-14
Identity = 18/25 (72.00%), Postives = 20/25 (80.00%), Query Frame = -2
Query: 1077 NFQQMWITKQEYEESAPEIVSRKCL 1151
             FQQMWI+KQEY+ES P IV RKC 
Sbjct:  352 TFQQMWISKQEYDESGPSIVHRKCF 376          
BLAST of SMED30000035 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000011113.1 (pep scaffold:Pmarinus_7.0:GL498954:115:1245:1 gene:ENSPMAG00000010086.1 transcript:ENSPMAT00000011113.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 50.0618 bits (118), Expect = 3.448e-14
Identity = 28/58 (48.28%), Postives = 34/58 (58.62%), Query Frame = -1
Query: 1165 ITECDFGIRNDM---------------IADCIRKEITSLGPSKMKIKIVVSPERKYSV 1293
            I +CD  IR D+               IAD ++KEIT+L PS MKIKI+  PERKYSV
Sbjct:  283 IMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSV 340          

HSP 2 Score: 45.4394 bits (106), Expect = 3.448e-14
Identity = 18/25 (72.00%), Postives = 20/25 (80.00%), Query Frame = -2
Query: 1077 NFQQMWITKQEYEESAPEIVSRKCL 1151
             FQQMWI+KQEY+ES P IV RKC 
Sbjct:  352 TFQQMWISKQEYDESGPSIVHRKCF 376          
BLAST of SMED30000035 vs. Ensembl Sea Lamprey
Match: ACTG2 (actin gamma 2, smooth muscle [Source:HGNC Symbol;Acc:HGNC:145])

HSP 1 Score: 48.521 bits (114), Expect = 1.136e-12
Identity = 27/58 (46.55%), Postives = 34/58 (58.62%), Query Frame = -1
Query: 1165 ITECDFGIRNDM---------------IADCIRKEITSLGPSKMKIKIVVSPERKYSV 1293
            I +CD  IR D+               IAD ++KEIT+L P+ MKIKI+  PERKYSV
Sbjct:   23 IMKCDIDIRKDLYANNVLSGGTTMYPGIADRMQKEITALAPTTMKIKIIAPPERKYSV 80          

HSP 2 Score: 41.9726 bits (97), Expect = 1.136e-12
Identity = 16/25 (64.00%), Postives = 19/25 (76.00%), Query Frame = -2
Query: 1077 NFQQMWITKQEYEESAPEIVSRKCL 1151
             FQQMWI+K EY+E+ P IV RKC 
Sbjct:   92 TFQQMWISKPEYDEAGPSIVHRKCF 116          
BLAST of SMED30000035 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000011230.1 (pep scaffold:Pmarinus_7.0:GL476986:121012:122166:1 gene:ENSPMAG00000010203.1 transcript:ENSPMAT00000011230.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 39.6614 bits (91), Expect = 4.255e-6
Identity = 15/25 (60.00%), Postives = 18/25 (72.00%), Query Frame = -2
Query: 1077 NFQQMWITKQEYEESAPEIVSRKCL 1151
             FQQMWIT  EY+E  P +V R+CL
Sbjct:  360 TFQQMWITAPEYKEFGPSVVHRRCL 384          

HSP 2 Score: 28.1054 bits (61), Expect = 4.255e-6
Identity = 11/27 (40.74%), Postives = 16/27 (59.26%), Query Frame = -1
Query: 1165 IRKEITSLGPSKMKIKIVVSPERKYSV 1245
            + +E+  L P    ++I   PERKYSV
Sbjct:  322 LWQELAKLAPRGAPVRIFAPPERKYSV 348          
BLAST of SMED30000035 vs. Ensembl Yeast
Match: ACT1 (Actin; structural protein involved in cell polarization, endocytosis, and other cytoskeletal functions [Source:SGD;Acc:S000001855])

HSP 1 Score: 45.8246 bits (107), Expect = 1.504e-12
Identity = 24/58 (41.38%), Postives = 34/58 (58.62%), Query Frame = -1
Query: 1165 ITECDFGIRNDM---------------IADCIRKEITSLGPSKMKIKIVVSPERKYSV 1293
            I +CD  +R ++               IA+ ++KEIT+L PS MK+KI+  PERKYSV
Sbjct:  282 IMKCDVDVRKELYGNIVMSGGTTMFPGIAERMQKEITALAPSSMKVKIIAPPERKYSV 339          

HSP 2 Score: 43.5134 bits (101), Expect = 1.504e-12
Identity = 17/25 (68.00%), Postives = 19/25 (76.00%), Query Frame = -2
Query: 1077 NFQQMWITKQEYEESAPEIVSRKCL 1151
             FQQMWI+KQEY+ES P IV  KC 
Sbjct:  351 TFQQMWISKQEYDESGPSIVHHKCF 375          
BLAST of SMED30000035 vs. Ensembl Nematostella
Match: EDO45013 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RU31])

HSP 1 Score: 49.2914 bits (116), Expect = 9.461e-14
Identity = 28/58 (48.28%), Postives = 33/58 (56.90%), Query Frame = -1
Query: 1165 ITECDFGIRNDM---------------IADCIRKEITSLGPSKMKIKIVVSPERKYSV 1293
            I +CD  IR D+               IAD ++KEITSL P  MKIKI+  PERKYSV
Sbjct:  282 IMKCDVDIRKDLYANTVLSGGSTMYPGIADRMQKEITSLAPPTMKIKIIAPPERKYSV 339          

HSP 2 Score: 45.4394 bits (106), Expect = 9.461e-14
Identity = 18/25 (72.00%), Postives = 20/25 (80.00%), Query Frame = -2
Query: 1077 NFQQMWITKQEYEESAPEIVSRKCL 1151
             FQQMWI+KQEY+ES P IV RKC 
Sbjct:  351 TFQQMWISKQEYDESGPSIVHRKCF 375          
BLAST of SMED30000035 vs. Ensembl Nematostella
Match: EDO42646 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S0V7])

HSP 1 Score: 48.9062 bits (115), Expect = 1.035e-13
Identity = 28/58 (48.28%), Postives = 33/58 (56.90%), Query Frame = -1
Query: 1165 ITECDFGIRNDM---------------IADCIRKEITSLGPSKMKIKIVVSPERKYSV 1293
            I +CD  IR D+               IAD ++KEITSL P  MKIKI+  PERKYSV
Sbjct:  282 IMKCDVDIRKDLYANTVLSGGSTMYPGIADRMQKEITSLAPPTMKIKIIAPPERKYSV 339          

HSP 2 Score: 45.8246 bits (107), Expect = 1.035e-13
Identity = 18/25 (72.00%), Postives = 20/25 (80.00%), Query Frame = -2
Query: 1077 NFQQMWITKQEYEESAPEIVSRKCL 1151
             FQQMWI+KQEY+ES P IV RKC 
Sbjct:  351 TFQQMWISKQEYDESGPSIVHRKCF 375          
BLAST of SMED30000035 vs. Ensembl Nematostella
Match: EDO37976 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SEA7])

HSP 1 Score: 47.7506 bits (112), Expect = 2.210e-13
Identity = 26/58 (44.83%), Postives = 34/58 (58.62%), Query Frame = -1
Query: 1165 ITECDFGIRNDM---------------IADCIRKEITSLGPSKMKIKIVVSPERKYSV 1293
            I +CD  IR D+               +AD ++KEI++L PS MKIKI+  PERKYSV
Sbjct:  283 IMKCDVDIRKDLYANTVMSGGTTMYPGLADRMQKEISALAPSTMKIKIIAPPERKYSV 340          

HSP 2 Score: 45.4394 bits (106), Expect = 2.210e-13
Identity = 18/25 (72.00%), Postives = 20/25 (80.00%), Query Frame = -2
Query: 1077 NFQQMWITKQEYEESAPEIVSRKCL 1151
             FQQMWI+KQEY+ES P IV RKC 
Sbjct:  352 TFQQMWISKQEYDESGPAIVHRKCF 376          
BLAST of SMED30000035 vs. Ensembl Nematostella
Match: EDO38006 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SEB1])

HSP 1 Score: 46.9802 bits (110), Expect = 4.008e-13
Identity = 26/58 (44.83%), Postives = 33/58 (56.90%), Query Frame = -1
Query: 1165 ITECDFGIRNDM---------------IADCIRKEITSLGPSKMKIKIVVSPERKYSV 1293
            I +CD  IR D+               IAD ++KEI++L P  MKIKI+  PERKYSV
Sbjct:  282 IMKCDVDIRKDLYANTVLSGGSTMFPGIADRMQKEISALAPPTMKIKIIAPPERKYSV 339          

HSP 2 Score: 45.8246 bits (107), Expect = 4.008e-13
Identity = 18/25 (72.00%), Postives = 20/25 (80.00%), Query Frame = -2
Query: 1077 NFQQMWITKQEYEESAPEIVSRKCL 1151
             FQQMWI+KQEY+ES P IV RKC 
Sbjct:  351 TFQQMWISKQEYDESGPSIVHRKCF 375          
BLAST of SMED30000035 vs. Ensembl Nematostella
Match: EDO38520 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SCN8])

HSP 1 Score: 46.595 bits (109), Expect = 5.332e-13
Identity = 26/58 (44.83%), Postives = 33/58 (56.90%), Query Frame = -1
Query: 1165 ITECDFGIRNDM---------------IADCIRKEITSLGPSKMKIKIVVSPERKYSV 1293
            I +CD  IR D+               IAD ++KEI++L P  MKIKI+  PERKYSV
Sbjct:  283 IMKCDVDIRKDLYANTVLSGGSTMYPGIADRMQKEISALAPPTMKIKIIAPPERKYSV 340          

HSP 2 Score: 45.4394 bits (106), Expect = 5.332e-13
Identity = 18/25 (72.00%), Postives = 20/25 (80.00%), Query Frame = -2
Query: 1077 NFQQMWITKQEYEESAPEIVSRKCL 1151
             FQQMWI+KQEY+ES P IV RKC 
Sbjct:  352 TFQQMWISKQEYDESGPSIVHRKCF 376          
BLAST of SMED30000035 vs. Ensembl Medaka
Match: actb (cytoplasmic actin OlCA1 [Source:NCBI gene;Acc:100049433])

HSP 1 Score: 49.6766 bits (117), Expect = 1.817e-13
Identity = 28/58 (48.28%), Postives = 34/58 (58.62%), Query Frame = -1
Query: 1165 ITECDFGIRNDM---------------IADCIRKEITSLGPSKMKIKIVVSPERKYSV 1293
            I +CD  IR D+               IAD ++KEIT+L PS MKIKI+  PERKYSV
Sbjct:  284 IMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSV 341          

HSP 2 Score: 45.8246 bits (107), Expect = 1.817e-13
Identity = 18/25 (72.00%), Postives = 20/25 (80.00%), Query Frame = -2
Query: 1077 NFQQMWITKQEYEESAPEIVSRKCL 1151
             FQQMWI+KQEY+ES P IV RKC 
Sbjct:  353 TFQQMWISKQEYDESGPSIVHRKCF 377          
BLAST of SMED30000035 vs. Ensembl Medaka
Match: actb (cytoplasmic actin OlCA1 [Source:NCBI gene;Acc:100049433])

HSP 1 Score: 49.6766 bits (117), Expect = 1.940e-13
Identity = 28/58 (48.28%), Postives = 34/58 (58.62%), Query Frame = -1
Query: 1165 ITECDFGIRNDM---------------IADCIRKEITSLGPSKMKIKIVVSPERKYSV 1293
            I +CD  IR D+               IAD ++KEIT+L PS MKIKI+  PERKYSV
Sbjct:  282 IMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSV 339          

HSP 2 Score: 45.8246 bits (107), Expect = 1.940e-13
Identity = 18/25 (72.00%), Postives = 20/25 (80.00%), Query Frame = -2
Query: 1077 NFQQMWITKQEYEESAPEIVSRKCL 1151
             FQQMWI+KQEY+ES P IV RKC 
Sbjct:  351 TFQQMWISKQEYDESGPSIVHRKCF 375          
BLAST of SMED30000035 vs. Ensembl Medaka
Match: actc1a (actin, alpha cardiac [Source:NCBI gene;Acc:101170382])

HSP 1 Score: 50.0618 bits (118), Expect = 3.379e-13
Identity = 28/58 (48.28%), Postives = 34/58 (58.62%), Query Frame = -1
Query: 1165 ITECDFGIRNDM---------------IADCIRKEITSLGPSKMKIKIVVSPERKYSV 1293
            I +CD  IR D+               IAD ++KEIT+L PS MKIKI+  PERKYSV
Sbjct:  284 IMKCDIDIRKDLYANNVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSV 341          

HSP 2 Score: 44.669 bits (104), Expect = 3.379e-13
Identity = 17/24 (70.83%), Postives = 20/24 (83.33%), Query Frame = -2
Query: 1077 FQQMWITKQEYEESAPEIVSRKCL 1148
            FQQMWI+KQEY+E+ P IV RKC 
Sbjct:  354 FQQMWISKQEYDEAGPSIVHRKCF 377          
BLAST of SMED30000035 vs. Ensembl Medaka
Match: ENSORLT00000022278.2 (actin, alpha cardiac [Source:NCBI gene;Acc:101161456])

HSP 1 Score: 50.0618 bits (118), Expect = 3.379e-13
Identity = 28/58 (48.28%), Postives = 34/58 (58.62%), Query Frame = -1
Query: 1165 ITECDFGIRNDM---------------IADCIRKEITSLGPSKMKIKIVVSPERKYSV 1293
            I +CD  IR D+               IAD ++KEIT+L PS MKIKI+  PERKYSV
Sbjct:  284 IMKCDIDIRKDLYANNVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSV 341          

HSP 2 Score: 44.669 bits (104), Expect = 3.379e-13
Identity = 17/24 (70.83%), Postives = 20/24 (83.33%), Query Frame = -2
Query: 1077 FQQMWITKQEYEESAPEIVSRKCL 1148
            FQQMWI+KQEY+E+ P IV RKC 
Sbjct:  354 FQQMWISKQEYDEAGPSIVHRKCF 377          
BLAST of SMED30000035 vs. Ensembl Medaka
Match: ACTA1 (actin, alpha cardiac [Source:NCBI gene;Acc:101159887])

HSP 1 Score: 50.0618 bits (118), Expect = 3.379e-13
Identity = 28/58 (48.28%), Postives = 34/58 (58.62%), Query Frame = -1
Query: 1165 ITECDFGIRNDM---------------IADCIRKEITSLGPSKMKIKIVVSPERKYSV 1293
            I +CD  IR D+               IAD ++KEIT+L PS MKIKI+  PERKYSV
Sbjct:  284 IMKCDIDIRKDLYANNVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSV 341          

HSP 2 Score: 44.669 bits (104), Expect = 3.379e-13
Identity = 17/24 (70.83%), Postives = 20/24 (83.33%), Query Frame = -2
Query: 1077 FQQMWITKQEYEESAPEIVSRKCL 1148
            FQQMWI+KQEY+E+ P IV RKC 
Sbjct:  354 FQQMWISKQEYDEAGPSIVHRKCF 377          
BLAST of SMED30000035 vs. Planmine SMEST
Match: SMESG000069119.1 (SMESG000069119.1)

HSP 1 Score: 412.535 bits (1059), Expect = 7.043e-144
Identity = 212/214 (99.07%), Postives = 212/214 (99.07%), Query Frame = 3
Query:  372 MINWDDWITPLEETDKLPILRSSDEKIMNNIRESICGIQNVSDNNPSLKYDSEVSENLKEIELALENLSVELTCIPLNFKNILKVKKEIILNDSNESFYTKTFFVDINIYVYFVIFRKNEAIYVKGYTKSTLENANHFKPLGIVLTISLIGKPVDDNIFISKFRSNIYKIIDGEEFLEKSIIPIKSITENFIINNYIYLEFVINNTIDIDCTGL 1013
            MINWDDWITPLEETDKLPILRSSDEKIMNNIRESI GIQNVSDNNPSLKYDSEVSENLKEIELALENLSVELTCIPLNFKNILKVKKEIILNDSNESFYTKTFFVDINIYVYFVIFRKNEAIYVKGYTKSTLENANHFKPLGIV TISLIGKPVDDNIFISKFRSNIYKIIDGEEFLEKSIIPIKSITENFIINNYIYLEFVINNTIDIDCTGL
Sbjct:    1 MINWDDWITPLEETDKLPILRSSDEKIMNNIRESIYGIQNVSDNNPSLKYDSEVSENLKEIELALENLSVELTCIPLNFKNILKVKKEIILNDSNESFYTKTFFVDINIYVYFVIFRKNEAIYVKGYTKSTLENANHFKPLGIVFTISLIGKPVDDNIFISKFRSNIYKIIDGEEFLEKSIIPIKSITENFIINNYIYLEFVINNTIDIDCTGL 214          
BLAST of SMED30000035 vs. Planmine SMEST
Match: SMESG000058003.1 (SMESG000058003.1)

HSP 1 Score: 51.6026 bits (122), Expect = 4.812e-14
Identity = 30/58 (51.72%), Postives = 34/58 (58.62%), Query Frame = -1
Query: 1165 ITECDFGIRNDM---------------IADCIRKEITSLGPSKMKIKIVVSPERKYSV 1293
            I +CD  IR D+               IAD ++KEITSL PS MKIKIV  PERKYSV
Sbjct:  283 IMKCDVDIRKDLYANTVLSGGSTMFPGIADRMQKEITSLAPSTMKIKIVAPPERKYSV 340          

HSP 2 Score: 45.4394 bits (106), Expect = 4.812e-14
Identity = 18/25 (72.00%), Postives = 20/25 (80.00%), Query Frame = -2
Query: 1077 NFQQMWITKQEYEESAPEIVSRKCL 1151
             FQQMWI+KQEY+ES P IV RKC 
Sbjct:  352 TFQQMWISKQEYDESGPGIVHRKCF 376          
BLAST of SMED30000035 vs. Planmine SMEST
Match: SMESG000057992.1 (SMESG000057992.1)

HSP 1 Score: 51.6026 bits (122), Expect = 4.812e-14
Identity = 30/58 (51.72%), Postives = 34/58 (58.62%), Query Frame = -1
Query: 1165 ITECDFGIRNDM---------------IADCIRKEITSLGPSKMKIKIVVSPERKYSV 1293
            I +CD  IR D+               IAD ++KEITSL PS MKIKIV  PERKYSV
Sbjct:  283 IMKCDVDIRKDLYANTVLSGGSTMFPGIADRMQKEITSLAPSTMKIKIVAPPERKYSV 340          

HSP 2 Score: 45.4394 bits (106), Expect = 4.812e-14
Identity = 18/25 (72.00%), Postives = 20/25 (80.00%), Query Frame = -2
Query: 1077 NFQQMWITKQEYEESAPEIVSRKCL 1151
             FQQMWI+KQEY+ES P IV RKC 
Sbjct:  352 TFQQMWISKQEYDESGPGIVHRKCF 376          
BLAST of SMED30000035 vs. Planmine SMEST
Match: SMESG000057988.1 (SMESG000057988.1)

HSP 1 Score: 51.6026 bits (122), Expect = 4.812e-14
Identity = 30/58 (51.72%), Postives = 34/58 (58.62%), Query Frame = -1
Query: 1165 ITECDFGIRNDM---------------IADCIRKEITSLGPSKMKIKIVVSPERKYSV 1293
            I +CD  IR D+               IAD ++KEITSL PS MKIKIV  PERKYSV
Sbjct:  283 IMKCDVDIRKDLYANTVLSGGSTMFPGIADRMQKEITSLAPSTMKIKIVAPPERKYSV 340          

HSP 2 Score: 45.4394 bits (106), Expect = 4.812e-14
Identity = 18/25 (72.00%), Postives = 20/25 (80.00%), Query Frame = -2
Query: 1077 NFQQMWITKQEYEESAPEIVSRKCL 1151
             FQQMWI+KQEY+ES P IV RKC 
Sbjct:  352 TFQQMWISKQEYDESGPGIVHRKCF 376          
BLAST of SMED30000035 vs. Planmine SMEST
Match: SMESG000066020.1 (SMESG000066020.1)

HSP 1 Score: 51.6026 bits (122), Expect = 4.891e-14
Identity = 30/58 (51.72%), Postives = 34/58 (58.62%), Query Frame = -1
Query: 1165 ITECDFGIRNDM---------------IADCIRKEITSLGPSKMKIKIVVSPERKYSV 1293
            I +CD  IR D+               IAD ++KEITSL PS MKIKIV  PERKYSV
Sbjct:  283 IMKCDVDIRKDLYANTVLSGGSTMYPGIADRMQKEITSLAPSTMKIKIVAPPERKYSV 340          

HSP 2 Score: 45.4394 bits (106), Expect = 4.891e-14
Identity = 18/25 (72.00%), Postives = 20/25 (80.00%), Query Frame = -2
Query: 1077 NFQQMWITKQEYEESAPEIVSRKCL 1151
             FQQMWI+KQEY+ES P IV RKC 
Sbjct:  352 TFQQMWISKQEYDESGPGIVHRKCF 376          
The following BLAST results are available for this feature:
BLAST of SMED30000035 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ACTA12.154e-1348.28actin alpha 1, skeletal muscle [Source:HGNC Symbol... [more]
ACTA12.232e-1348.28actin alpha 1, skeletal muscle [Source:HGNC Symbol... [more]
ACTB2.876e-1348.28actin beta [Source:HGNC Symbol;Acc:HGNC:132][more]
ACTB2.876e-1348.28actin beta [Source:HGNC Symbol;Acc:HGNC:132][more]
ACTG13.020e-1348.28actin gamma 1 [Source:HGNC Symbol;Acc:HGNC:144][more]
back to top
BLAST of SMED30000035 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
act-48.852e-1448.28Actin-4 [Source:UniProtKB/Swiss-Prot;Acc:P10986][more]
act-48.852e-1448.28Actin-4 [Source:UniProtKB/Swiss-Prot;Acc:P10986][more]
act-48.852e-1448.28Actin-4 [Source:UniProtKB/Swiss-Prot;Acc:P10986][more]
act-48.852e-1448.28Actin-4 [Source:UniProtKB/Swiss-Prot;Acc:P10986][more]
act-48.852e-1448.28Actin-4 [Source:UniProtKB/Swiss-Prot;Acc:P10986][more]
back to top
BLAST of SMED30000035 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Act42A1.180e-1350.00gene:FBgn0000043 transcript:FBtr0086029[more]
Act5C1.805e-1348.28gene:FBgn0000042 transcript:FBtr0070822[more]
Act5C1.805e-1348.28gene:FBgn0000042 transcript:FBtr0100662[more]
Act5C1.805e-1348.28gene:FBgn0000042 transcript:FBtr0345894[more]
Act5C1.805e-1348.28gene:FBgn0000042 transcript:FBtr0070823[more]
back to top
BLAST of SMED30000035 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
actb21.111e-1350.00actin, beta 2 [Source:NCBI gene;Acc:57935][more]
actb21.111e-1350.00actin, beta 2 [Source:NCBI gene;Acc:57935][more]
actb21.111e-1350.00actin, beta 2 [Source:NCBI gene;Acc:57935][more]
actb11.148e-1350.00actin, beta 1 [Source:NCBI gene;Acc:57934][more]
actb11.148e-1350.00actin, beta 1 [Source:NCBI gene;Acc:57934][more]
back to top
BLAST of SMED30000035 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
MGC755822.351e-1348.28MGC75582, possible similarity to act2 [Source:NCBI... [more]
acta12.409e-1348.28actin, alpha 1, skeletal muscle [Source:NCBI gene;... [more]
actb3.155e-1348.28actin, beta [Source:NCBI gene;Acc:407952][more]
actg13.155e-1348.28actin gamma 1 [Source:NCBI gene;Acc:394957][more]
act35.141e-1348.28actin alpha 4 [Source:NCBI gene;Acc:394673][more]
back to top
BLAST of SMED30000035 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Acta11.617e-1348.28actin, alpha 1, skeletal muscle [Source:MGI Symbol... [more]
Actb2.083e-1348.28actin, beta [Source:MGI Symbol;Acc:MGI:87904][more]
Actb2.186e-1348.28actin, beta [Source:MGI Symbol;Acc:MGI:87904][more]
Actg12.187e-1348.28actin, gamma, cytoplasmic 1 [Source:MGI Symbol;Acc... [more]
Actg12.187e-1348.28actin, gamma, cytoplasmic 1 [Source:MGI Symbol;Acc... [more]
back to top
BLAST of SMED30000035 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P53459|ACT6_DIPDE4.486e-1348.28Actin-6 (Fragment) OS=Diphyllobothrium dendriticum... [more]
sp|Q25472|ACT2_MOLOC4.709e-1348.28Actin, muscle-type OS=Molgula oculata OX=27575 PE=... [more]
sp|P68555|ACT_TAESO4.866e-1351.72Actin OS=Taenia solium OX=6204 GN=ACT1 PE=3 SV=1[more]
sp|P68556|ACT1_DIPDE4.866e-1351.72Actin-1/4 OS=Diphyllobothrium dendriticum OX=28845... [more]
sp|P53456|ACT2_DIPDE5.028e-1351.72Actin-2 OS=Diphyllobothrium dendriticum OX=28845 G... [more]
back to top
BLAST of SMED30000035 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1V4JKX82.382e-1148.28Nuclear pore complex protein Nup133 OS=Patagioenas... [more]
M1T2202.969e-1148.28Actin-like protein (Fragment) OS=Stylophora pistil... [more]
A0A3P6HDK13.421e-1150.00Uncharacterized protein OS=Mesocestoides corti OX=... [more]
A0A183TGM44.737e-1148.28Uncharacterized protein OS=Schistocephalus solidus... [more]
A0A183S9555.889e-1148.28Uncharacterized protein OS=Schistocephalus solidus... [more]
back to top
BLAST of SMED30000035 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
actb29.663e-1450.00actin beta [Source:NCBI gene;Acc:103030443][more]
actb19.984e-1450.00actin, cytoplasmic 1 [Source:NCBI gene;Acc:1030395... [more]
actb11.040e-1350.00actin, cytoplasmic 1 [Source:NCBI gene;Acc:1030395... [more]
acta1b1.328e-1348.28actin, alpha skeletal muscle 2 [Source:NCBI gene;A... [more]
ENSAMXT00000013099.21.328e-1348.28actin, alpha skeletal muscle 2 [Source:NCBI gene;A... [more]
back to top
BLAST of SMED30000035 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 4
Match NameE-valueIdentityDescription
ENSPMAT00000004586.13.420e-1448.28pep scaffold:Pmarinus_7.0:GL479516:23873:27955:-1 ... [more]
ENSPMAT00000011113.13.448e-1448.28pep scaffold:Pmarinus_7.0:GL498954:115:1245:1 gene... [more]
ACTG21.136e-1246.55actin gamma 2, smooth muscle [Source:HGNC Symbol;A... [more]
ENSPMAT00000011230.14.255e-660.00pep scaffold:Pmarinus_7.0:GL476986:121012:122166:1... [more]
back to top
BLAST of SMED30000035 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
ACT11.504e-1241.38Actin; structural protein involved in cell polariz... [more]
back to top
BLAST of SMED30000035 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO450139.461e-1448.28Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO426461.035e-1348.28Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO379762.210e-1344.83Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO380064.008e-1344.83Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO385205.332e-1344.83Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of SMED30000035 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
actb1.817e-1348.28cytoplasmic actin OlCA1 [Source:NCBI gene;Acc:1000... [more]
actb1.940e-1348.28cytoplasmic actin OlCA1 [Source:NCBI gene;Acc:1000... [more]
actc1a3.379e-1348.28actin, alpha cardiac [Source:NCBI gene;Acc:1011703... [more]
ENSORLT00000022278.23.379e-1348.28actin, alpha cardiac [Source:NCBI gene;Acc:1011614... [more]
ACTA13.379e-1348.28actin, alpha cardiac [Source:NCBI gene;Acc:1011598... [more]
back to top
BLAST of SMED30000035 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000069119.17.043e-14499.07SMESG000069119.1[more]
SMESG000058003.14.812e-1451.72SMESG000058003.1[more]
SMESG000057992.14.812e-1451.72SMESG000057992.1[more]
SMESG000057988.14.812e-1451.72SMESG000057988.1[more]
SMESG000066020.14.891e-1451.72SMESG000066020.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30000035 ID=SMED30000035|Name=SMED30000035|organism=Schmidtea mediterranea sexual|type=transcript|length=1557bp
TCTCATTGTATTGATACTCCTGTCGTTATAGAAACGCAAATAGTGAGCGA
TGTGTGCAATCGGATCACGTGGTTGTCGCATCAACGTATCAGCAACTGCT
TCAGAAAGAGGCGTCATAATCACGTGATTTAGATAATCTGATTCAACTCT
CGTTTCAGAAATGCAGTCATTGGACATATTGTGTTCCAACGTTGCATTGA
ATTGCAAATAGCGTGGACTGAAGTTGACAGATCCATCATAATTCATTTTA
CAATTTATTGATTAATGATTTTATTGATCTAATAATATTATCAATCGTTT
TTCTCAGTTTTCAATAAATTTAGTTATAAATTTATGTAATTTTTATGACA
TTTGGAAATATATAAAGAGTAATGATAAATTGGGATGATTGGATTACTCC
TCTTGAAGAAACCGATAAGCTGCCAATATTGCGGAGTTCTGATGAAAAGA
TAATGAATAATATAAGAGAAAGTATTTGTGGAATTCAAAATGTAAGTGAT
AACAACCCATCATTAAAATACGATTCCGAAGTTTCTGAAAACTTAAAGGA
AATCGAATTGGCTCTTGAAAATTTATCAGTAGAGTTGACATGTATTCCAC
TAAACTTTAAGAATATATTGAAAGTCAAAAAAGAAATTATTTTAAATGAT
AGCAATGAAAGCTTTTATACAAAAACGTTTTTTGTCGATATTAACATATA
TGTTTATTTCGTAATATTTCGTAAAAATGAAGCAATTTACGTTAAGGGCT
ACACAAAATCGACATTGGAAAATGCAAATCATTTCAAACCACTCGGCATT
GTGTTGACAATTTCTTTGATCGGCAAACCAGTCGATGATAATATTTTTAT
ATCGAAATTCAGGTCAAATATTTATAAGATAATCGATGGTGAAGAATTTT
TAGAGAAATCGATTATTCCCATTAAATCGATAACGGAAAATTTCATTATT
AATAATTATATTTATTTAGAATTTGTTATAAATAACACAATTGATATTGA
CTGCACAGGTCTCTAAATTTTATTTCATAATAAATCTTTTTTTCAATTTT
AAATAAACAATGAAAGGAATCCATTACAAACATTTTCTGCTAACTATTTC
AGGAGCAGATTCTTCATATTCTTGCTTAGTTATCCACATTTGTTGGAAGT
TGATAGAGAAGCTAAACTGAATATTTTCTTTCGGGAGAAACAACGATTTT
GATCTTCATTTTACTGGGGCCCAATGAAGTTATTTCTTTTCGTATACAAT
CAGCTATCATATCATTTCTGATACCAAAATCGCATTCGGTTATATATACC
AGCGGATTTCATTTCCAAAAATGATTTAGGGCAATTGGAATATTTCACTG
CTTGTCTTTTGCCCAAGGTAAAATCTATCATGGGGTGAACTAATAGCATA
AAAAAGAGCTTAACTTACCGTTGTATTTACAAGCAAAAGACCATAATTTA
GCAATAATTGAATTAATTTTGGCTTATATTAACATTCAACAGAATAAAAA
TAAAATCCTCCATGTTGGATAAAAATAAATATCAACTAAATGATAAAAAT
AATATTG
back to top

protein sequence of SMED30000035-orf-1

>SMED30000035-orf-1 ID=SMED30000035-orf-1|Name=SMED30000035-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=215bp
MINWDDWITPLEETDKLPILRSSDEKIMNNIRESICGIQNVSDNNPSLKY
DSEVSENLKEIELALENLSVELTCIPLNFKNILKVKKEIILNDSNESFYT
KTFFVDINIYVYFVIFRKNEAIYVKGYTKSTLENANHFKPLGIVLTISLI
GKPVDDNIFISKFRSNIYKIIDGEEFLEKSIIPIKSITENFIINNYIYLE
FVINNTIDIDCTGL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000020protonephridia
Vocabulary: INTERPRO
TermDefinition
IPR007858Dpy-30_motif
IPR004001Actin_CS
IPR004000Actin