VASt domain-containing protein

Overview
NameVASt domain-containing protein
Smed IDSMED30000033
Length (bp)2128
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of VASt domain-containing protein (SMED30000033) t-SNE clustered cells

Violin plots show distribution of expression levels for VASt domain-containing protein (SMED30000033) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of VASt domain-containing protein (SMED30000033) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for VASt domain-containing protein (SMED30000033) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30000033

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
neuronSMED30000033SMESG000033356.1 dd_Smed_v4_9149_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30000033SMESG000033356.1 dd_Smed_v4_9149_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
posterior region of the whole animalSMED30000033SMESG000033356.1 dd_Smed_v4_9149_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30000033SMESG000033356.1 dd_Smed_v4_9149_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
medial muscle cellSMED30000033SMESG000033356.1 dd_Smed_v4_9149_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30000033SMESG000033356.1 dd_Smed_v4_9149_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of VASt domain-containing protein vs. Ensembl Human
Match: GRAMD1B (GRAM domain containing 1B [Source:HGNC Symbol;Acc:HGNC:29214])

HSP 1 Score: 189.119 bits (479), Expect = 1.693e-50
Identity = 144/460 (31.30%), Postives = 225/460 (48.91%), Query Frame = 1
Query:  286 TYKQRRSDFKKSFKDTNAESSPLISDYSCAIYAGTPKILQQGRMYITTEFLCFYSRFITFEQKITVSYKDIKELTKEKTAMVFQNAIQIVTDNNEKHFFSSFTTRDRAYYVIHKLWMESKDGIKLSNAAFWDRVRENYGNDLGFLLEDVEYDESNATQFTARY--KIPRRPSEIMSNTSSPDDSLYESLEESP--VSDNVIDYSLCN-GHNLKSENFDKKPPSIPEEEIKFDLSFRNSTQXXXXXXXXXXXXXXXXXXXSSRPAAICSDHEHLPNMLLD------------------------EEFSINVHTLWTFIFTDNAFFRALCAMRFITEITQSNWSDDVDREKCRTIYYTVNLKNRIGPKKSPTVEKQVLLEGSCKDYIYYVESIVRTVGIPMSDSFHIVLRYCLLYINPNKSRIKISMKIVYDKTVFFATKSIIDSSVKSGCIDYHKDLKQAL 1578
            TYKQR  DF+K FK    ++  LI DYSCA+      IL QGR+Y++  ++CFYS    +E  +TV  KDI  +TKEKTA +  NAIQ+ TD +EKHFF+SF  RDR Y ++ +LW  +     L     W  V + YGN+LG   +D +Y   +    T  Y  +IP   +E+  N SS   S+    + SP     ++ + +L + G +    +FD  P  + EE ++ D S      I      +   I PV     + P+   +D+E +P  L D                        E F+ +V  L+  +FT++ F R     R  ++I    W  + +  + R I YT+ L N + PK +   E Q + + S +   Y +++ V T  +P  D F+ + RY L  +  NKSR+++S ++ Y K  +   K+ I+ +  SG  DY + L+  L
Sbjct:   50 TYKQRNEDFRKLFKQL-PDTERLIVDYSCALQR---DILLQGRLYLSENWICFYSNIFRWETLLTVRLKDICSMTKEKTARLIPNAIQVCTD-SEKHFFTSFGARDRTYMMMFRLWQNALLEKPLCPKELWHFVHQCYGNELGLTSDDEDYVPPDDDFNTMGYCEEIPVEENEV--NDSSSKSSIETKPDASPQLPKKSITNSTLTSTGSSEAPVSFDGLP--LEEEALEGDGSLEKELAIDNIMGEKIEMIAPV-----NSPSLDFNDNEDIPTELSDSSDTHDEGEVQAFYEDLSGRQYVNEVFNFSVDKLYDLLFTNSPFQRDFMEQRRFSDIIFHPWKKEENGNQSRVILYTITLTNPLAPKTATVRETQTMYKASQESECYVIDAEVLTHDVPYHDYFYTINRYTLTRVARNKSRLRVSTELRYRKQPWGLVKTFIEKNFWSGLEDYFRHLESEL 495          
BLAST of VASt domain-containing protein vs. Ensembl Human
Match: GRAMD1B (GRAM domain containing 1B [Source:HGNC Symbol;Acc:HGNC:29214])

HSP 1 Score: 188.734 bits (478), Expect = 2.396e-50
Identity = 144/460 (31.30%), Postives = 225/460 (48.91%), Query Frame = 1
Query:  286 TYKQRRSDFKKSFKDTNAESSPLISDYSCAIYAGTPKILQQGRMYITTEFLCFYSRFITFEQKITVSYKDIKELTKEKTAMVFQNAIQIVTDNNEKHFFSSFTTRDRAYYVIHKLWMESKDGIKLSNAAFWDRVRENYGNDLGFLLEDVEYDESNATQFTARY--KIPRRPSEIMSNTSSPDDSLYESLEESP--VSDNVIDYSLCN-GHNLKSENFDKKPPSIPEEEIKFDLSFRNSTQXXXXXXXXXXXXXXXXXXXSSRPAAICSDHEHLPNMLLD------------------------EEFSINVHTLWTFIFTDNAFFRALCAMRFITEITQSNWSDDVDREKCRTIYYTVNLKNRIGPKKSPTVEKQVLLEGSCKDYIYYVESIVRTVGIPMSDSFHIVLRYCLLYINPNKSRIKISMKIVYDKTVFFATKSIIDSSVKSGCIDYHKDLKQAL 1578
            TYKQR  DF+K FK    ++  LI DYSCA+      IL QGR+Y++  ++CFYS    +E  +TV  KDI  +TKEKTA +  NAIQ+ TD +EKHFF+SF  RDR Y ++ +LW  +     L     W  V + YGN+LG   +D +Y   +    T  Y  +IP   +E+  N SS   S+    + SP     ++ + +L + G +    +FD  P  + EE ++ D S      I      +   I PV     + P+   +D+E +P  L D                        E F+ +V  L+  +FT++ F R     R  ++I    W  + +  + R I YT+ L N + PK +   E Q + + S +   Y +++ V T  +P  D F+ + RY L  +  NKSR+++S ++ Y K  +   K+ I+ +  SG  DY + L+  L
Sbjct:   50 TYKQRNEDFRKLFKQL-PDTERLIVDYSCALQR---DILLQGRLYLSENWICFYSNIFRWETLLTVRLKDICSMTKEKTARLIPNAIQVCTD-SEKHFFTSFGARDRTYMMMFRLWQNALLEKPLCPKELWHFVHQCYGNELGLTSDDEDYVPPDDDFNTMGYCEEIPVEENEV--NDSSSKSSIETKPDASPQLPKKSITNSTLTSTGSSEAPVSFDGLP--LEEEALEGDGSLEKELAIDNIMGEKIEMIAPV-----NSPSLDFNDNEDIPTELSDSSDTHDEGEVQAFYEDLSGRQYVNEVFNFSVDKLYDLLFTNSPFQRDFMEQRRFSDIIFHPWKKEENGNQSRVILYTITLTNPLAPKTATVRETQTMYKASQESECYVIDAEVLTHDVPYHDYFYTINRYTLTRVARNKSRLRVSTELRYRKQPWGLVKTFIEKNFWSGLEDYFRHLESEL 495          
BLAST of VASt domain-containing protein vs. Ensembl Human
Match: GRAMD1B (GRAM domain containing 1B [Source:HGNC Symbol;Acc:HGNC:29214])

HSP 1 Score: 188.734 bits (478), Expect = 2.847e-50
Identity = 144/460 (31.30%), Postives = 225/460 (48.91%), Query Frame = 1
Query:  286 TYKQRRSDFKKSFKDTNAESSPLISDYSCAIYAGTPKILQQGRMYITTEFLCFYSRFITFEQKITVSYKDIKELTKEKTAMVFQNAIQIVTDNNEKHFFSSFTTRDRAYYVIHKLWMESKDGIKLSNAAFWDRVRENYGNDLGFLLEDVEYDESNATQFTARY--KIPRRPSEIMSNTSSPDDSLYESLEESP--VSDNVIDYSLCN-GHNLKSENFDKKPPSIPEEEIKFDLSFRNSTQXXXXXXXXXXXXXXXXXXXSSRPAAICSDHEHLPNMLLD------------------------EEFSINVHTLWTFIFTDNAFFRALCAMRFITEITQSNWSDDVDREKCRTIYYTVNLKNRIGPKKSPTVEKQVLLEGSCKDYIYYVESIVRTVGIPMSDSFHIVLRYCLLYINPNKSRIKISMKIVYDKTVFFATKSIIDSSVKSGCIDYHKDLKQAL 1578
            TYKQR  DF+K FK    ++  LI DYSCA+      IL QGR+Y++  ++CFYS    +E  +TV  KDI  +TKEKTA +  NAIQ+ TD +EKHFF+SF  RDR Y ++ +LW  +     L     W  V + YGN+LG   +D +Y   +    T  Y  +IP   +E+  N SS   S+    + SP     ++ + +L + G +    +FD  P  + EE ++ D S      I      +   I PV     + P+   +D+E +P  L D                        E F+ +V  L+  +FT++ F R     R  ++I    W  + +  + R I YT+ L N + PK +   E Q + + S +   Y +++ V T  +P  D F+ + RY L  +  NKSR+++S ++ Y K  +   K+ I+ +  SG  DY + L+  L
Sbjct:   54 TYKQRNEDFRKLFKQL-PDTERLIVDYSCALQRD---ILLQGRLYLSENWICFYSNIFRWETLLTVRLKDICSMTKEKTARLIPNAIQVCTD-SEKHFFTSFGARDRTYMMMFRLWQNALLEKPLCPKELWHFVHQCYGNELGLTSDDEDYVPPDDDFNTMGYCEEIPVEENEV--NDSSSKSSIETKPDASPQLPKKSITNSTLTSTGSSEAPVSFDGLP--LEEEALEGDGSLEKELAIDNIMGEKIEMIAPV-----NSPSLDFNDNEDIPTELSDSSDTHDEGEVQAFYEDLSGRQYVNEVFNFSVDKLYDLLFTNSPFQRDFMEQRRFSDIIFHPWKKEENGNQSRVILYTITLTNPLAPKTATVRETQTMYKASQESECYVIDAEVLTHDVPYHDYFYTINRYTLTRVARNKSRLRVSTELRYRKQPWGLVKTFIEKNFWSGLEDYFRHLESEL 499          
BLAST of VASt domain-containing protein vs. Ensembl Human
Match: GRAMD1B (GRAM domain containing 1B [Source:HGNC Symbol;Acc:HGNC:29214])

HSP 1 Score: 189.119 bits (479), Expect = 3.167e-50
Identity = 144/460 (31.30%), Postives = 225/460 (48.91%), Query Frame = 1
Query:  286 TYKQRRSDFKKSFKDTNAESSPLISDYSCAIYAGTPKILQQGRMYITTEFLCFYSRFITFEQKITVSYKDIKELTKEKTAMVFQNAIQIVTDNNEKHFFSSFTTRDRAYYVIHKLWMESKDGIKLSNAAFWDRVRENYGNDLGFLLEDVEYDESNATQFTARY--KIPRRPSEIMSNTSSPDDSLYESLEESP--VSDNVIDYSLCN-GHNLKSENFDKKPPSIPEEEIKFDLSFRNSTQXXXXXXXXXXXXXXXXXXXSSRPAAICSDHEHLPNMLLD------------------------EEFSINVHTLWTFIFTDNAFFRALCAMRFITEITQSNWSDDVDREKCRTIYYTVNLKNRIGPKKSPTVEKQVLLEGSCKDYIYYVESIVRTVGIPMSDSFHIVLRYCLLYINPNKSRIKISMKIVYDKTVFFATKSIIDSSVKSGCIDYHKDLKQAL 1578
            TYKQR  DF+K FK    ++  LI DYSCA+      IL QGR+Y++  ++CFYS    +E  +TV  KDI  +TKEKTA +  NAIQ+ TD +EKHFF+SF  RDR Y ++ +LW  +     L     W  V + YGN+LG   +D +Y   +    T  Y  +IP   +E+  N SS   S+    + SP     ++ + +L + G +    +FD  P  + EE ++ D S      I      +   I PV     + P+   +D+E +P  L D                        E F+ +V  L+  +FT++ F R     R  ++I    W  + +  + R I YT+ L N + PK +   E Q + + S +   Y +++ V T  +P  D F+ + RY L  +  NKSR+++S ++ Y K  +   K+ I+ +  SG  DY + L+  L
Sbjct:   90 TYKQRNEDFRKLFKQL-PDTERLIVDYSCALQR---DILLQGRLYLSENWICFYSNIFRWETLLTVRLKDICSMTKEKTARLIPNAIQVCTD-SEKHFFTSFGARDRTYMMMFRLWQNALLEKPLCPKELWHFVHQCYGNELGLTSDDEDYVPPDDDFNTMGYCEEIPVEENEV--NDSSSKSSIETKPDASPQLPKKSITNSTLTSTGSSEAPVSFDGLP--LEEEALEGDGSLEKELAIDNIMGEKIEMIAPV-----NSPSLDFNDNEDIPTELSDSSDTHDEGEVQAFYEDLSGRQYVNEVFNFSVDKLYDLLFTNSPFQRDFMEQRRFSDIIFHPWKKEENGNQSRVILYTITLTNPLAPKTATVRETQTMYKASQESECYVIDAEVLTHDVPYHDYFYTINRYTLTRVARNKSRLRVSTELRYRKQPWGLVKTFIEKNFWSGLEDYFRHLESEL 535          
BLAST of VASt domain-containing protein vs. Ensembl Human
Match: GRAMD1B (GRAM domain containing 1B [Source:HGNC Symbol;Acc:HGNC:29214])

HSP 1 Score: 188.734 bits (478), Expect = 3.519e-50
Identity = 144/460 (31.30%), Postives = 225/460 (48.91%), Query Frame = 1
Query:  286 TYKQRRSDFKKSFKDTNAESSPLISDYSCAIYAGTPKILQQGRMYITTEFLCFYSRFITFEQKITVSYKDIKELTKEKTAMVFQNAIQIVTDNNEKHFFSSFTTRDRAYYVIHKLWMESKDGIKLSNAAFWDRVRENYGNDLGFLLEDVEYDESNATQFTARY--KIPRRPSEIMSNTSSPDDSLYESLEESP--VSDNVIDYSLCN-GHNLKSENFDKKPPSIPEEEIKFDLSFRNSTQXXXXXXXXXXXXXXXXXXXSSRPAAICSDHEHLPNMLLD------------------------EEFSINVHTLWTFIFTDNAFFRALCAMRFITEITQSNWSDDVDREKCRTIYYTVNLKNRIGPKKSPTVEKQVLLEGSCKDYIYYVESIVRTVGIPMSDSFHIVLRYCLLYINPNKSRIKISMKIVYDKTVFFATKSIIDSSVKSGCIDYHKDLKQAL 1578
            TYKQR  DF+K FK    ++  LI DYSCA+      IL QGR+Y++  ++CFYS    +E  +TV  KDI  +TKEKTA +  NAIQ+ TD +EKHFF+SF  RDR Y ++ +LW  +     L     W  V + YGN+LG   +D +Y   +    T  Y  +IP   +E+  N SS   S+    + SP     ++ + +L + G +    +FD  P  + EE ++ D S      I      +   I PV     + P+   +D+E +P  L D                        E F+ +V  L+  +FT++ F R     R  ++I    W  + +  + R I YT+ L N + PK +   E Q + + S +   Y +++ V T  +P  D F+ + RY L  +  NKSR+++S ++ Y K  +   K+ I+ +  SG  DY + L+  L
Sbjct:   90 TYKQRNEDFRKLFKQL-PDTERLIVDYSCALQR---DILLQGRLYLSENWICFYSNIFRWETLLTVRLKDICSMTKEKTARLIPNAIQVCTD-SEKHFFTSFGARDRTYMMMFRLWQNALLEKPLCPKELWHFVHQCYGNELGLTSDDEDYVPPDDDFNTMGYCEEIPVEENEV--NDSSSKSSIETKPDASPQLPKKSITNSTLTSTGSSEAPVSFDGLP--LEEEALEGDGSLEKELAIDNIMGEKIEMIAPV-----NSPSLDFNDNEDIPTELSDSSDTHDEGEVQAFYEDLSGRQYVNEVFNFSVDKLYDLLFTNSPFQRDFMEQRRFSDIIFHPWKKEENGNQSRVILYTITLTNPLAPKTATVRETQTMYKASQESECYVIDAEVLTHDVPYHDYFYTINRYTLTRVARNKSRLRVSTELRYRKQPWGLVKTFIEKNFWSGLEDYFRHLESEL 535          
BLAST of VASt domain-containing protein vs. Ensembl Celegans
Match: ZC328.3 (pep chromosome:WBcel235:I:6409050:6412249:-1 gene:WBGene00022593.1 transcript:ZC328.3b.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:ZC328.3)

HSP 1 Score: 91.2781 bits (225), Expect = 1.901e-19
Identity = 50/173 (28.90%), Postives = 80/173 (46.24%), Query Frame = 1
Query: 1069 CSDHEHLPNMLLDEEFSINVHTLWTFIFTDNAFFRALCAMRFITEITQSNWSDDVDREKCRTIYYTVNLKNRIGPKKSPTVEKQVLLEGSCKDYIYYVESIVRTVGIPMSDSFHIVLRYCLLYINPNKSRIKISMKIVYDKTVFFATKSIIDSSVKSGCIDYHKDLKQALLIE 1587
            C   EH   +++D+EF ++V   +  +FTDN F   L       E   + W  D   +  RT  YTV+L + + PK     EKQ+L           ++   +  G+P SD+F +  RYC+    P   RIK+   ++Y K+ +   K+ I+     G +D H  L   L+ E
Sbjct:   65 CPCSEHFGRLIMDKEFKVSVEKFYELLFTDNEFLTMLNQKTKTAEYVAATWVRDHQGDNTRTCTYTVSLAHAMAPKAIIVNEKQILTHYPNPKQGIMMQKETQNSGVPYSDNFTVNCRYCISRTGPTSCRIKVHGGVMYKKSTWAVVKTFIEKGTHQG-LDEHYQLLSKLVDE 236          
BLAST of VASt domain-containing protein vs. Ensembl Celegans
Match: ZC328.3 (pep chromosome:WBcel235:I:6409050:6417010:-1 gene:WBGene00022593.1 transcript:ZC328.3a.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:ZC328.3)

HSP 1 Score: 91.2781 bits (225), Expect = 6.817e-19
Identity = 50/173 (28.90%), Postives = 80/173 (46.24%), Query Frame = 1
Query: 1069 CSDHEHLPNMLLDEEFSINVHTLWTFIFTDNAFFRALCAMRFITEITQSNWSDDVDREKCRTIYYTVNLKNRIGPKKSPTVEKQVLLEGSCKDYIYYVESIVRTVGIPMSDSFHIVLRYCLLYINPNKSRIKISMKIVYDKTVFFATKSIIDSSVKSGCIDYHKDLKQALLIE 1587
            C   EH   +++D+EF ++V   +  +FTDN F   L       E   + W  D   +  RT  YTV+L + + PK     EKQ+L           ++   +  G+P SD+F +  RYC+    P   RIK+   ++Y K+ +   K+ I+     G +D H  L   L+ E
Sbjct:  296 CPCSEHFGRLIMDKEFKVSVEKFYELLFTDNEFLTMLNQKTKTAEYVAATWVRDHQGDNTRTCTYTVSLAHAMAPKAIIVNEKQILTHYPNPKQGIMMQKETQNSGVPYSDNFTVNCRYCISRTGPTSCRIKVHGGVMYKKSTWAVVKTFIEKGTHQG-LDEHYQLLSKLVDE 467          

HSP 2 Score: 86.2705 bits (212), Expect = 2.710e-17
Identity = 54/159 (33.96%), Postives = 83/159 (52.20%), Query Frame = 1
Query:  229 KMKNYFLENFTKK--EPYMLKTYKQRRSDFKKSFKDTN--AESSPLISDYSCAIYAGTPKILQQGRMYITTEFLCFYSRFITFEQKITVSYKDIKELTKEKTAMVFQNAIQIVTDNNEKHFFSSFTTRDRAYYVIHKLW--MESKDGIKLSNAAFWDRV 687
            +M+ YF E   K      +  +Y +R   FKK F D     E+   ++ YSCA      +IL QGRM+I+   +CFY+  I +E  + +  K+I  + K K A +F N+IQI  D  EK+FF+SF  RD++Y V+      +  +D   ++    WD V
Sbjct:   47 RMEKYFAEKPDKNIFMKLIHPSYHERNLQFKKIFVDKGLIEENDQFLASYSCAYQR---EILAQGRMFISQFNVCFYANIIGWETTLVIPMKEISLVKKMKAAFIFPNSIQIERDTKEKYFFASFINRDKSYQVLTTAHQKVAGEDEKAMTREEVWDMV 202          
BLAST of VASt domain-containing protein vs. Ensembl Fly
Match: GramD1B (gene:FBgn0085423 transcript:FBtr0112639)

HSP 1 Score: 117.857 bits (294), Expect = 7.138e-27
Identity = 56/150 (37.33%), Postives = 93/150 (62.00%), Query Frame = 1
Query:  289 YKQRRSDFKKSFKDTNAESSPLISDYSCAIYAGTPKILQQGRMYITTEFLCFYSRFITFEQKITVSYKDIKELTKEKTAMVFQNAIQIVTDNNEKHFFSSFTTRDRAYYVIHKLWMESKDGIKLSNAAFWDRVRENYGNDLGFLLEDVEY 738
            YK R  DFKK FKD   +   LI DYSCA+      IL QGR+Y++  ++CF++   ++E  +++ +KD+  +TKEKTA+V  NAI I +   +K+FF++FT+RD+++ ++ ++W  +    + S    W  V   YG++LG   +D +Y
Sbjct:  332 YKSRAEDFKKLFKDVPNDER-LIVDYSCALQR---DILVQGRLYVSQNYVCFHANIFSWETHVSIKWKDVTAITKEKTALVIPNAISI-SSGKDKYFFATFTSRDKSFLMLFRVWQNTLMNKQFSPQEIWQHVHTCYGDELGLTTDDEDY 476          

HSP 2 Score: 78.1814 bits (191), Expect = 1.644e-14
Identity = 44/159 (27.67%), Postives = 77/159 (48.43%), Query Frame = 1
Query: 1114 FSINVHTLWTFIFTDNAFFRALCAMRFITEITQSNWSDDVDREKCRTIYYTVNLKNRIGPKKSPTVEKQVLLEGSCKDYIYYVESIVRTVGIPMSDSFHIVLRYCLLYINPNKSRIKISMKIVYDKTVFFATKSIIDSSVKSGCIDYHKDLKQALLIES 1590
              INV TL+  +F+ + F     AMR  T++    W+ + +  + RT+  TV L   +GPK S   E Q   E S    +Y ++      GIP ++SF +++ +CL     + + + I  +I Y K+++   K  I+ +  +G  D+      AL  E+
Sbjct:  747 LPINVDTLFNLLFSKSKFITDFHAMRKSTDLVLGEWTKNEEGLQVRTVNVTVQLAASVGPKTSKVTEYQTQRECSKPGELYSIDVNSVNAGIPYAESFSVLIHFCLARTVDDHTMLSIHTQIKYKKSIWGVVKGFIEKNTWAGLEDFFGAQLHALQSET 905          
BLAST of VASt domain-containing protein vs. Ensembl Fly
Match: GramD1B (gene:FBgn0085423 transcript:FBtr0306333)

HSP 1 Score: 117.857 bits (294), Expect = 7.716e-27
Identity = 56/150 (37.33%), Postives = 93/150 (62.00%), Query Frame = 1
Query:  289 YKQRRSDFKKSFKDTNAESSPLISDYSCAIYAGTPKILQQGRMYITTEFLCFYSRFITFEQKITVSYKDIKELTKEKTAMVFQNAIQIVTDNNEKHFFSSFTTRDRAYYVIHKLWMESKDGIKLSNAAFWDRVRENYGNDLGFLLEDVEY 738
            YK R  DFKK FKD   +   LI DYSCA+      IL QGR+Y++  ++CF++   ++E  +++ +KD+  +TKEKTA+V  NAI I +   +K+FF++FT+RD+++ ++ ++W  +    + S    W  V   YG++LG   +D +Y
Sbjct:  342 YKSRAEDFKKLFKDVPNDER-LIVDYSCALQR---DILVQGRLYVSQNYVCFHANIFSWETHVSIKWKDVTAITKEKTALVIPNAISI-SSGKDKYFFATFTSRDKSFLMLFRVWQNTLMNKQFSPQEIWQHVHTCYGDELGLTTDDEDY 486          

HSP 2 Score: 78.1814 bits (191), Expect = 1.629e-14
Identity = 44/159 (27.67%), Postives = 77/159 (48.43%), Query Frame = 1
Query: 1114 FSINVHTLWTFIFTDNAFFRALCAMRFITEITQSNWSDDVDREKCRTIYYTVNLKNRIGPKKSPTVEKQVLLEGSCKDYIYYVESIVRTVGIPMSDSFHIVLRYCLLYINPNKSRIKISMKIVYDKTVFFATKSIIDSSVKSGCIDYHKDLKQALLIES 1590
              INV TL+  +F+ + F     AMR  T++    W+ + +  + RT+  TV L   +GPK S   E Q   E S    +Y ++      GIP ++SF +++ +CL     + + + I  +I Y K+++   K  I+ +  +G  D+      AL  E+
Sbjct:  757 LPINVDTLFNLLFSKSKFITDFHAMRKSTDLVLGEWTKNEEGLQVRTVNVTVQLAASVGPKTSKVTEYQTQRECSKPGELYSIDVNSVNAGIPYAESFSVLIHFCLARTVDDHTMLSIHTQIKYKKSIWGVVKGFIEKNTWAGLEDFFGAQLHALQSET 915          
BLAST of VASt domain-containing protein vs. Ensembl Fly
Match: GramD1B (gene:FBgn0085423 transcript:FBtr0112638)

HSP 1 Score: 117.857 bits (294), Expect = 8.050e-27
Identity = 56/150 (37.33%), Postives = 93/150 (62.00%), Query Frame = 1
Query:  289 YKQRRSDFKKSFKDTNAESSPLISDYSCAIYAGTPKILQQGRMYITTEFLCFYSRFITFEQKITVSYKDIKELTKEKTAMVFQNAIQIVTDNNEKHFFSSFTTRDRAYYVIHKLWMESKDGIKLSNAAFWDRVRENYGNDLGFLLEDVEY 738
            YK R  DFKK FKD   +   LI DYSCA+      IL QGR+Y++  ++CF++   ++E  +++ +KD+  +TKEKTA+V  NAI I +   +K+FF++FT+RD+++ ++ ++W  +    + S    W  V   YG++LG   +D +Y
Sbjct:  406 YKSRAEDFKKLFKDVPNDER-LIVDYSCALQR---DILVQGRLYVSQNYVCFHANIFSWETHVSIKWKDVTAITKEKTALVIPNAISI-SSGKDKYFFATFTSRDKSFLMLFRVWQNTLMNKQFSPQEIWQHVHTCYGDELGLTTDDEDY 550          

HSP 2 Score: 78.5666 bits (192), Expect = 1.455e-14
Identity = 44/159 (27.67%), Postives = 77/159 (48.43%), Query Frame = 1
Query: 1114 FSINVHTLWTFIFTDNAFFRALCAMRFITEITQSNWSDDVDREKCRTIYYTVNLKNRIGPKKSPTVEKQVLLEGSCKDYIYYVESIVRTVGIPMSDSFHIVLRYCLLYINPNKSRIKISMKIVYDKTVFFATKSIIDSSVKSGCIDYHKDLKQALLIES 1590
              INV TL+  +F+ + F     AMR  T++    W+ + +  + RT+  TV L   +GPK S   E Q   E S    +Y ++      GIP ++SF +++ +CL     + + + I  +I Y K+++   K  I+ +  +G  D+      AL  E+
Sbjct:  821 LPINVDTLFNLLFSKSKFITDFHAMRKSTDLVLGEWTKNEEGLQVRTVNVTVQLAASVGPKTSKVTEYQTQRECSKPGELYSIDVNSVNAGIPYAESFSVLIHFCLARTVDDHTMLSIHTQIKYKKSIWGVVKGFIEKNTWAGLEDFFGAQLHALQSET 979          
BLAST of VASt domain-containing protein vs. Ensembl Fly
Match: GramD1B (gene:FBgn0085423 transcript:FBtr0112641)

HSP 1 Score: 117.472 bits (293), Expect = 1.006e-26
Identity = 56/150 (37.33%), Postives = 93/150 (62.00%), Query Frame = 1
Query:  289 YKQRRSDFKKSFKDTNAESSPLISDYSCAIYAGTPKILQQGRMYITTEFLCFYSRFITFEQKITVSYKDIKELTKEKTAMVFQNAIQIVTDNNEKHFFSSFTTRDRAYYVIHKLWMESKDGIKLSNAAFWDRVRENYGNDLGFLLEDVEY 738
            YK R  DFKK FKD   +   LI DYSCA+      IL QGR+Y++  ++CF++   ++E  +++ +KD+  +TKEKTA+V  NAI I +   +K+FF++FT+RD+++ ++ ++W  +    + S    W  V   YG++LG   +D +Y
Sbjct:  332 YKSRAEDFKKLFKDVPNDER-LIVDYSCALQR---DILVQGRLYVSQNYVCFHANIFSWETHVSIKWKDVTAITKEKTALVIPNAISI-SSGKDKYFFATFTSRDKSFLMLFRVWQNTLMNKQFSPQEIWQHVHTCYGDELGLTTDDEDY 476          

HSP 2 Score: 78.1814 bits (191), Expect = 1.912e-14
Identity = 44/159 (27.67%), Postives = 77/159 (48.43%), Query Frame = 1
Query: 1114 FSINVHTLWTFIFTDNAFFRALCAMRFITEITQSNWSDDVDREKCRTIYYTVNLKNRIGPKKSPTVEKQVLLEGSCKDYIYYVESIVRTVGIPMSDSFHIVLRYCLLYINPNKSRIKISMKIVYDKTVFFATKSIIDSSVKSGCIDYHKDLKQALLIES 1590
              INV TL+  +F+ + F     AMR  T++    W+ + +  + RT+  TV L   +GPK S   E Q   E S    +Y ++      GIP ++SF +++ +CL     + + + I  +I Y K+++   K  I+ +  +G  D+      AL  E+
Sbjct:  747 LPINVDTLFNLLFSKSKFITDFHAMRKSTDLVLGEWTKNEEGLQVRTVNVTVQLAASVGPKTSKVTEYQTQRECSKPGELYSIDVNSVNAGIPYAESFSVLIHFCLARTVDDHTMLSIHTQIKYKKSIWGVVKGFIEKNTWAGLEDFFGAQLHALQSET 905          
BLAST of VASt domain-containing protein vs. Ensembl Fly
Match: GramD1B (gene:FBgn0085423 transcript:FBtr0332409)

HSP 1 Score: 117.472 bits (293), Expect = 1.137e-26
Identity = 56/150 (37.33%), Postives = 93/150 (62.00%), Query Frame = 1
Query:  289 YKQRRSDFKKSFKDTNAESSPLISDYSCAIYAGTPKILQQGRMYITTEFLCFYSRFITFEQKITVSYKDIKELTKEKTAMVFQNAIQIVTDNNEKHFFSSFTTRDRAYYVIHKLWMESKDGIKLSNAAFWDRVRENYGNDLGFLLEDVEY 738
            YK R  DFKK FKD   +   LI DYSCA+      IL QGR+Y++  ++CF++   ++E  +++ +KD+  +TKEKTA+V  NAI I +   +K+FF++FT+RD+++ ++ ++W  +    + S    W  V   YG++LG   +D +Y
Sbjct:  308 YKSRAEDFKKLFKDVPNDER-LIVDYSCALQR---DILVQGRLYVSQNYVCFHANIFSWETHVSIKWKDVTAITKEKTALVIPNAISI-SSGKDKYFFATFTSRDKSFLMLFRVWQNTLMNKQFSPQEIWQHVHTCYGDELGLTTDDEDY 452          

HSP 2 Score: 78.1814 bits (191), Expect = 1.769e-14
Identity = 44/159 (27.67%), Postives = 77/159 (48.43%), Query Frame = 1
Query: 1114 FSINVHTLWTFIFTDNAFFRALCAMRFITEITQSNWSDDVDREKCRTIYYTVNLKNRIGPKKSPTVEKQVLLEGSCKDYIYYVESIVRTVGIPMSDSFHIVLRYCLLYINPNKSRIKISMKIVYDKTVFFATKSIIDSSVKSGCIDYHKDLKQALLIES 1590
              INV TL+  +F+ + F     AMR  T++    W+ + +  + RT+  TV L   +GPK S   E Q   E S    +Y ++      GIP ++SF +++ +CL     + + + I  +I Y K+++   K  I+ +  +G  D+      AL  E+
Sbjct:  723 LPINVDTLFNLLFSKSKFITDFHAMRKSTDLVLGEWTKNEEGLQVRTVNVTVQLAASVGPKTSKVTEYQTQRECSKPGELYSIDVNSVNAGIPYAESFSVLIHFCLARTVDDHTMLSIHTQIKYKKSIWGVVKGFIEKNTWAGLEDFFGAQLHALQSET 881          
BLAST of VASt domain-containing protein vs. Ensembl Zebrafish
Match: AL953903.4 (GRAM domain containing 1Ba [Source:NCBI gene;Acc:568698])

HSP 1 Score: 181.415 bits (459), Expect = 6.086e-48
Identity = 142/479 (29.65%), Postives = 220/479 (45.93%), Query Frame = 1
Query:  286 TYKQRRSDFKKSFKDTNAESSPLISDYSCAIYAGTPKILQQGRMYITTEFLCFYSRFITFEQKITVSYKDIKELTKEKTAMVFQNAIQIVTDNNEKHFFSSFTTRDRAYYVIHKLWMESKDGIKLSNAAFWDRVRENYGNDLGFLLEDVEYDESNATQFTARY--KIPRRPSEIMSNTSSPDDSLYESLEESP-VSDNVIDYSLCNGHNLKSE--NFDKKPPS-----IPEEEIKFDLSFRNSTQXXXXXXXXXXXXXXXXXXXSSRPAAICSDHEHLPNMLLD------------------------EEFSINVHTLWTFIFTDNAFFRALCAMRFITEITQSNWSDDVDREKCRTIYYTVNLKNRIGPKKSPTVEKQVLLEGSCKDYIYYVESIVRTVGIPMSDSFHIVLRYCLLYINPNKSRIKISMKIVYDKTVFFATKSIIDSSVKSGCIDYHKDLKQALLIESQKINDVLTEQ 1620
            TYKQR  DF+K FK    ++  LI DYSCA+      IL QGR+Y++  ++CFYS    +E  +TV  KD+  +TKEKTA +  NAIQ+ TD NEKHFF+SF  RDR Y ++ +LW  +     L     W  V + YGN+LG   +D +Y   +    T  Y  +IP   +E   N +   D+    ++ SP +   V   S  N  +      NFD  P       IPE+ +   L     ++                 + +  P+   +D+E LP  L D                        E +  +V  L   +FT++ F R     R  +++    W  +    + R I YT++L N + PK +   E Q L + S     Y +++ V    +P  D F+ + RY L  +  NK R+++S ++ Y K  +   K  I+ +  SG  +Y + L+    +E  K+  VL+EQ
Sbjct:   79 TYKQRNEDFRKLFKQL-PDTERLIVDYSCALQRD---ILLQGRLYLSENWICFYSNIFRWETLLTVRLKDVCSMTKEKTARLIPNAIQLCTD-NEKHFFTSFGARDRTYMMMFRLWQNALLDKPLCPKELWHFVHQCYGNELGLTSDDEDYVPPDDDFNTMGYCEEIPAEDNEANDNCNKTPDA---KMDISPQLHRKVFPNSSLNSTDSTDAPLNFDVPPVEDFTNCIPEDLLPLTLPDNKLSE-----------TGGSAHVPAPSPSLDFNDNEDLPTELSDSSETHDEGEVQAFQEDLNGKLYINEVYKFSVDKLHDILFTESQFMREFLEQRRFSDVVYHPWRKEDTGNQTREIMYTISLSNPLAPKTATVTETQTLHKASQVSECYIIDAEVIAHDVPYHDYFYTLNRYMLTRVARNKCRLRVSAELRYRKQPWGLVKGFIERNFWSGLDEYFRYLE----LELNKVQLVLSEQ 534          
BLAST of VASt domain-containing protein vs. Ensembl Zebrafish
Match: AL953903.4 (GRAM domain containing 1Ba [Source:NCBI gene;Acc:568698])

HSP 1 Score: 181.8 bits (460), Expect = 7.836e-48
Identity = 142/479 (29.65%), Postives = 220/479 (45.93%), Query Frame = 1
Query:  286 TYKQRRSDFKKSFKDTNAESSPLISDYSCAIYAGTPKILQQGRMYITTEFLCFYSRFITFEQKITVSYKDIKELTKEKTAMVFQNAIQIVTDNNEKHFFSSFTTRDRAYYVIHKLWMESKDGIKLSNAAFWDRVRENYGNDLGFLLEDVEYDESNATQFTARY--KIPRRPSEIMSNTSSPDDSLYESLEESP-VSDNVIDYSLCNGHNLKSE--NFDKKPPS-----IPEEEIKFDLSFRNSTQXXXXXXXXXXXXXXXXXXXSSRPAAICSDHEHLPNMLLD------------------------EEFSINVHTLWTFIFTDNAFFRALCAMRFITEITQSNWSDDVDREKCRTIYYTVNLKNRIGPKKSPTVEKQVLLEGSCKDYIYYVESIVRTVGIPMSDSFHIVLRYCLLYINPNKSRIKISMKIVYDKTVFFATKSIIDSSVKSGCIDYHKDLKQALLIESQKINDVLTEQ 1620
            TYKQR  DF+K FK    ++  LI DYSCA+      IL QGR+Y++  ++CFYS    +E  +TV  KD+  +TKEKTA +  NAIQ+ TD NEKHFF+SF  RDR Y ++ +LW  +     L     W  V + YGN+LG   +D +Y   +    T  Y  +IP   +E   N +   D+    ++ SP +   V   S  N  +      NFD  P       IPE+ +   L     ++                 + +  P+   +D+E LP  L D                        E +  +V  L   +FT++ F R     R  +++    W  +    + R I YT++L N + PK +   E Q L + S     Y +++ V    +P  D F+ + RY L  +  NK R+++S ++ Y K  +   K  I+ +  SG  +Y + L+    +E  K+  VL+EQ
Sbjct:  111 TYKQRNEDFRKLFKQL-PDTERLIVDYSCALQRD---ILLQGRLYLSENWICFYSNIFRWETLLTVRLKDVCSMTKEKTARLIPNAIQLCTD-NEKHFFTSFGARDRTYMMMFRLWQNALLDKPLCPKELWHFVHQCYGNELGLTSDDEDYVPPDDDFNTMGYCEEIPAEDNEANDNCNKTPDA---KMDISPQLHRKVFPNSSLNSTDSTDAPLNFDVPPVEDFTNCIPEDLLPLTLPDNKLSE-----------TGGSAHVPAPSPSLDFNDNEDLPTELSDSSETHDEGEVQAFQEDLNGKLYINEVYKFSVDKLHDILFTESQFMREFLEQRRFSDVVYHPWRKEDTGNQTREIMYTISLSNPLAPKTATVTETQTLHKASQVSECYIIDAEVIAHDVPYHDYFYTLNRYMLTRVARNKCRLRVSAELRYRKQPWGLVKGFIERNFWSGLDEYFRYLE----LELNKVQLVLSEQ 566          
BLAST of VASt domain-containing protein vs. Ensembl Zebrafish
Match: gramd1ba (GRAM domain containing 1Ba [Source:ZFIN;Acc:ZDB-GENE-091118-87])

HSP 1 Score: 181.03 bits (458), Expect = 9.729e-48
Identity = 142/480 (29.58%), Postives = 220/480 (45.83%), Query Frame = 1
Query:  286 TYKQRRSDFKKSFKDTNAESSPLISDYSCAIYAGTPKILQQGRMYITTEFLCFYSRFITFEQKITVSYKDIKELTKEKTAMVFQNAIQIVTDNNEKHFFSSFTTRDRAYYVIHKLWMESKDGIKLSNAAFWDRVRENYGNDLGFLLEDVEYDESNATQFTARY--KIPRRPSEIMSNTSSPDDSLYESLEESP-VSDNVIDYSLCNGHNLKSE--NFDKKPPS-----IPEEEIKFDLSFRNSTQXXXXXXXXXXXXXXXXXXXSSRPAAICSDHEHLPNMLLD-------------------------EEFSINVHTLWTFIFTDNAFFRALCAMRFITEITQSNWSDDVDREKCRTIYYTVNLKNRIGPKKSPTVEKQVLLEGSCKDYIYYVESIVRTVGIPMSDSFHIVLRYCLLYINPNKSRIKISMKIVYDKTVFFATKSIIDSSVKSGCIDYHKDLKQALLIESQKINDVLTEQ 1620
            TYKQR  DF+K FK    ++  LI DYSCA+      IL QGR+Y++  ++CFYS    +E  +TV  KD+  +TKEKTA +  NAIQ+ TD NEKHFF+SF  RDR Y ++ +LW  +     L     W  V + YGN+LG   +D +Y   +    T  Y  +IP   +E   N +   D+    ++ SP +   V   S  N  +      NFD  P       IPE+ +   L     ++                 + +  P+   +D+E LP  L D                         E +  +V  L   +FT++ F R     R  +++    W  +    + R I YT++L N + PK +   E Q L + S     Y +++ V    +P  D F+ + RY L  +  NK R+++S ++ Y K  +   K  I+ +  SG  +Y + L+    +E  K+  VL+EQ
Sbjct:   88 TYKQRNEDFRKLFKQL-PDTERLIVDYSCALQRD---ILLQGRLYLSENWICFYSNIFRWETLLTVRLKDVCSMTKEKTARLIPNAIQLCTD-NEKHFFTSFGARDRTYMMMFRLWQNALLDKPLCPKELWHFVHQCYGNELGLTSDDEDYVPPDDDFNTMGYCEEIPAEDNEANDNCNKTPDA---KMDISPQLHRKVFPNSSLNSTDSTDAPLNFDVPPVEDFTNCIPEDLLPLTLPDNKLSE-----------TGGSAHVPAPSPSLDFNDNEDLPTELSDSSETHDEAGEVQAFQEDLNGKLYINEVYKFSVDKLHDILFTESQFMREFLEQRRFSDVVYHPWRKEDTGNQTREIMYTISLSNPLAPKTATVTETQTLHKASQVSECYIIDAEVIAHDVPYHDYFYTLNRYMLTRVARNKCRLRVSAELRYRKQPWGLVKGFIERNFWSGLDEYFRYLE----LELNKVQLVLSEQ 544          
BLAST of VASt domain-containing protein vs. Ensembl Zebrafish
Match: gramd1ba (GRAM domain containing 1Ba [Source:ZFIN;Acc:ZDB-GENE-091118-87])

HSP 1 Score: 181.03 bits (458), Expect = 1.010e-47
Identity = 142/480 (29.58%), Postives = 220/480 (45.83%), Query Frame = 1
Query:  286 TYKQRRSDFKKSFKDTNAESSPLISDYSCAIYAGTPKILQQGRMYITTEFLCFYSRFITFEQKITVSYKDIKELTKEKTAMVFQNAIQIVTDNNEKHFFSSFTTRDRAYYVIHKLWMESKDGIKLSNAAFWDRVRENYGNDLGFLLEDVEYDESNATQFTARY--KIPRRPSEIMSNTSSPDDSLYESLEESP-VSDNVIDYSLCNGHNLKSE--NFDKKPPS-----IPEEEIKFDLSFRNSTQXXXXXXXXXXXXXXXXXXXSSRPAAICSDHEHLPNMLLD-------------------------EEFSINVHTLWTFIFTDNAFFRALCAMRFITEITQSNWSDDVDREKCRTIYYTVNLKNRIGPKKSPTVEKQVLLEGSCKDYIYYVESIVRTVGIPMSDSFHIVLRYCLLYINPNKSRIKISMKIVYDKTVFFATKSIIDSSVKSGCIDYHKDLKQALLIESQKINDVLTEQ 1620
            TYKQR  DF+K FK    ++  LI DYSCA+      IL QGR+Y++  ++CFYS    +E  +TV  KD+  +TKEKTA +  NAIQ+ TD NEKHFF+SF  RDR Y ++ +LW  +     L     W  V + YGN+LG   +D +Y   +    T  Y  +IP   +E   N +   D+    ++ SP +   V   S  N  +      NFD  P       IPE+ +   L     ++                 + +  P+   +D+E LP  L D                         E +  +V  L   +FT++ F R     R  +++    W  +    + R I YT++L N + PK +   E Q L + S     Y +++ V    +P  D F+ + RY L  +  NK R+++S ++ Y K  +   K  I+ +  SG  +Y + L+    +E  K+  VL+EQ
Sbjct:   92 TYKQRNEDFRKLFKQL-PDTERLIVDYSCALQRD---ILLQGRLYLSENWICFYSNIFRWETLLTVRLKDVCSMTKEKTARLIPNAIQLCTD-NEKHFFTSFGARDRTYMMMFRLWQNALLDKPLCPKELWHFVHQCYGNELGLTSDDEDYVPPDDDFNTMGYCEEIPAEDNEANDNCNKTPDA---KMDISPQLHRKVFPNSSLNSTDSTDAPLNFDVPPVEDFTNCIPEDLLPLTLPDNKLSE-----------TGGSAHVPAPSPSLDFNDNEDLPTELSDSSETHDEAGEVQAFQEDLNGKLYINEVYKFSVDKLHDILFTESQFMREFLEQRRFSDVVYHPWRKEDTGNQTREIMYTISLSNPLAPKTATVTETQTLHKASQVSECYIIDAEVIAHDVPYHDYFYTLNRYMLTRVARNKCRLRVSAELRYRKQPWGLVKGFIERNFWSGLDEYFRYLE----LELNKVQLVLSEQ 548          
BLAST of VASt domain-containing protein vs. Ensembl Zebrafish
Match: gramd1ba (GRAM domain containing 1Ba [Source:ZFIN;Acc:ZDB-GENE-091118-87])

HSP 1 Score: 181.03 bits (458), Expect = 1.076e-47
Identity = 142/480 (29.58%), Postives = 220/480 (45.83%), Query Frame = 1
Query:  286 TYKQRRSDFKKSFKDTNAESSPLISDYSCAIYAGTPKILQQGRMYITTEFLCFYSRFITFEQKITVSYKDIKELTKEKTAMVFQNAIQIVTDNNEKHFFSSFTTRDRAYYVIHKLWMESKDGIKLSNAAFWDRVRENYGNDLGFLLEDVEYDESNATQFTARY--KIPRRPSEIMSNTSSPDDSLYESLEESP-VSDNVIDYSLCNGHNLKSE--NFDKKPPS-----IPEEEIKFDLSFRNSTQXXXXXXXXXXXXXXXXXXXSSRPAAICSDHEHLPNMLLD-------------------------EEFSINVHTLWTFIFTDNAFFRALCAMRFITEITQSNWSDDVDREKCRTIYYTVNLKNRIGPKKSPTVEKQVLLEGSCKDYIYYVESIVRTVGIPMSDSFHIVLRYCLLYINPNKSRIKISMKIVYDKTVFFATKSIIDSSVKSGCIDYHKDLKQALLIESQKINDVLTEQ 1620
            TYKQR  DF+K FK    ++  LI DYSCA+      IL QGR+Y++  ++CFYS    +E  +TV  KD+  +TKEKTA +  NAIQ+ TD NEKHFF+SF  RDR Y ++ +LW  +     L     W  V + YGN+LG   +D +Y   +    T  Y  +IP   +E   N +   D+    ++ SP +   V   S  N  +      NFD  P       IPE+ +   L     ++                 + +  P+   +D+E LP  L D                         E +  +V  L   +FT++ F R     R  +++    W  +    + R I YT++L N + PK +   E Q L + S     Y +++ V    +P  D F+ + RY L  +  NK R+++S ++ Y K  +   K  I+ +  SG  +Y + L+    +E  K+  VL+EQ
Sbjct:  101 TYKQRNEDFRKLFKQL-PDTERLIVDYSCALQRD---ILLQGRLYLSENWICFYSNIFRWETLLTVRLKDVCSMTKEKTARLIPNAIQLCTD-NEKHFFTSFGARDRTYMMMFRLWQNALLDKPLCPKELWHFVHQCYGNELGLTSDDEDYVPPDDDFNTMGYCEEIPAEDNEANDNCNKTPDA---KMDISPQLHRKVFPNSSLNSTDSTDAPLNFDVPPVEDFTNCIPEDLLPLTLPDNKLSE-----------TGGSAHVPAPSPSLDFNDNEDLPTELSDSSETHDEAGEVQAFQEDLNGKLYINEVYKFSVDKLHDILFTESQFMREFLEQRRFSDVVYHPWRKEDTGNQTREIMYTISLSNPLAPKTATVTETQTLHKASQVSECYIIDAEVIAHDVPYHDYFYTLNRYMLTRVARNKCRLRVSAELRYRKQPWGLVKGFIERNFWSGLDEYFRYLE----LELNKVQLVLSEQ 557          
BLAST of VASt domain-containing protein vs. Ensembl Xenopus
Match: gramd1c (GRAM domain containing 1C [Source:NCBI gene;Acc:100491022])

HSP 1 Score: 180.644 bits (457), Expect = 7.134e-48
Identity = 133/466 (28.54%), Postives = 226/466 (48.50%), Query Frame = 1
Query:  286 TYKQRRSDFKKSFKDTNAESSPLISDYSCAIYAGTPKILQQGRMYITTEFLCFYSRFITFEQKITVSYKDIKELTKEKTAMVFQNAIQIVTDNNEKHFFSSFTTRDRAYYVIHKLWMESKDGIKLSNAAFWDRVRENYGNDLGFLLEDVEY-----DESNATQFTARY----------KIPRRPSEIMSNTSSPDDSLYES----LEESPVSDNVIDYSLCNGHNLKSENFDKKP---PSIPEEEIKFDLSFRNSTQXXXXXXXXXXXXXXXXXXXSSRPAAICSDHEHLPNMLLDEEFSINVHTLWTFIFTDNAFFRALCAMRFITEITQSNWSDDVDREKCRTIYYTVNLKNRIGPKKSPTVEKQVLLEGSCKDYIYYVESIVRTVGIPMSDSFHIVLRYCLLYINPNKSRIKISMKIVYDKTVFFATKSIIDSSVKSGCIDYHKDLKQALLIESQKINDVLTE 1617
            TYKQR  +F+K FK+   ES  LI DY+CA+     +IL QGR+Y++   LCF+S    +E  I +  +DI  +TKEKTA +  NAIQ+ T+ NEK FF+SF TRDR++  I ++W        L+   FW  V+++YG DLG   E++E+     +++  T+   R           K+PR  S  +S  +  D  L       L +S V ++  + +      L +   D+KP    +I    +  DL+   +  +  S+  +  +    +                   + ++  + I+   ++  +FT + FF      R + ++  + W  D + ++ RT+ YT+ + N +  K +   EKQVL +G+     Y VE+ V T  +P  D F+ V +Y ++    +K R+++   + Y K  +   K+ I+ +  SG  DY K ++  L+IE      VL E
Sbjct:   29 TYKQRSEEFRKIFKEL-PESEKLIVDYACALQK---EILLQGRIYLSESCLCFHSNIFRWETTICLQLRDITSMTKEKTARLIPNAIQVSTE-NEKLFFTSFATRDRSFLNIFRMWQNVLLDKTLTKKEFWQLVQQSYGTDLGLNNEEMEHMSVPVEDNGQTRLLGRAVSEDCGEKPEKMPRGAS--VSQGTETDSPLLSPMQLILRQSHVEESQGEKAGGKSPQLGA---DRKPSLRATIGTPALALDLNGNENQNLDRSSFSDTGDEEDTKYPEEGIDG----------RLYINRVYQISAERMFQLLFTQSHFFVNFLGSRKVFDLECTPWQSDGNGKQTRTLTYTITINNPLVGKFTTATEKQVLYKGNQGGLSYSVEAEVLTHDVPYHDYFYTVNKYSIVRTAQDKCRLRVCTDVRYKKQPWGLVKTFIERNSWSGLEDYFKQMESDLMIEENASGSVLAE 474          
BLAST of VASt domain-containing protein vs. Ensembl Xenopus
Match: gramd1c (GRAM domain containing 1C [Source:NCBI gene;Acc:100491022])

HSP 1 Score: 180.644 bits (457), Expect = 7.627e-48
Identity = 138/469 (29.42%), Postives = 231/469 (49.25%), Query Frame = 1
Query:  286 TYKQRRSDFKKSFKDTNAESSPLISDYSCAIYAGTPKILQQGRMYITTEFLCFYSRFITFEQKITVSYKDIKELTKEKTAMVFQNAIQIVTDNNEKHFFSSFTTRDRAYYVIHKLWMESKDGIKLSNAAFWDRVRENYGNDLGFLLEDVEY-----DESNATQFTARY----------KIPRRPSEIMSNTSSPDDSLYES----LEESPVSDNVIDYSLCNGHNLKSENFDKKP---PSIPEEEIKFDLSF---RNSTQXXXXXXXXXXXXXXXXXXXSSRPAAICSDHEHLPNMLLDEEFSINVHTLWTFIFTDNAFFRALCAMRFITEITQSNWSDDVDREKCRTIYYTVNLKNRIGPKKSPTVEKQVLLEGSCKDYIYYVESIVRTVGIPMSDSFHIVLRYCLLYINPNKSRIKISMKIVYDKTVFFATKSIIDSSVKSGCIDYHKDLKQALLIESQKINDVLTE 1617
            TYKQR  +F+K FK+   ES  LI DY+CA+     +IL QGR+Y++   LCF+S    +E  I +  +DI  +TKEKTA +  NAIQ+ T+ NEK FF+SF TRDR++  I ++W        L+   FW  V+++YG DLG   E++E+     +++  T+   R           K+PR  S  +S  +  D  L       L +S V ++  + +      L +   D+KP    +I    +  DL+    +N  +   S+  +E +    E+ I  R             + ++  + I+   ++  +FT + FF      R + ++  + W  D + ++ RT+ YT+ + N +  K +   EKQVL +G+     Y VE+ V T  +P  D F+ V +Y ++    +K R+++   + Y K  +   K+ I+ +  SG  DY K ++  L+IE      VL E
Sbjct:   43 TYKQRSEEFRKIFKEL-PESEKLIVDYACALQK---EILLQGRIYLSESCLCFHSNIFRWETTICLQLRDITSMTKEKTARLIPNAIQVSTE-NEKLFFTSFATRDRSFLNIFRMWQNVLLDKTLTKKEFWQLVQQSYGTDLGLNNEEMEHMSVPVEDNGQTRLLGRAVSEDCGEKPEKMPRGAS--VSQGTETDSPLLSPMQLILRQSHVEESQGEKAGGKSPQLGA---DRKPSLRATIGTPALALDLNGNENQNLDRSSFSDTGDEEDTKYPEEGIDGR-------------LYINRVYQISAERMFQLLFTQSHFFVNFLGSRKVFDLECTPWQSDGNGKQTRTLTYTITINNPLVGKFTTATEKQVLYKGNQGGLSYSVEAEVLTHDVPYHDYFYTVNKYSIVRTAQDKCRLRVCTDVRYKKQPWGLVKTFIERNSWSGLEDYFKQMESDLMIEENASGSVLAE 488          
BLAST of VASt domain-containing protein vs. Ensembl Xenopus
Match: nfxl1 (nuclear transcription factor, X-box binding like 1 [Source:Xenbase;Acc:XB-GENE-964724])

HSP 1 Score: 148.288 bits (373), Expect = 3.991e-37
Identity = 112/424 (26.42%), Postives = 191/424 (45.05%), Query Frame = 1
Query:  286 TYKQRRSDFKKSFKDTNAESSPLISDYSCAIYAGTPKILQQGRMYITTEFLCFYSRFITFEQKITVSYKDIKELTKEKTAMVFQNAIQIVTDNNEKHFFSSFTTRDRAYYVIHKLWMESKDGIKLSNAAFWDRVRENYGNDLGFLLEDVEY----DESNATQFTARYKIPRRPSEIMSNTSSPDDSLYESLEESPVSDNVIDYSLCNGHNLKSENFDKKPP-SIPEEEIKFDLSFRNSTQXXXXXXXXXXXXXXXXXXXSSRPAAICSDHEHLPNMLLDEEFSINVHTLWTFIFTDNAFFRALCAMRFITEITQSNWSDDVDREKCRTIYYTVNLKNRIGPKKSPTVEKQVLLEGSCKDYIYYVESIVRTVGIPMSDSFHIVLRYCLLYINPNKSRIKISMKIVYDKTVFFATKSIIDSSVKSG 1542
            TYKQR  +F+K FK    +S  LI DYSCA+      IL QGR+Y++  ++CFYS    +E  ++ +++    L                   +  HFF+SF  RDR++ +I +LW  +     LS    W  V + YG +LG   ED +Y    D  N    +  +      S  +S+TSS  D+   +  + P +D+    SL +  ++      + P  ++P++    DL+ R                                       + ++  + I+   L   + TD  F       R  T+IT + W  D + ++ R + YT+ + N +GPK +P +E Q+L   S K  +  +++ V T GIP  D F+   RYC+  +  NK+R+++S +I Y K  +   ++II+ +  +G
Sbjct:   49 TYKQRNENFRKIFKKL-PDSERLIVDYSCALQK---DILLQGRLYLSENWICFYSNIFRWETTVSPTHRVANSLGP-----------------HPDHFFTSFGARDRSFLLIFRLWQNALLDKTLSPRELWHIVHQCYGTELGLTSEDEDYVSPRDLLNGLGGSEDFP----ESTDLSDTSSRGDTKLSASPQLPATDSFT--SLASADSMIPVRHPRAPNCTVPKDTPSSDLTGR---------------------------------------LHINAVYHISAEHLQHALTTDTQFMNDFMEQRKFTDITVNPWMRDGNGKQSRILNYTIPINNPLGPKSAPAIETQIL--HSVKGSVCVLDTQVITQGIPYQDYFYTSHRYCISSVGKNKARLRVSSEICYRKQPWSLVRAIIEKNSWNG 404          
BLAST of VASt domain-containing protein vs. Ensembl Xenopus
Match: gramd1c (GRAM domain containing 1C [Source:NCBI gene;Acc:100491022])

HSP 1 Score: 147.902 bits (372), Expect = 9.042e-37
Identity = 126/469 (26.87%), Postives = 215/469 (45.84%), Query Frame = 1
Query:  286 TYKQRRSDFKKSFKDTNAESSPLISDYSCAIYAGTPKILQQGRMYITTEFLCFYSRFITFEQKITVSYKDIKELTKEKTAMVFQNAIQIVTDNNEKHFFSSFTTRDRAYYVIHKLWMESKDGIKLSNAAFWDRVRENYGNDLGFLLEDVEY-----DESNATQFTARY----------KIPRRPSEIMSNTSSPDDSLYES----LEESPVSDNVIDYSLCNGHNLKSENFDKKP---PSIPEEEIKFDLSF---RNSTQXXXXXXXXXXXXXXXXXXXSSRPAAICSDHEHLPNMLLDEEFSINVHTLWTFIFTDNAFFRALCAMRFITEITQSNWSDDVDREKCRTIYYTVNLKNRIGPKKSPTVEKQVLLEGSCKDYIYYVESIVRTVGIPMSDSFHIVLRYCLLYINPNKSRIKISMKIVYDKTVFFATKSIIDSSVKSGCIDYHKDLKQALLIESQKINDVLTE 1617
            TYKQR  +F+K FK+   ES  LI DY+CA+     +IL QGR+Y++   LCF+S    +E  I +  +DI  +TKEKTA +  NAIQ+ T+N +                             L+   FW  V+++YG DLG   E++E+     +++  T+   R           K+PR  S  +S  +  D  L       L +S V ++  + +      L +   D+KP    +I    +  DL+    +N  +   S+  +E +    E+ I  R             + ++  + I+   ++  +FT + FF      R + ++  + W  D + ++ RT+ YT+ + N +  K +   EKQVL +G+     Y VE+ V T  +P  D F+ V +Y ++    +K R+++   + Y K  +   K+ I+ +  SG  DY K ++  L+IE      VL E
Sbjct:   43 TYKQRSEEFRKIFKEL-PESEKLIVDYACALQK---EILLQGRIYLSESCLCFHSNIFRWETTICLQLRDITSMTKEKTARLIPNAIQVSTENEKT----------------------------LTKKEFWQLVQQSYGTDLGLNNEEMEHMSVPVEDNGQTRLLGRAVSEDCGEKPEKMPRGAS--VSQGTETDSPLLSPMQLILRQSHVEESQGEKAGGKSPQLGA---DRKPSLRATIGTPALALDLNGNENQNLDRSSFSDTGDEEDTKYPEEGIDGR-------------LYINRVYQISAERMFQLLFTQSHFFVNFLGSRKVFDLECTPWQSDGNGKQTRTLTYTITINNPLVGKFTTATEKQVLYKGNQGGLSYSVEAEVLTHDVPYHDYFYTVNKYSIVRTAQDKCRLRVCTDVRYKKQPWGLVKTFIERNSWSGLEDYFKQMESDLMIEENASGSVLAE 461          
BLAST of VASt domain-containing protein vs. Ensembl Xenopus
Match: nfxl1 (nuclear transcription factor, X-box binding like 1 [Source:Xenbase;Acc:XB-GENE-964724])

HSP 1 Score: 141.354 bits (355), Expect = 1.079e-34
Identity = 116/421 (27.55%), Postives = 188/421 (44.66%), Query Frame = 1
Query:  286 TYKQRRSDFKKSFKDTNAESSPLISDYSCAIYAGTPKILQQGRMYITTEFLCFYSRFITFEQKITVSYKDIKELTKEKTAMVFQNAIQIVTDNNEKHFFSSFTTRDRAYYVIHKLWMESKDGIKLSNAAFWDRVRENYGNDLGFLLEDVEYDESNATQFTARYKIPRRPSEIMSNTSSPDDSLYESLEESPVSDNVIDYSLCNGHNLKSENFDKKPP--SIPEEEIKFDLSFRNSTQXXXXXXXXXXXXXXXXXXXSSRPAAICSDHEHLPNMLLDEEFSINVHTLWTFIFTDNAFFRALCAMRFITEITQSNWSDDVDREKCRTIYYTVNLKNRIGPKKSPTVEKQVLLEGSCKDYIYYVESIVRTVGIPMSDSFHIVLRYCLLYINPNKSRIKISMKIVYDKTVFFATKSIIDSSVKSG 1542
            TYKQR  +F+K FK    +S  LI DYSCA+      IL QGR+Y++  ++CFYS    +E  ++ +              +  N++    D    HFF+SF  RDR++ +I +LW  +     LS    W  V + YG +LG   ED +Y                 P +++++  S      +S  E   S  V   S   G  L     D  P    +P EE+  D S  NST     +  E  +           P++  +   H     ++  + I+   L   + TD  F       R  T+IT + W  D + ++ R + YT+ + N +GPK +P +E QV         +  +++ V T GIP  D F+   RYC+  +  NK+R+++S +I Y K  +   ++II+ +  +G
Sbjct:   49 TYKQRNENFRKIFKKL-PDSERLIVDYSCALQK---DILLQGRLYLSENWICFYSNIFRWETTVSPT-----------VCPLVANSLGPHPD----HFFTSFGARDRSFLLIFRLWQNALLDKTLSPRELWHIVHQCYGTELGLTSEDEDYVS---------------PRDLLNDAQS------DSQLEGSSSQTVTPLSEMAGSAL----LDSLPALDLLPSEELPTDPS-NNSTPSSTQDEGELPKDT---------PSSDLTGRLH-----INAVYHISAEHLQHALTTDTQFMNDFMEQRKFTDITVNPWMRDGNGKQSRILNYTIPINNPLGPKSAPAIETQVRQHNGS---VCVLDTQVITQGIPYQDYFYTSHRYCISSVGKNKARLRVSSEICYRKQPWSLVRAIIEKNSWNG 407          
BLAST of VASt domain-containing protein vs. Ensembl Mouse
Match: Gramd1b (GRAM domain containing 1B [Source:MGI Symbol;Acc:MGI:1925037])

HSP 1 Score: 188.734 bits (478), Expect = 1.939e-50
Identity = 143/460 (31.09%), Postives = 225/460 (48.91%), Query Frame = 1
Query:  286 TYKQRRSDFKKSFKDTNAESSPLISDYSCAIYAGTPKILQQGRMYITTEFLCFYSRFITFEQKITVSYKDIKELTKEKTAMVFQNAIQIVTDNNEKHFFSSFTTRDRAYYVIHKLWMESKDGIKLSNAAFWDRVRENYGNDLGFLLEDVEYDESNATQFTARY--KIPRRPSEIMSNTSSPDDSLYESLEESP--VSDNVIDYSLCN-GHNLKSENFDKKPPSIPEEEIKFDLSFRNSTQXXXXXXXXXXXXXXXXXXXSSRPAAICSDHEHLPNMLLD------------------------EEFSINVHTLWTFIFTDNAFFRALCAMRFITEITQSNWSDDVDREKCRTIYYTVNLKNRIGPKKSPTVEKQVLLEGSCKDYIYYVESIVRTVGIPMSDSFHIVLRYCLLYINPNKSRIKISMKIVYDKTVFFATKSIIDSSVKSGCIDYHKDLKQAL 1578
            TYKQR  DF+K FK    ++  LI DYSCA+      IL QGR+Y++  ++CFYS    +E  +TV  KDI  +TKEKTA +  NAIQ+ TD +EKHFF+SF  RDR Y ++ +LW  +     L     W  V + YGN+LG   +D +Y   +    T  Y  +IP   +E+  N SS   S+    + SP     ++ + +L + G +    +FD  P  + EE ++ D S      I      +   + PV     + P+   +D+E +P  L D                        E F+ +V  L+  +FT++ F R     R  ++I    W  + +  + R I YT+ L N + PK +   E Q + + S +   Y +++ V T  +P  D F+ + RY L  +  NKSR+++S ++ Y K  +   K+ I+ +  SG  DY + L+  L
Sbjct:   50 TYKQRNEDFRKLFKQL-PDTERLIVDYSCALQR---DILLQGRLYLSENWICFYSNIFRWETLLTVRLKDICSMTKEKTARLIPNAIQVCTD-SEKHFFTSFGARDRTYMMMFRLWQNALLEKPLCPKELWHFVHQCYGNELGLTSDDEDYVPPDDDFNTMGYCEEIPIEENEV--NDSSSKSSIETKPDASPQLPKKSITNSTLTSTGSSEAPVSFDGLP--LEEEVMEGDGSLEKELAIDNIIGEKIEIMAPV-----TSPSLDFNDNEDIPTELSDSSDTHDEGEVQAFYEDLSGRQYVNEVFNFSVDKLYDLLFTNSPFLRDFMEQRRFSDIIFHPWKKEENGNQSRVILYTITLTNPLAPKTATVRETQTMYKASQESECYVIDAEVLTHDVPYHDYFYTINRYTLTRVARNKSRLRVSTELRYRKQPWGFVKTFIEKNFWSGLEDYFRHLETEL 495          
BLAST of VASt domain-containing protein vs. Ensembl Mouse
Match: Gramd1b (GRAM domain containing 1B [Source:MGI Symbol;Acc:MGI:1925037])

HSP 1 Score: 188.734 bits (478), Expect = 2.975e-50
Identity = 143/460 (31.09%), Postives = 225/460 (48.91%), Query Frame = 1
Query:  286 TYKQRRSDFKKSFKDTNAESSPLISDYSCAIYAGTPKILQQGRMYITTEFLCFYSRFITFEQKITVSYKDIKELTKEKTAMVFQNAIQIVTDNNEKHFFSSFTTRDRAYYVIHKLWMESKDGIKLSNAAFWDRVRENYGNDLGFLLEDVEYDESNATQFTARY--KIPRRPSEIMSNTSSPDDSLYESLEESP--VSDNVIDYSLCN-GHNLKSENFDKKPPSIPEEEIKFDLSFRNSTQXXXXXXXXXXXXXXXXXXXSSRPAAICSDHEHLPNMLLD------------------------EEFSINVHTLWTFIFTDNAFFRALCAMRFITEITQSNWSDDVDREKCRTIYYTVNLKNRIGPKKSPTVEKQVLLEGSCKDYIYYVESIVRTVGIPMSDSFHIVLRYCLLYINPNKSRIKISMKIVYDKTVFFATKSIIDSSVKSGCIDYHKDLKQAL 1578
            TYKQR  DF+K FK    ++  LI DYSCA+      IL QGR+Y++  ++CFYS    +E  +TV  KDI  +TKEKTA +  NAIQ+ TD +EKHFF+SF  RDR Y ++ +LW  +     L     W  V + YGN+LG   +D +Y   +    T  Y  +IP   +E+  N SS   S+    + SP     ++ + +L + G +    +FD  P  + EE ++ D S      I      +   + PV     + P+   +D+E +P  L D                        E F+ +V  L+  +FT++ F R     R  ++I    W  + +  + R I YT+ L N + PK +   E Q + + S +   Y +++ V T  +P  D F+ + RY L  +  NKSR+++S ++ Y K  +   K+ I+ +  SG  DY + L+  L
Sbjct:   86 TYKQRNEDFRKLFKQL-PDTERLIVDYSCALQR---DILLQGRLYLSENWICFYSNIFRWETLLTVRLKDICSMTKEKTARLIPNAIQVCTD-SEKHFFTSFGARDRTYMMMFRLWQNALLEKPLCPKELWHFVHQCYGNELGLTSDDEDYVPPDDDFNTMGYCEEIPIEENEV--NDSSSKSSIETKPDASPQLPKKSITNSTLTSTGSSEAPVSFDGLP--LEEEVMEGDGSLEKELAIDNIIGEKIEIMAPV-----TSPSLDFNDNEDIPTELSDSSDTHDEGEVQAFYEDLSGRQYVNEVFNFSVDKLYDLLFTNSPFLRDFMEQRRFSDIIFHPWKKEENGNQSRVILYTITLTNPLAPKTATVRETQTMYKASQESECYVIDAEVLTHDVPYHDYFYTINRYTLTRVARNKSRLRVSTELRYRKQPWGFVKTFIEKNFWSGLEDYFRHLETEL 531          
BLAST of VASt domain-containing protein vs. Ensembl Mouse
Match: Gramd1b (GRAM domain containing 1B [Source:MGI Symbol;Acc:MGI:1925037])

HSP 1 Score: 187.963 bits (476), Expect = 4.670e-50
Identity = 143/460 (31.09%), Postives = 225/460 (48.91%), Query Frame = 1
Query:  286 TYKQRRSDFKKSFKDTNAESSPLISDYSCAIYAGTPKILQQGRMYITTEFLCFYSRFITFEQKITVSYKDIKELTKEKTAMVFQNAIQIVTDNNEKHFFSSFTTRDRAYYVIHKLWMESKDGIKLSNAAFWDRVRENYGNDLGFLLEDVEYDESNATQFTARY--KIPRRPSEIMSNTSSPDDSLYESLEESP--VSDNVIDYSLCN-GHNLKSENFDKKPPSIPEEEIKFDLSFRNSTQXXXXXXXXXXXXXXXXXXXSSRPAAICSDHEHLPNMLLD------------------------EEFSINVHTLWTFIFTDNAFFRALCAMRFITEITQSNWSDDVDREKCRTIYYTVNLKNRIGPKKSPTVEKQVLLEGSCKDYIYYVESIVRTVGIPMSDSFHIVLRYCLLYINPNKSRIKISMKIVYDKTVFFATKSIIDSSVKSGCIDYHKDLKQAL 1578
            TYKQR  DF+K FK    ++  LI DYSCA+      IL QGR+Y++  ++CFYS    +E  +TV  KDI  +TKEKTA +  NAIQ+ TD +EKHFF+SF  RDR Y ++ +LW  +     L     W  V + YGN+LG   +D +Y   +    T  Y  +IP   +E+  N SS   S+    + SP     ++ + +L + G +    +FD  P  + EE ++ D S      I      +   + PV     + P+   +D+E +P  L D                        E F+ +V  L+  +FT++ F R     R  ++I    W  + +  + R I YT+ L N + PK +   E Q + + S +   Y +++ V T  +P  D F+ + RY L  +  NKSR+++S ++ Y K  +   K+ I+ +  SG  DY + L+  L
Sbjct:   90 TYKQRNEDFRKLFKQL-PDTERLIVDYSCALQR---DILLQGRLYLSENWICFYSNIFRWETLLTVRLKDICSMTKEKTARLIPNAIQVCTD-SEKHFFTSFGARDRTYMMMFRLWQNALLEKPLCPKELWHFVHQCYGNELGLTSDDEDYVPPDDDFNTMGYCEEIPIEENEV--NDSSSKSSIETKPDASPQLPKKSITNSTLTSTGSSEAPVSFDGLP--LEEEVMEGDGSLEKELAIDNIIGEKIEIMAPV-----TSPSLDFNDNEDIPTELSDSSDTHDEGEVQAFYEDLSGRQYVNEVFNFSVDKLYDLLFTNSPFLRDFMEQRRFSDIIFHPWKKEENGNQSRVILYTITLTNPLAPKTATVRETQTMYKASQESECYVIDAEVLTHDVPYHDYFYTINRYTLTRVARNKSRLRVSTELRYRKQPWGFVKTFIEKNFWSGLEDYFRHLETEL 535          
BLAST of VASt domain-containing protein vs. Ensembl Mouse
Match: Gramd1b (GRAM domain containing 1B [Source:MGI Symbol;Acc:MGI:1925037])

HSP 1 Score: 188.348 bits (477), Expect = 5.420e-50
Identity = 143/460 (31.09%), Postives = 225/460 (48.91%), Query Frame = 1
Query:  286 TYKQRRSDFKKSFKDTNAESSPLISDYSCAIYAGTPKILQQGRMYITTEFLCFYSRFITFEQKITVSYKDIKELTKEKTAMVFQNAIQIVTDNNEKHFFSSFTTRDRAYYVIHKLWMESKDGIKLSNAAFWDRVRENYGNDLGFLLEDVEYDESNATQFTARY--KIPRRPSEIMSNTSSPDDSLYESLEESP--VSDNVIDYSLCN-GHNLKSENFDKKPPSIPEEEIKFDLSFRNSTQXXXXXXXXXXXXXXXXXXXSSRPAAICSDHEHLPNMLLD------------------------EEFSINVHTLWTFIFTDNAFFRALCAMRFITEITQSNWSDDVDREKCRTIYYTVNLKNRIGPKKSPTVEKQVLLEGSCKDYIYYVESIVRTVGIPMSDSFHIVLRYCLLYINPNKSRIKISMKIVYDKTVFFATKSIIDSSVKSGCIDYHKDLKQAL 1578
            TYKQR  DF+K FK    ++  LI DYSCA+      IL QGR+Y++  ++CFYS    +E  +TV  KDI  +TKEKTA +  NAIQ+ TD +EKHFF+SF  RDR Y ++ +LW  +     L     W  V + YGN+LG   +D +Y   +    T  Y  +IP   +E+  N SS   S+    + SP     ++ + +L + G +    +FD  P  + EE ++ D S      I      +   + PV     + P+   +D+E +P  L D                        E F+ +V  L+  +FT++ F R     R  ++I    W  + +  + R I YT+ L N + PK +   E Q + + S +   Y +++ V T  +P  D F+ + RY L  +  NKSR+++S ++ Y K  +   K+ I+ +  SG  DY + L+  L
Sbjct:  119 TYKQRNEDFRKLFKQL-PDTERLIVDYSCALQRD---ILLQGRLYLSENWICFYSNIFRWETLLTVRLKDICSMTKEKTARLIPNAIQVCTD-SEKHFFTSFGARDRTYMMMFRLWQNALLEKPLCPKELWHFVHQCYGNELGLTSDDEDYVPPDDDFNTMGYCEEIPIEENEV--NDSSSKSSIETKPDASPQLPKKSITNSTLTSTGSSEAPVSFDGLP--LEEEVMEGDGSLEKELAIDNIIGEKIEIMAPV-----TSPSLDFNDNEDIPTELSDSSDTHDEGEVQAFYEDLSGRQYVNEVFNFSVDKLYDLLFTNSPFLRDFMEQRRFSDIIFHPWKKEENGNQSRVILYTITLTNPLAPKTATVRETQTMYKASQESECYVIDAEVLTHDVPYHDYFYTINRYTLTRVARNKSRLRVSTELRYRKQPWGFVKTFIEKNFWSGLEDYFRHLETEL 564          
BLAST of VASt domain-containing protein vs. Ensembl Mouse
Match: Gramd1b (GRAM domain containing 1B [Source:MGI Symbol;Acc:MGI:1925037])

HSP 1 Score: 187.963 bits (476), Expect = 6.089e-50
Identity = 143/460 (31.09%), Postives = 225/460 (48.91%), Query Frame = 1
Query:  286 TYKQRRSDFKKSFKDTNAESSPLISDYSCAIYAGTPKILQQGRMYITTEFLCFYSRFITFEQKITVSYKDIKELTKEKTAMVFQNAIQIVTDNNEKHFFSSFTTRDRAYYVIHKLWMESKDGIKLSNAAFWDRVRENYGNDLGFLLEDVEYDESNATQFTARY--KIPRRPSEIMSNTSSPDDSLYESLEESP--VSDNVIDYSLCN-GHNLKSENFDKKPPSIPEEEIKFDLSFRNSTQXXXXXXXXXXXXXXXXXXXSSRPAAICSDHEHLPNMLLD------------------------EEFSINVHTLWTFIFTDNAFFRALCAMRFITEITQSNWSDDVDREKCRTIYYTVNLKNRIGPKKSPTVEKQVLLEGSCKDYIYYVESIVRTVGIPMSDSFHIVLRYCLLYINPNKSRIKISMKIVYDKTVFFATKSIIDSSVKSGCIDYHKDLKQAL 1578
            TYKQR  DF+K FK    ++  LI DYSCA+      IL QGR+Y++  ++CFYS    +E  +TV  KDI  +TKEKTA +  NAIQ+ TD +EKHFF+SF  RDR Y ++ +LW  +     L     W  V + YGN+LG   +D +Y   +    T  Y  +IP   +E+  N SS   S+    + SP     ++ + +L + G +    +FD  P  + EE ++ D S      I      +   + PV     + P+   +D+E +P  L D                        E F+ +V  L+  +FT++ F R     R  ++I    W  + +  + R I YT+ L N + PK +   E Q + + S +   Y +++ V T  +P  D F+ + RY L  +  NKSR+++S ++ Y K  +   K+ I+ +  SG  DY + L+  L
Sbjct:  117 TYKQRNEDFRKLFKQL-PDTERLIVDYSCALQR---DILLQGRLYLSENWICFYSNIFRWETLLTVRLKDICSMTKEKTARLIPNAIQVCTD-SEKHFFTSFGARDRTYMMMFRLWQNALLEKPLCPKELWHFVHQCYGNELGLTSDDEDYVPPDDDFNTMGYCEEIPIEENEV--NDSSSKSSIETKPDASPQLPKKSITNSTLTSTGSSEAPVSFDGLP--LEEEVMEGDGSLEKELAIDNIIGEKIEIMAPV-----TSPSLDFNDNEDIPTELSDSSDTHDEGEVQAFYEDLSGRQYVNEVFNFSVDKLYDLLFTNSPFLRDFMEQRRFSDIIFHPWKKEENGNQSRVILYTITLTNPLAPKTATVRETQTMYKASQESECYVIDAEVLTHDVPYHDYFYTINRYTLTRVARNKSRLRVSTELRYRKQPWGFVKTFIEKNFWSGLEDYFRHLETEL 562          
BLAST of VASt domain-containing protein vs. UniProt/SwissProt
Match: sp|Q3KR37|ASTRB_HUMAN (Protein Aster-B OS=Homo sapiens OX=9606 GN=GRAMD1B PE=1 SV=1)

HSP 1 Score: 189.119 bits (479), Expect = 1.521e-49
Identity = 144/460 (31.30%), Postives = 225/460 (48.91%), Query Frame = 1
Query:  286 TYKQRRSDFKKSFKDTNAESSPLISDYSCAIYAGTPKILQQGRMYITTEFLCFYSRFITFEQKITVSYKDIKELTKEKTAMVFQNAIQIVTDNNEKHFFSSFTTRDRAYYVIHKLWMESKDGIKLSNAAFWDRVRENYGNDLGFLLEDVEYDESNATQFTARY--KIPRRPSEIMSNTSSPDDSLYESLEESP--VSDNVIDYSLCN-GHNLKSENFDKKPPSIPEEEIKFDLSFRNSTQXXXXXXXXXXXXXXXXXXXSSRPAAICSDHEHLPNMLLD------------------------EEFSINVHTLWTFIFTDNAFFRALCAMRFITEITQSNWSDDVDREKCRTIYYTVNLKNRIGPKKSPTVEKQVLLEGSCKDYIYYVESIVRTVGIPMSDSFHIVLRYCLLYINPNKSRIKISMKIVYDKTVFFATKSIIDSSVKSGCIDYHKDLKQAL 1578
            TYKQR  DF+K FK    ++  LI DYSCA+      IL QGR+Y++  ++CFYS    +E  +TV  KDI  +TKEKTA +  NAIQ+ TD +EKHFF+SF  RDR Y ++ +LW  +     L     W  V + YGN+LG   +D +Y   +    T  Y  +IP   +E+  N SS   S+    + SP     ++ + +L + G +    +FD  P  + EE ++ D S      I      +   I PV     + P+   +D+E +P  L D                        E F+ +V  L+  +FT++ F R     R  ++I    W  + +  + R I YT+ L N + PK +   E Q + + S +   Y +++ V T  +P  D F+ + RY L  +  NKSR+++S ++ Y K  +   K+ I+ +  SG  DY + L+  L
Sbjct:   90 TYKQRNEDFRKLFKQL-PDTERLIVDYSCALQR---DILLQGRLYLSENWICFYSNIFRWETLLTVRLKDICSMTKEKTARLIPNAIQVCTD-SEKHFFTSFGARDRTYMMMFRLWQNALLEKPLCPKELWHFVHQCYGNELGLTSDDEDYVPPDDDFNTMGYCEEIPVEENEV--NDSSSKSSIETKPDASPQLPKKSITNSTLTSTGSSEAPVSFDGLP--LEEEALEGDGSLEKELAIDNIMGEKIEMIAPV-----NSPSLDFNDNEDIPTELSDSSDTHDEGEVQAFYEDLSGRQYVNEVFNFSVDKLYDLLFTNSPFQRDFMEQRRFSDIIFHPWKKEENGNQSRVILYTITLTNPLAPKTATVRETQTMYKASQESECYVIDAEVLTHDVPYHDYFYTINRYTLTRVARNKSRLRVSTELRYRKQPWGLVKTFIEKNFWSGLEDYFRHLESEL 535          
BLAST of VASt domain-containing protein vs. UniProt/SwissProt
Match: sp|Q80TI0|ASTRB_MOUSE (Protein Aster-B OS=Mus musculus OX=10090 GN=Gramd1b PE=1 SV=2)

HSP 1 Score: 188.734 bits (478), Expect = 1.915e-49
Identity = 143/460 (31.09%), Postives = 225/460 (48.91%), Query Frame = 1
Query:  286 TYKQRRSDFKKSFKDTNAESSPLISDYSCAIYAGTPKILQQGRMYITTEFLCFYSRFITFEQKITVSYKDIKELTKEKTAMVFQNAIQIVTDNNEKHFFSSFTTRDRAYYVIHKLWMESKDGIKLSNAAFWDRVRENYGNDLGFLLEDVEYDESNATQFTARY--KIPRRPSEIMSNTSSPDDSLYESLEESP--VSDNVIDYSLCN-GHNLKSENFDKKPPSIPEEEIKFDLSFRNSTQXXXXXXXXXXXXXXXXXXXSSRPAAICSDHEHLPNMLLD------------------------EEFSINVHTLWTFIFTDNAFFRALCAMRFITEITQSNWSDDVDREKCRTIYYTVNLKNRIGPKKSPTVEKQVLLEGSCKDYIYYVESIVRTVGIPMSDSFHIVLRYCLLYINPNKSRIKISMKIVYDKTVFFATKSIIDSSVKSGCIDYHKDLKQAL 1578
            TYKQR  DF+K FK    ++  LI DYSCA+      IL QGR+Y++  ++CFYS    +E  +TV  KDI  +TKEKTA +  NAIQ+ TD +EKHFF+SF  RDR Y ++ +LW  +     L     W  V + YGN+LG   +D +Y   +    T  Y  +IP   +E+  N SS   S+    + SP     ++ + +L + G +    +FD  P  + EE ++ D S      I      +   + PV     + P+   +D+E +P  L D                        E F+ +V  L+  +FT++ F R     R  ++I    W  + +  + R I YT+ L N + PK +   E Q + + S +   Y +++ V T  +P  D F+ + RY L  +  NKSR+++S ++ Y K  +   K+ I+ +  SG  DY + L+  L
Sbjct:   90 TYKQRNEDFRKLFKQL-PDTERLIVDYSCALQR---DILLQGRLYLSENWICFYSNIFRWETLLTVRLKDICSMTKEKTARLIPNAIQVCTD-SEKHFFTSFGARDRTYMMMFRLWQNALLEKPLCPKELWHFVHQCYGNELGLTSDDEDYVPPDDDFNTMGYCEEIPIEENEV--NDSSSKSSIETKPDASPQLPKKSITNSTLTSTGSSEAPVSFDGLP--LEEEVMEGDGSLEKELAIDNIIGEKIEIMAPV-----TSPSLDFNDNEDIPTELSDSSDTHDEGEVQAFYEDLSGRQYVNEVFNFSVDKLYDLLFTNSPFLRDFMEQRRFSDIIFHPWKKEENGNQSRVILYTITLTNPLAPKTATVRETQTMYKASQESECYVIDAEVLTHDVPYHDYFYTINRYTLTRVARNKSRLRVSTELRYRKQPWGFVKTFIEKNFWSGLEDYFRHLETEL 535          
BLAST of VASt domain-containing protein vs. UniProt/SwissProt
Match: sp|Q8IYS0|ASTRC_HUMAN (Protein Aster-C OS=Homo sapiens OX=9606 GN=GRAMD1C PE=1 SV=2)

HSP 1 Score: 181.415 bits (459), Expect = 2.611e-47
Identity = 136/491 (27.70%), Postives = 241/491 (49.08%), Query Frame = 1
Query:  286 TYKQRRSDFKKSFKDTNAESSPLISDYSCAIYAGTPKILQQGRMYITTEFLCFYSRFITFEQKITVSYKDIKELTKEKTAMVFQNAIQIVTDNNEKHFFSSFTTRDRAYYVIHKLWMESKDGIKLSNAAFWDRVRENYGNDLGFLLEDVEYDESNATQFTARYKIPRRPSE-IMSNTSSPDDSLYESLEESPVSDNVIDYSLCNGHNLKSENFD--------KKPPSIPEEEIKFDLSFRNSTQXXXXXXXXXXXXXXXXXXXSSRPAAICSDHEHLP------NMLLDEEFSINVHTLWTFIFTDNAFFRALCAMRFITEITQSNWSDDVDREKCRTIYYTVNLKNRIGPKKSPTVEKQVLLEGSCKDYIYYVESIVRTVGIPMSDSFHIVLRYCLLYINPNKSRIKISMKIVYDKTVFFATKSIIDSSVKSGCIDYHKDLKQALLIESQKINDVLTEQKSYCTQSSIEESYQKVDTNENISIVSALHNS 1713
            TYK R  ++++ F     ++  LI+DY+CA+      IL QGR+Y++  +LCFYS    +E  I+++ K+I  +TKEKTA +  NAIQIVT+ +EK FF+SF  RDR+Y  I +LW        L+   FW  +++NYG +LG   E++E         +     PR P    + ++   D+ L +S+  S  S+++   S       ++E+FD         K  S  E++ K  L      ++    +   +        +     +   D E++P       + ++  F I+   ++  +FT + F +   + R I ++  + W+ ++  ++ RT+ YT+ L + +  K +   EKQ L + S +   Y V+S V T  +P  D F+ V RYC++  +  K R+++S  + Y K  +   KS+I+ +  S   DY K L+  LLIE   +N  + +            ++ +  T E +  +S+ H+S
Sbjct:   63 TYKDRNEEYRRQFTHL-PDTERLIADYACALQR---DILLQGRLYLSENWLCFYSNIFRWETTISIALKNITFMTKEKTARLIPNAIQIVTE-SEKFFFTSFGARDRSYLSIFRLWQNVLLDKSLTRQEFWQLLQQNYGTELGLNAEEME-----NLSLSIEDVQPRSPGRSSLDDSGERDEKLSKSI--SFTSESISRVS-------ETESFDGNSSKGGLGKEESQNEKQTKKSLLPTLEKKLTRVPSKSLDLNKNEYLSLDKSSTSDSVDEENVPEKDLHGRLFINRIFHISADRMFELLFTSSRFMQKFASSRNIIDVVSTPWTAELGGDQLRTMTYTIVLNSPLTGKCTAATEKQTLYKESREARFYLVDSEVLTHDVPYHDYFYTVNRYCIIRSSKQKCRLRVSTDLKYRKQPWGLVKSLIEKNSWSSLEDYFKQLESDLLIEESVLNQAIEDPGKLTGLRRRRRTFNR--TAETVPKLSSQHSS 532          
BLAST of VASt domain-containing protein vs. UniProt/SwissProt
Match: sp|Q8CI52|ASTRC_MOUSE (Protein Aster-C OS=Mus musculus OX=10090 GN=Gramd1c PE=2 SV=2)

HSP 1 Score: 180.644 bits (457), Expect = 4.930e-47
Identity = 132/458 (28.82%), Postives = 221/458 (48.25%), Query Frame = 1
Query:  286 TYKQRRSDFKKSFKDTNAESSPLISDYSCAIYAGTPKILQQGRMYITTEFLCFYSRFITFEQKITVSYKDIKELTKEKTAMVFQNAIQIVTDNNEKHFFSSFTTRDRAYYVIHKLWMESKDGIKLSNAAFWDRVRENYGNDLGFLLEDVEY----DESNATQFTARYKI---PRRPSEIMSNTSSPDDSLYESLEESPVSDNVIDYSLCNGHNLKSENFDKKPPSIPEEEIKFDLSFRNSTQXXXXXXXXXXXXXXXXXXXSSRPAAICSDHEHLP------NMLLDEEFSINVHTLWTFIFTDNAFFRALCAMRFITEITQSNWSDDVDREKCRTIYYTVNLKNRIGPKKSPTVEKQVLLEGSCKDYIYYVESIVRTVGIPMSDSFHIVLRYCLLYINPNKSRIKISMKIVYDKTVFFATKSIIDSSVKSGCIDYHKDLKQALLIE----SQKINDV 1608
            TYK R  ++++ F     +S  LI+DY+CA+      IL QGR+Y++ ++LCFYS    +E  I+++ K+I  +TKEKTA +  NAIQI+T+  EK FF+SF  RDR+Y +I +LW        L+   FW  +++NYG +LG   E++E+    +E+   +   R  +     R  +     S   +S+  + E  P+  N     L    +    N  K P    E+ I      R  ++  + N  E   +       S        D E++P       + ++  F I+   ++  +FT + F +     R I ++  + W+ +    + RT+ YT+ L N +  K +   EKQ L + S +   Y V+S V T  +P  D F+ + RYC++     + R+++S  + Y K  +   KS+I+ +  S    Y K L+  LL+E    SQ I D 
Sbjct:   63 TYKDRNEEYRQQFTHL-PDSEKLIADYACAL---QKDILVQGRLYLSEKWLCFYSNIFRWETTISIALKNITFMTKEKTARLIPNAIQIITE-GEKFFFTSFGARDRSYLIIFRLWQNVLLDKSLTRQEFWQLLQQNYGTELGLNAEEMEHLLSVEENVQPRSPGRSSVDDAGERDEKFSKAVSFTQESVSRASETEPLDGNSPKRGLGKEDSQSERNVRKSPSLASEKRIS-----RAPSKSLDLNKNEYLSLDKSSTSDS-------VDEENIPEKDLQGRLYINRVFHISAERMFELLFTSSHFMQRFANSRNIIDVVSTPWTVESGGNQLRTMTYTIVLSNPLTGKYTAATEKQTLYKESREAQFYLVDSEVLTHDVPYHDYFYTLNRYCIVRSAKQRCRLRVSTDLKYRKQPWGLIKSLIEKNSWSSLESYFKKLESDLLMEESVLSQSIEDA 503          
BLAST of VASt domain-containing protein vs. UniProt/SwissProt
Match: sp|Q5RC33|ASTRC_PONAB (Protein Aster-C OS=Pongo abelii OX=9601 GN=GRAMD1C PE=2 SV=1)

HSP 1 Score: 179.874 bits (455), Expect = 8.952e-47
Identity = 136/490 (27.76%), Postives = 243/490 (49.59%), Query Frame = 1
Query:  286 TYKQRRSDFKKSFKDTNAESSPLISDYSCAIYAGTPKILQQGRMYITTEFLCFYSRFITFEQKITVSYKDIKELTKEKTAMVFQNAIQIVTDNNEKHFFSSFTTRDRAYYVIHKLWMESKDGIKLSNAAFWDRVRENYGNDLGFLLEDVEYDESNATQFTARYKIPRRPSEIMSNTSSPDDSLYESLEESPVSDNVIDYSLCNGHNLKSENFD--------KKPPSIPEEEIKFDLSFRNSTQXXXXXXXXXXXXXXXXXXXSSRPAAICSDHEHLP------NMLLDEEFSINVHTLWTFIFTDNAFFRALCAMRFITEITQSNWSDDVDREKCRTIYYTVNLKNRIGPKKSPTVEKQVLLEGSCKDYIYYVESIVRTVGIPMSDSFHIVLRYCLLYINPNKSRIKISMKIVYDKTVFFATKSIIDSSVKSGCIDYHKDLKQALLIESQKINDVLTEQKSYCTQSSIEESYQKVDTNENISIVSALHNS 1713
            TYK R  ++++ F     ++  LI+DY+CA+      IL QGR+Y++  +LCFYS    +E  I+++ K+I  +TKEKTA +  NAIQIVT+ +EK FF+SF  RDR+Y  I +LW        L+   FW  +++NYG +LG   E++E    + +    R + P R S  + ++   D+ L +S+  S  S+++   S       ++E+FD         K  S  E++ K  L      ++    +   +        +     +   D E++P       + ++  F I+   ++  +FT + F +   + R I ++  + W+ ++  ++ RT+ YT+ L + +  K +   EKQ L + S +   Y V+S V T  +P  D F+ V RYC++  +  K R+++S  + Y K  +   KS+I+ +      DY K L+  LLIE   +N  + +            ++ +  T E +  +S+ H+S
Sbjct:   63 TYKDRNEEYRRQFTHL-PDTERLIADYACALQR---DILLQGRLYLSENWLCFYSNIFRWETTISIALKNITFMTKEKTARLIPNAIQIVTE-SEKFFFTSFGARDRSYLSIFRLWQNVLLDKSLTRQEFWQLLQQNYGTELGLNAEEME--NLSLSIEDVRPRSPGRSS--LDDSGERDEKLSKSI--SFTSESISRVS-------ETESFDGNSSKGGLGKEESQNEKQTKKSLLPTLEKKLTRVPSKSLDLNKNEYLSLEKSSTSDSVDEENVPEKDLHGRLFINRIFHISADRMFELLFTSSRFMQKFASSRNIIDVVSTPWTAELGGDQLRTMTYTIVLNSPLTGKCTAATEKQTLYKESREARFYMVDSEVLTHDVPYHDYFYTVDRYCIIRSSKQKCRLRVSTDLKYRKQPWGLVKSLIEKNSWGSLEDYFKHLESDLLIEESILNQAIEDPGKLTGLRRRRRTFNR--TAETVPKLSSQHSS 532          
BLAST of VASt domain-containing protein vs. TrEMBL
Match: A0A2C9JP87 (VASt domain-containing protein OS=Biomphalaria glabrata OX=6526 GN=106061972 PE=4 SV=1)

HSP 1 Score: 234.187 bits (596), Expect = 9.873e-63
Identity = 146/455 (32.09%), Postives = 232/455 (50.99%), Query Frame = 1
Query:  262 KKEPYMLKTYKQRRSDFKKSFKDTNAESSPLISDYSCAIYAGTPKILQQGRMYITTEFLCFYSRFITFEQKITVSYKDIKELTKEKTAMVFQNAIQIVTDNNEKHFFSSFTTRDRAYYVIHKLWMESKDGIKLSNAAFWDRVRENYGNDLGFLLEDVEYDESNATQFTARYKIPRRP--------SEIMSNTSSPDDSLYESLEESPVSDNVIDYSLCNGHNLKSENFDKKPPSIPEEEIKFDLSFRNSTQXXXXXXXXXXXXXXXXXXXSSRPAAICSDHEHLPNMLLDEEFSINVHTLWTFIFTDNAFFRALCAMRFITEITQSNWSDDVDRE--KCRTIYYTVNLKNRIGPKKSPTVEKQVLLEGSCKDYIYYVESIVRTVGIPMSDSFHIVLRYCLLYINPNKSRIKISMKIVYDKTVFFATKSIIDSSVKSGCIDYHKDLKQALLIESQK 1596
            +K+  M  TYK R  D+K+ FKD   +   LI DYSCA+      IL QGRMYI+ +++CFY++   +E  + +  K+I  +TKEKTA V  NAIQI T+  E+ FF+SF TRD+ Y ++ ++W  +     +S    W  +  NYG+DLG   +D +Y    + +          P        SE+++ T+    +      ++ V+D V +       N+       + PS+P       + F NS+                     S     C+ H+HL  M LDE F+IN+  ++  +FTD+ FFR+    R   E+   NW ++ D    K R I YT+ L N IGP+ SP+ E+Q+    S    IY+V+      GIP +DSF+++LRYCL  ++P K RI ++ ++ Y K V    +++I+ S  +G  DY++ L   L  E+++
Sbjct:  201 RKKQIMSTTYKSRSEDYKRMFKDVPKDER-LIVDYSCALQK---DILVQGRMYISQKWICFYAKIFNWETMLMIPCKEITAITKEKTARVIPNAIQITTEK-ERFFFTSFGTRDKTYMMLFRIWQNALLDQPMSAKELWTWIHYNYGDDLGLTTDDEDYVPPQSFEELTEKLKEEIPAIKELNTDSEVLTTTAENLQTASNEDTDAFVTDEVFN-------NVTESIPLSQMPSLP----SMPVDFLNSSD-------------------DSEGEYFCAGHDHLEKMYLDEVFNINIDIVFACLFTDSPFFRSFVGSRKTFELNLPNWEEEPDENGNKVRNITYTLTLNNSIGPRTSPSTERQICYTMSKPGKIYHVDCECCNGGIPYADSFYMLLRYCLTRVSPTKCRIVVTGELKYRKHVMGMFRAMIEKSAVNGLTDYYRQLSAHLRREAER 620          
BLAST of VASt domain-containing protein vs. TrEMBL
Match: A0A2C9JP77 (VASt domain-containing protein OS=Biomphalaria glabrata OX=6526 GN=106061972 PE=4 SV=1)

HSP 1 Score: 234.187 bits (596), Expect = 1.044e-62
Identity = 146/455 (32.09%), Postives = 232/455 (50.99%), Query Frame = 1
Query:  262 KKEPYMLKTYKQRRSDFKKSFKDTNAESSPLISDYSCAIYAGTPKILQQGRMYITTEFLCFYSRFITFEQKITVSYKDIKELTKEKTAMVFQNAIQIVTDNNEKHFFSSFTTRDRAYYVIHKLWMESKDGIKLSNAAFWDRVRENYGNDLGFLLEDVEYDESNATQFTARYKIPRRP--------SEIMSNTSSPDDSLYESLEESPVSDNVIDYSLCNGHNLKSENFDKKPPSIPEEEIKFDLSFRNSTQXXXXXXXXXXXXXXXXXXXSSRPAAICSDHEHLPNMLLDEEFSINVHTLWTFIFTDNAFFRALCAMRFITEITQSNWSDDVDRE--KCRTIYYTVNLKNRIGPKKSPTVEKQVLLEGSCKDYIYYVESIVRTVGIPMSDSFHIVLRYCLLYINPNKSRIKISMKIVYDKTVFFATKSIIDSSVKSGCIDYHKDLKQALLIESQK 1596
            +K+  M  TYK R  D+K+ FKD   +   LI DYSCA+      IL QGRMYI+ +++CFY++   +E  + +  K+I  +TKEKTA V  NAIQI T+  E+ FF+SF TRD+ Y ++ ++W  +     +S    W  +  NYG+DLG   +D +Y    + +          P        SE+++ T+    +      ++ V+D V +       N+       + PS+P       + F NS+                     S     C+ H+HL  M LDE F+IN+  ++  +FTD+ FFR+    R   E+   NW ++ D    K R I YT+ L N IGP+ SP+ E+Q+    S    IY+V+      GIP +DSF+++LRYCL  ++P K RI ++ ++ Y K V    +++I+ S  +G  DY++ L   L  E+++
Sbjct:  200 RKKQIMSTTYKSRSEDYKRMFKDVPKDER-LIVDYSCALQK---DILVQGRMYISQKWICFYAKIFNWETMLMIPCKEITAITKEKTARVIPNAIQITTEK-ERFFFTSFGTRDKTYMMLFRIWQNALLDQPMSAKELWTWIHYNYGDDLGLTTDDEDYVPPQSFEELTEKLKEEIPAIKELNTDSEVLTTTAENLQTASNEDTDAFVTDEVFN-------NVTESIPLSQMPSLP----SMPVDFLNSSD-------------------DSEGEYFCAGHDHLEKMYLDEVFNINIDIVFACLFTDSPFFRSFVGSRKTFELNLPNWEEEPDENGNKVRNITYTLTLNNSIGPRTSPSTERQICYTMSKPGKIYHVDCECCNGGIPYADSFYMLLRYCLTRVSPTKCRIVVTGELKYRKHVMGMFRAMIEKSAVNGLTDYYRQLSAHLRREAER 619          
BLAST of VASt domain-containing protein vs. TrEMBL
Match: A0A2C9JP88 (VASt domain-containing protein OS=Biomphalaria glabrata OX=6526 GN=106061972 PE=4 SV=1)

HSP 1 Score: 234.187 bits (596), Expect = 2.511e-62
Identity = 146/455 (32.09%), Postives = 232/455 (50.99%), Query Frame = 1
Query:  262 KKEPYMLKTYKQRRSDFKKSFKDTNAESSPLISDYSCAIYAGTPKILQQGRMYITTEFLCFYSRFITFEQKITVSYKDIKELTKEKTAMVFQNAIQIVTDNNEKHFFSSFTTRDRAYYVIHKLWMESKDGIKLSNAAFWDRVRENYGNDLGFLLEDVEYDESNATQFTARYKIPRRP--------SEIMSNTSSPDDSLYESLEESPVSDNVIDYSLCNGHNLKSENFDKKPPSIPEEEIKFDLSFRNSTQXXXXXXXXXXXXXXXXXXXSSRPAAICSDHEHLPNMLLDEEFSINVHTLWTFIFTDNAFFRALCAMRFITEITQSNWSDDVDRE--KCRTIYYTVNLKNRIGPKKSPTVEKQVLLEGSCKDYIYYVESIVRTVGIPMSDSFHIVLRYCLLYINPNKSRIKISMKIVYDKTVFFATKSIIDSSVKSGCIDYHKDLKQALLIESQK 1596
            +K+  M  TYK R  D+K+ FKD   +   LI DYSCA+      IL QGRMYI+ +++CFY++   +E  + +  K+I  +TKEKTA V  NAIQI T+  E+ FF+SF TRD+ Y ++ ++W  +     +S    W  +  NYG+DLG   +D +Y    + +          P        SE+++ T+    +      ++ V+D V +       N+       + PS+P       + F NS+                     S     C+ H+HL  M LDE F+IN+  ++  +FTD+ FFR+    R   E+   NW ++ D    K R I YT+ L N IGP+ SP+ E+Q+    S    IY+V+      GIP +DSF+++LRYCL  ++P K RI ++ ++ Y K V    +++I+ S  +G  DY++ L   L  E+++
Sbjct:  276 RKKQIMSTTYKSRSEDYKRMFKDVPKDER-LIVDYSCALQK---DILVQGRMYISQKWICFYAKIFNWETMLMIPCKEITAITKEKTARVIPNAIQITTEK-ERFFFTSFGTRDKTYMMLFRIWQNALLDQPMSAKELWTWIHYNYGDDLGLTTDDEDYVPPQSFEELTEKLKEEIPAIKELNTDSEVLTTTAENLQTASNEDTDAFVTDEVFN-------NVTESIPLSQMPSLP----SMPVDFLNSSD-------------------DSEGEYFCAGHDHLEKMYLDEVFNINIDIVFACLFTDSPFFRSFVGSRKTFELNLPNWEEEPDENGNKVRNITYTLTLNNSIGPRTSPSTERQICYTMSKPGKIYHVDCECCNGGIPYADSFYMLLRYCLTRVSPTKCRIVVTGELKYRKHVMGMFRAMIEKSAVNGLTDYYRQLSAHLRREAER 695          
BLAST of VASt domain-containing protein vs. TrEMBL
Match: A0A2C9JP82 (VASt domain-containing protein OS=Biomphalaria glabrata OX=6526 GN=106061972 PE=4 SV=1)

HSP 1 Score: 234.187 bits (596), Expect = 2.669e-62
Identity = 146/455 (32.09%), Postives = 232/455 (50.99%), Query Frame = 1
Query:  262 KKEPYMLKTYKQRRSDFKKSFKDTNAESSPLISDYSCAIYAGTPKILQQGRMYITTEFLCFYSRFITFEQKITVSYKDIKELTKEKTAMVFQNAIQIVTDNNEKHFFSSFTTRDRAYYVIHKLWMESKDGIKLSNAAFWDRVRENYGNDLGFLLEDVEYDESNATQFTARYKIPRRP--------SEIMSNTSSPDDSLYESLEESPVSDNVIDYSLCNGHNLKSENFDKKPPSIPEEEIKFDLSFRNSTQXXXXXXXXXXXXXXXXXXXSSRPAAICSDHEHLPNMLLDEEFSINVHTLWTFIFTDNAFFRALCAMRFITEITQSNWSDDVDRE--KCRTIYYTVNLKNRIGPKKSPTVEKQVLLEGSCKDYIYYVESIVRTVGIPMSDSFHIVLRYCLLYINPNKSRIKISMKIVYDKTVFFATKSIIDSSVKSGCIDYHKDLKQALLIESQK 1596
            +K+  M  TYK R  D+K+ FKD   +   LI DYSCA+      IL QGRMYI+ +++CFY++   +E  + +  K+I  +TKEKTA V  NAIQI T+  E+ FF+SF TRD+ Y ++ ++W  +     +S    W  +  NYG+DLG   +D +Y    + +          P        SE+++ T+    +      ++ V+D V +       N+       + PS+P       + F NS+                     S     C+ H+HL  M LDE F+IN+  ++  +FTD+ FFR+    R   E+   NW ++ D    K R I YT+ L N IGP+ SP+ E+Q+    S    IY+V+      GIP +DSF+++LRYCL  ++P K RI ++ ++ Y K V    +++I+ S  +G  DY++ L   L  E+++
Sbjct:  277 RKKQIMSTTYKSRSEDYKRMFKDVPKDER-LIVDYSCALQK---DILVQGRMYISQKWICFYAKIFNWETMLMIPCKEITAITKEKTARVIPNAIQITTEK-ERFFFTSFGTRDKTYMMLFRIWQNALLDQPMSAKELWTWIHYNYGDDLGLTTDDEDYVPPQSFEELTEKLKEEIPAIKELNTDSEVLTTTAENLQTASNEDTDAFVTDEVFN-------NVTESIPLSQMPSLP----SMPVDFLNSSD-------------------DSEGEYFCAGHDHLEKMYLDEVFNINIDIVFACLFTDSPFFRSFVGSRKTFELNLPNWEEEPDENGNKVRNITYTLTLNNSIGPRTSPSTERQICYTMSKPGKIYHVDCECCNGGIPYADSFYMLLRYCLTRVSPTKCRIVVTGELKYRKHVMGMFRAMIEKSAVNGLTDYYRQLSAHLRREAER 696          
BLAST of VASt domain-containing protein vs. TrEMBL
Match: A0A2C9JP79 (VASt domain-containing protein OS=Biomphalaria glabrata OX=6526 GN=106061972 PE=4 SV=1)

HSP 1 Score: 232.646 bits (592), Expect = 5.970e-62
Identity = 145/450 (32.22%), Postives = 229/450 (50.89%), Query Frame = 1
Query:  277 MLKTYKQRRSDFKKSFKDTNAESSPLISDYSCAIYAGTPKILQQGRMYITTEFLCFYSRFITFEQKITVSYKDIKELTKEKTAMVFQNAIQIVTDNNEKHFFSSFTTRDRAYYVIHKLWMESKDGIKLSNAAFWDRVRENYGNDLGFLLEDVEYDESNATQFTARYKIPRRP--------SEIMSNTSSPDDSLYESLEESPVSDNVIDYSLCNGHNLKSENFDKKPPSIPEEEIKFDLSFRNSTQXXXXXXXXXXXXXXXXXXXSSRPAAICSDHEHLPNMLLDEEFSINVHTLWTFIFTDNAFFRALCAMRFITEITQSNWSDDVDRE--KCRTIYYTVNLKNRIGPKKSPTVEKQVLLEGSCKDYIYYVESIVRTVGIPMSDSFHIVLRYCLLYINPNKSRIKISMKIVYDKTVFFATKSIIDSSVKSGCIDYHKDLKQALLIESQK 1596
            M  TYK R  D+K+ FKD   +   LI DYSCA+      IL QGRMYI+ +++CFY++   +E  + +  K+I  +TKEKTA V  NAIQI T+  E+ FF+SF TRD+ Y ++ ++W  +     +S    W  +  NYG+DLG   +D +Y    + +          P        SE+++ T+    +      ++ V+D V +       N+       + PS+P       + F NS+                     S     C+ H+HL  M LDE F+IN+  ++  +FTD+ FFR+    R   E+   NW ++ D    K R I YT+ L N IGP+ SP+ E+Q+    S    IY+V+      GIP +DSF+++LRYCL  ++P K RI ++ ++ Y K V    +++I+ S  +G  DY++ L   L  E+++
Sbjct:  260 MSTTYKSRSEDYKRMFKDVPKDER-LIVDYSCALQK---DILVQGRMYISQKWICFYAKIFNWETMLMIPCKEITAITKEKTARVIPNAIQITTEK-ERFFFTSFGTRDKTYMMLFRIWQNALLDQPMSAKELWTWIHYNYGDDLGLTTDDEDYVPPQSFEELTEKLKEEIPAIKELNTDSEVLTTTAENLQTASNEDTDAFVTDEVFN-------NVTESIPLSQMPSLP----SMPVDFLNSSD-------------------DSEGEYFCAGHDHLEKMYLDEVFNINIDIVFACLFTDSPFFRSFVGSRKTFELNLPNWEEEPDENGNKVRNITYTLTLNNSIGPRTSPSTERQICYTMSKPGKIYHVDCECCNGGIPYADSFYMLLRYCLTRVSPTKCRIVVTGELKYRKHVMGMFRAMIEKSAVNGLTDYYRQLSAHLRREAER 674          
BLAST of VASt domain-containing protein vs. Ensembl Cavefish
Match: gramd1ba (GRAM domain-containing protein 1B-like [Source:NCBI gene;Acc:103036148])

HSP 1 Score: 184.496 bits (467), Expect = 5.956e-49
Identity = 141/475 (29.68%), Postives = 221/475 (46.53%), Query Frame = 1
Query:  286 TYKQRRSDFKKSFKDTNAESSPLISDYSCAIYAGTPKILQQGRMYITTEFLCFYSRFITFEQKITVSYKDIKELTKEKTAMVFQNAIQIVTDNNEKHFFSSFTTRDRAYYVIHKLWMESKDGIKLSNAAFWDRVRENYGNDLGFLLEDVEYDESNATQFTARY--KIPRRPSEIM-SNTSSPDDSLYESLEESPVSDNVIDYSLCNGHNLKSENFDKKPPSIPEEEIKFDLSFRNSTQXXXXXXXXXXXXXXXXXXXSSRPAAICS----DHEHLPNMLLD------------------------EEFSINVHTLWTFIFTDNAFFRALCAMRFITEITQSNWSDDVDREKCRTIYYTVNLKNRIGPKKSPTVEKQVLLEGSCKDYIYYVESIVRTVGIPMSDSFHIVLRYCLLYINPNKSRIKISMKIVYDKTVFFATKSIIDSSVKSGCIDYHKDLKQALLIESQKINDVLTE 1617
            TYKQR  DF+K FK    ++  LI DYSCA+      IL QGR+Y++  ++CFYS    +E  +TV  KD+  +TKEKTA +  NAIQ+ TD NEKHFF+SF  RDR Y ++ +LW  +     L     W  V + YGN+LG   +D +Y   +    T  Y  +IP   +E   + T SP+      ++ SP    +        +NL S      P       + +DL+           ++    +   +   SS P    S    D+E LP  L D                        E +  +V  L+  +FT++ F R    +R  +++    W  +   ++ R I YT++L N + PK +   E Q L + S +   Y +++ V T  +P  D F+ + RY L  +  NK R+++S ++ Y K  +   K  I+ +  SG  +Y + L+    +E  K+   LTE
Sbjct:   46 TYKQRNEDFRKLFKQL-PDTERLIVDYSCALQR---DILLQGRLYLSENWICFYSNIFRWETLLTVRLKDVCSMTKEKTARLIPNAIQLCTD-NEKHFFTSFGARDRTYMMMFRLWQNALLDKPLCPKELWHFVHQCYGNELGLTSDDEDYVPPDDDFNTMGYCEEIPAEDNEANDACTKSPE----VKVDASPQLPKIF-----TSNNLSSTGSTDTP-------VHYDLAPEEEFTGCLPEDLLTLPLPDNKLSESSAPVPSPSLDFNDNEDLPTELSDSSETHDEGEVQAFHEDLNGKQYINEIYKFSVDKLYDLLFTESQFMRDFLELRRFSDVVYRPWKKEETGDQSREIMYTISLTNPLAPKTATVTETQTLYKASQESECYIIDAEVITHDVPYHDYFYTLNRYVLTRVAKNKCRLRVSTELRYRKQPWGLVKGFIERNFWSGLDEYFRHLE----LELSKMEVALTE 495          
BLAST of VASt domain-containing protein vs. Ensembl Cavefish
Match: gramd1ba (GRAM domain-containing protein 1B-like [Source:NCBI gene;Acc:103036148])

HSP 1 Score: 183.726 bits (465), Expect = 8.551e-49
Identity = 141/475 (29.68%), Postives = 221/475 (46.53%), Query Frame = 1
Query:  286 TYKQRRSDFKKSFKDTNAESSPLISDYSCAIYAGTPKILQQGRMYITTEFLCFYSRFITFEQKITVSYKDIKELTKEKTAMVFQNAIQIVTDNNEKHFFSSFTTRDRAYYVIHKLWMESKDGIKLSNAAFWDRVRENYGNDLGFLLEDVEYDESNATQFTARY--KIPRRPSEIM-SNTSSPDDSLYESLEESPVSDNVIDYSLCNGHNLKSENFDKKPPSIPEEEIKFDLSFRNSTQXXXXXXXXXXXXXXXXXXXSSRPAAICS----DHEHLPNMLLD------------------------EEFSINVHTLWTFIFTDNAFFRALCAMRFITEITQSNWSDDVDREKCRTIYYTVNLKNRIGPKKSPTVEKQVLLEGSCKDYIYYVESIVRTVGIPMSDSFHIVLRYCLLYINPNKSRIKISMKIVYDKTVFFATKSIIDSSVKSGCIDYHKDLKQALLIESQKINDVLTE 1617
            TYKQR  DF+K FK    ++  LI DYSCA+      IL QGR+Y++  ++CFYS    +E  +TV  KD+  +TKEKTA +  NAIQ+ TD NEKHFF+SF  RDR Y ++ +LW  +     L     W  V + YGN+LG   +D +Y   +    T  Y  +IP   +E   + T SP+      ++ SP    +        +NL S      P       + +DL+           ++    +   +   SS P    S    D+E LP  L D                        E +  +V  L+  +FT++ F R    +R  +++    W  +   ++ R I YT++L N + PK +   E Q L + S +   Y +++ V T  +P  D F+ + RY L  +  NK R+++S ++ Y K  +   K  I+ +  SG  +Y + L+    +E  K+   LTE
Sbjct:   60 TYKQRNEDFRKLFKQL-PDTERLIVDYSCALQR---DILLQGRLYLSENWICFYSNIFRWETLLTVRLKDVCSMTKEKTARLIPNAIQLCTD-NEKHFFTSFGARDRTYMMMFRLWQNALLDKPLCPKELWHFVHQCYGNELGLTSDDEDYVPPDDDFNTMGYCEEIPAEDNEANDACTKSPE----VKVDASPQLPKIF-----TSNNLSSTGSTDTP-------VHYDLAPEEEFTGCLPEDLLTLPLPDNKLSESSAPVPSPSLDFNDNEDLPTELSDSSETHDEGEVQAFHEDLNGKQYINEIYKFSVDKLYDLLFTESQFMRDFLELRRFSDVVYRPWKKEETGDQSREIMYTISLTNPLAPKTATVTETQTLYKASQESECYIIDAEVITHDVPYHDYFYTLNRYVLTRVAKNKCRLRVSTELRYRKQPWGLVKGFIERNFWSGLDEYFRHLE----LELSKMEVALTE 509          
BLAST of VASt domain-containing protein vs. Ensembl Cavefish
Match: gramd1ba (GRAM domain-containing protein 1B-like [Source:NCBI gene;Acc:103036148])

HSP 1 Score: 183.726 bits (465), Expect = 8.551e-49
Identity = 141/475 (29.68%), Postives = 221/475 (46.53%), Query Frame = 1
Query:  286 TYKQRRSDFKKSFKDTNAESSPLISDYSCAIYAGTPKILQQGRMYITTEFLCFYSRFITFEQKITVSYKDIKELTKEKTAMVFQNAIQIVTDNNEKHFFSSFTTRDRAYYVIHKLWMESKDGIKLSNAAFWDRVRENYGNDLGFLLEDVEYDESNATQFTARY--KIPRRPSEIM-SNTSSPDDSLYESLEESPVSDNVIDYSLCNGHNLKSENFDKKPPSIPEEEIKFDLSFRNSTQXXXXXXXXXXXXXXXXXXXSSRPAAICS----DHEHLPNMLLD------------------------EEFSINVHTLWTFIFTDNAFFRALCAMRFITEITQSNWSDDVDREKCRTIYYTVNLKNRIGPKKSPTVEKQVLLEGSCKDYIYYVESIVRTVGIPMSDSFHIVLRYCLLYINPNKSRIKISMKIVYDKTVFFATKSIIDSSVKSGCIDYHKDLKQALLIESQKINDVLTE 1617
            TYKQR  DF+K FK    ++  LI DYSCA+      IL QGR+Y++  ++CFYS    +E  +TV  KD+  +TKEKTA +  NAIQ+ TD NEKHFF+SF  RDR Y ++ +LW  +     L     W  V + YGN+LG   +D +Y   +    T  Y  +IP   +E   + T SP+      ++ SP    +        +NL S      P       + +DL+           ++    +   +   SS P    S    D+E LP  L D                        E +  +V  L+  +FT++ F R    +R  +++    W  +   ++ R I YT++L N + PK +   E Q L + S +   Y +++ V T  +P  D F+ + RY L  +  NK R+++S ++ Y K  +   K  I+ +  SG  +Y + L+    +E  K+   LTE
Sbjct:   60 TYKQRNEDFRKLFKQL-PDTERLIVDYSCALQR---DILLQGRLYLSENWICFYSNIFRWETLLTVRLKDVCSMTKEKTARLIPNAIQLCTD-NEKHFFTSFGARDRTYMMMFRLWQNALLDKPLCPKELWHFVHQCYGNELGLTSDDEDYVPPDDDFNTMGYCEEIPAEDNEANDACTKSPE----VKVDASPQLPKIF-----TSNNLSSTGSTDTP-------VHYDLAPEEEFTGCLPEDLLTLPLPDNKLSESSAPVPSPSLDFNDNEDLPTELSDSSETHDEGEVQAFHEDLNGKQYINEIYKFSVDKLYDLLFTESQFMRDFLELRRFSDVVYRPWKKEETGDQSREIMYTISLTNPLAPKTATVTETQTLYKASQESECYIIDAEVITHDVPYHDYFYTLNRYVLTRVAKNKCRLRVSTELRYRKQPWGLVKGFIERNFWSGLDEYFRHLE----LELSKMEVALTE 509          
BLAST of VASt domain-containing protein vs. Ensembl Cavefish
Match: gramd1ba (GRAM domain-containing protein 1B-like [Source:NCBI gene;Acc:103036148])

HSP 1 Score: 183.341 bits (464), Expect = 1.325e-48
Identity = 141/475 (29.68%), Postives = 221/475 (46.53%), Query Frame = 1
Query:  286 TYKQRRSDFKKSFKDTNAESSPLISDYSCAIYAGTPKILQQGRMYITTEFLCFYSRFITFEQKITVSYKDIKELTKEKTAMVFQNAIQIVTDNNEKHFFSSFTTRDRAYYVIHKLWMESKDGIKLSNAAFWDRVRENYGNDLGFLLEDVEYDESNATQFTARY--KIPRRPSEIM-SNTSSPDDSLYESLEESPVSDNVIDYSLCNGHNLKSENFDKKPPSIPEEEIKFDLSFRNSTQXXXXXXXXXXXXXXXXXXXSSRPAAICS----DHEHLPNMLLD------------------------EEFSINVHTLWTFIFTDNAFFRALCAMRFITEITQSNWSDDVDREKCRTIYYTVNLKNRIGPKKSPTVEKQVLLEGSCKDYIYYVESIVRTVGIPMSDSFHIVLRYCLLYINPNKSRIKISMKIVYDKTVFFATKSIIDSSVKSGCIDYHKDLKQALLIESQKINDVLTE 1617
            TYKQR  DF+K FK    ++  LI DYSCA+      IL QGR+Y++  ++CFYS    +E  +TV  KD+  +TKEKTA +  NAIQ+ TD NEKHFF+SF  RDR Y ++ +LW  +     L     W  V + YGN+LG   +D +Y   +    T  Y  +IP   +E   + T SP+      ++ SP    +        +NL S      P       + +DL+           ++    +   +   SS P    S    D+E LP  L D                        E +  +V  L+  +FT++ F R    +R  +++    W  +   ++ R I YT++L N + PK +   E Q L + S +   Y +++ V T  +P  D F+ + RY L  +  NK R+++S ++ Y K  +   K  I+ +  SG  +Y + L+    +E  K+   LTE
Sbjct:   96 TYKQRNEDFRKLFKQL-PDTERLIVDYSCALQR---DILLQGRLYLSENWICFYSNIFRWETLLTVRLKDVCSMTKEKTARLIPNAIQLCTD-NEKHFFTSFGARDRTYMMMFRLWQNALLDKPLCPKELWHFVHQCYGNELGLTSDDEDYVPPDDDFNTMGYCEEIPAEDNEANDACTKSPE----VKVDASPQLPKIF-----TSNNLSSTGSTDTP-------VHYDLAPEEEFTGCLPEDLLTLPLPDNKLSESSAPVPSPSLDFNDNEDLPTELSDSSETHDEGEVQAFHEDLNGKQYINEIYKFSVDKLYDLLFTESQFMRDFLELRRFSDVVYRPWKKEETGDQSREIMYTISLTNPLAPKTATVTETQTLYKASQESECYIIDAEVITHDVPYHDYFYTLNRYVLTRVAKNKCRLRVSTELRYRKQPWGLVKGFIERNFWSGLDEYFRHLE----LELSKMEVALTE 545          
BLAST of VASt domain-containing protein vs. Ensembl Cavefish
Match: gramd1ba (GRAM domain-containing protein 1B-like [Source:NCBI gene;Acc:103036148])

HSP 1 Score: 183.726 bits (465), Expect = 1.568e-48
Identity = 141/475 (29.68%), Postives = 221/475 (46.53%), Query Frame = 1
Query:  286 TYKQRRSDFKKSFKDTNAESSPLISDYSCAIYAGTPKILQQGRMYITTEFLCFYSRFITFEQKITVSYKDIKELTKEKTAMVFQNAIQIVTDNNEKHFFSSFTTRDRAYYVIHKLWMESKDGIKLSNAAFWDRVRENYGNDLGFLLEDVEYDESNATQFTARY--KIPRRPSEIM-SNTSSPDDSLYESLEESPVSDNVIDYSLCNGHNLKSENFDKKPPSIPEEEIKFDLSFRNSTQXXXXXXXXXXXXXXXXXXXSSRPAAICS----DHEHLPNMLLD------------------------EEFSINVHTLWTFIFTDNAFFRALCAMRFITEITQSNWSDDVDREKCRTIYYTVNLKNRIGPKKSPTVEKQVLLEGSCKDYIYYVESIVRTVGIPMSDSFHIVLRYCLLYINPNKSRIKISMKIVYDKTVFFATKSIIDSSVKSGCIDYHKDLKQALLIESQKINDVLTE 1617
            TYKQR  DF+K FK    ++  LI DYSCA+      IL QGR+Y++  ++CFYS    +E  +TV  KD+  +TKEKTA +  NAIQ+ TD NEKHFF+SF  RDR Y ++ +LW  +     L     W  V + YGN+LG   +D +Y   +    T  Y  +IP   +E   + T SP+      ++ SP    +        +NL S      P       + +DL+           ++    +   +   SS P    S    D+E LP  L D                        E +  +V  L+  +FT++ F R    +R  +++    W  +   ++ R I YT++L N + PK +   E Q L + S +   Y +++ V T  +P  D F+ + RY L  +  NK R+++S ++ Y K  +   K  I+ +  SG  +Y + L+    +E  K+   LTE
Sbjct:  100 TYKQRNEDFRKLFKQL-PDTERLIVDYSCALQR---DILLQGRLYLSENWICFYSNIFRWETLLTVRLKDVCSMTKEKTARLIPNAIQLCTD-NEKHFFTSFGARDRTYMMMFRLWQNALLDKPLCPKELWHFVHQCYGNELGLTSDDEDYVPPDDDFNTMGYCEEIPAEDNEANDACTKSPE----VKVDASPQLPKIF-----TSNNLSSTGSTDTP-------VHYDLAPEEEFTGCLPEDLLTLPLPDNKLSESSAPVPSPSLDFNDNEDLPTELSDSSETHDEGEVQAFHEDLNGKQYINEIYKFSVDKLYDLLFTESQFMRDFLELRRFSDVVYRPWKKEETGDQSREIMYTISLTNPLAPKTATVTETQTLYKASQESECYIIDAEVITHDVPYHDYFYTLNRYVLTRVAKNKCRLRVSTELRYRKQPWGLVKGFIERNFWSGLDEYFRHLE----LELSKMEVALTE 549          
BLAST of VASt domain-containing protein vs. Ensembl Sea Lamprey
Match: GRAMD1A (GRAM domain containing 1A [Source:HGNC Symbol;Acc:HGNC:29305])

HSP 1 Score: 148.288 bits (373), Expect = 6.117e-39
Identity = 121/440 (27.50%), Postives = 198/440 (45.00%), Query Frame = 1
Query:  289 YKQRRSDFKKSFKDTNAESSPLISDYSCAIYAGTPKILQQGRMYITTEFLCFYSRFITFEQKITVSYKDIKELTKEKTAMVFQNAIQIVTDNNEKHFFSSFTTRDRAYYVIHKLWMESKDGIKLSNAAFWDRVRENYGNDLGFLLEDVEYDESNATQFTARYKIPRRPSEIMSNTSSPDDSLYESLEESPVSDNVIDYSLCNGHNLKSE--NFDKKPPSIPEEEIKFDLSFRNSTQXXXXXXXXXXXXXXXXXXXSSRPAAICSD---HEHLPNML-LDEEFSINVHTLWTFIFTDNAFFRALCAMRFITEITQSNWSDDVDREKCRTIYYTVNLKNR-IGPKKSPTVEKQVLLEGSCKDYIYYVESIVRTVGIPMSDSFHIVLRYCLLYINPNKSRIKISMKIVYDKTVFFATKSIIDSSVKSGCIDYHKDLKQALLIE 1587
            Y+QR  DF++ FK    E+  L+ DYSCA+      IL  GR+Y++  +LCF+S    +E  +T+  K+I  +TKE+TA V  NAIQ+ T  NEK+FFSS   RDRA+ +I +LW  S     L +  F   V++ YG+D     E  E+  S   +       P   +     T +PD +    +            +  + H  + +    D    S+   E+  +   R+            +         +  PA   +D   H   P  + +D E  +    L   +F+D+ F R     R IT++    W       + R++ YT+NL      PK S   E Q++ + S  D++  V S V T  +P S+ F     + L  ++ + +R++IS ++ + K  +   K++ID S  +G  +Y   L   LL E
Sbjct:    4 YRQRNDDFRRIFKQL-PENEHLVVDYSCALQR---DILVHGRLYLSEGWLCFHSNIFRWETLLTIQMKEITAVTKERTARVIPNAIQVCT-QNEKYFFSSLGARDRAFLMIFRLWQNSLLDKTLDSREFLQYVQQAYGSDSTLHSEGDEH-ASRPVRAAVTPNTPSSSAHAPHGTRTPDRAATPDISMGSPRAPPTHLASTSPHGSRGDLSQVDGLTMSMLGREMTPEPQRRDYPSPELGPGTNPSTDDSDASEGT--PAGDGADRKPHTLPPGQVCIDREVCVGTEKLEKLLFSDSLFMRRFLLARKITDVVCKPWEQTKPGTEQRSLTYTINLNGGPFTPKSSSATEVQIMNKES-SDWLVVV-SEVATHDVPYSEYFFNRNHFLLQRLSSHTTRLRISWEVCFRKQPWGPVKALIDKSSSTGLAEYFALLDSELLRE 433          
BLAST of VASt domain-containing protein vs. Ensembl Sea Lamprey
Match: gramd1bb (GRAM domain containing 1Bb [Source:ZFIN;Acc:ZDB-GENE-140106-106])

HSP 1 Score: 127.102 bits (318), Expect = 7.969e-31
Identity = 67/151 (44.37%), Postives = 91/151 (60.26%), Query Frame = 1
Query:  286 TYKQRRSDFKKSFKDTNAESSPLISDYSCAIYAGTPKILQQGRMYITTEFLCFYSRFITFEQKITVSYKDIKELTKEKTAMVFQNAIQIVTDNNEKHFFSSFTTRDRAYYVIHKLWMESKDGIKLSNAAFWDRVRENYGNDLGFLLEDVEY 738
            TYKQR  DF+K FK    ES  LI DYSCA+      IL QGR+Y++  ++CFYS    +E  +T+  K+I  +TKEKTA +  NAIQI T+ N+KHFF+S   RDR + ++ +LW  +     L     W  V + YGN+LG   ED +Y
Sbjct:   13 TYKQRNEDFRKLFKQL-PESERLIVDYSCALQR---DILLQGRLYLSENWICFYSNIFRWETLLTIRLKEITAMTKEKTARLIPNAIQICTE-NDKHFFTSLGARDRTFMMMFRLWQNALLDKPLCPKELWQFVHQCYGNELGLTSEDEDY 158          
BLAST of VASt domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003678.1 (pep scaffold:Pmarinus_7.0:GL477104:103280:105081:-1 gene:ENSPMAG00000003360.1 transcript:ENSPMAT00000003678.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 57.3806 bits (137), Expect = 2.030e-10
Identity = 28/83 (33.73%), Postives = 50/83 (60.24%), Query Frame = 1
Query:  364 YSCAIYAGTPKILQQGRMYITTEFLCFYSRFITFEQKITVSYKDIKELTKEKTAMVFQNAIQIVTDNNEKHFFSSFTTRDRAY 612
            ++CA+      ++ QGRM+++  ++CF++ F   + K+ +    +K + K+++A++  NAI I T   EKH F SF  RD AY
Sbjct:   26 FNCAL---QRDLIFQGRMFVSENWICFFANFFGKDVKVAIPVLTVKAIKKQRSALLLPNAIGI-TSACEKHMFISFLARDAAY 104          
BLAST of VASt domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006389.1 (pep scaffold:Pmarinus_7.0:GL481951:143257:161898:-1 gene:ENSPMAG00000005741.1 transcript:ENSPMAT00000006389.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 51.2174 bits (121), Expect = 8.896e-7
Identity = 29/109 (26.61%), Postives = 59/109 (54.13%), Query Frame = 1
Query:  304 SDFKKSFKDTNAESSPLISDYSCAIYAGTPKILQQGRMYITTEFLCFYSRFITFEQKITVSYKDIKELTKEKTAMVFQNAIQIVTDNNEKHFFSSFTTRDRAYYVIHKL 630
            + F+K F     E   L++ YSC+ + G  ++ +QG +Y++   +CFYS  +  E K+ V + D+  L +  T +V   ++++ T + +  FFS F +    + ++ +L
Sbjct:   71 AKFRKLFG--MPEEERLVNYYSCSYWKG--RVPRQGWLYLSVNHVCFYSLLLGKEAKLVVRWADVTCLERTAT-VVLPESVRVATRDGDL-FFSMFLSVGETFRLMERL 173          
BLAST of VASt domain-containing protein vs. Ensembl Yeast
Match: LAM4 (Sterol-binding protein that localizes to puncta in the cortical ER; sterol binding occurs via two StART-like domains; one of six StART-like domain-containing proteins in yeast that may be involved in intracellular sterol transfer between membranes; conserved across eukaryotes; has both GRAM and StART-like (VASt) domains; the authentic, non-tagged protein is detected in highly purified mitochondria in high-throughput studies [Source:SGD;Acc:S000001122])

HSP 1 Score: 72.4034 bits (176), Expect = 1.548e-13
Identity = 43/117 (36.75%), Postives = 70/117 (59.83%), Query Frame = 1
Query:  292 KQRRSDFKKSFKDTNAESSP---LISDYSCAIYAGTPKILQQGRMYITTEFLCFYSRFITFEQKITVSYKDIKELTKEKTAMVFQNAIQIVTDNNEKHFFSSFTTRDRAYYVIHKLW 633
            +++ ++F   FKD+    SP   LI D+SCA+   +  IL QGRMYI+ + + FYS  + +   + + +K I ++ K  TA +F N I I T +  K+ F+SFT+RD  Y +I ++W
Sbjct:  544 EKKDAEFHAIFKDSGV--SPNERLILDHSCAL---SRDILLQGRMYISDQHIGFYSNILGWVSTVFIPFKTIVQIEKRATAGIFPNGIVIDTLHT-KYTFASFTSRDATYDLITEVW 654          
BLAST of VASt domain-containing protein vs. Ensembl Yeast
Match: YSP2 (Sterol-binding protein; has a probable role in retrograde transport of sterols from the plasma membrane to the ER; contains two StART-like domains that bind sterols and a GRAM domain; co-localizes to puncta in the cortical ER with Sip3p; one of six StART-like domain-containing proteins in yeast that may be involved in sterol transfer between intracellular membranes; conserved across eukaryotes [Source:SGD;Acc:S000002734])

HSP 1 Score: 68.5514 bits (166), Expect = 2.299e-12
Identity = 42/127 (33.07%), Postives = 72/127 (56.69%), Query Frame = 1
Query:  292 KQRRSDFKKSFKDTNAE-SSPLISDYSCAIYAGTPKILQQGRMYITTEFLCFYSRFITFEQKITVSYKDIKELTKEKTAMVFQNAIQIVTDNNEKHFFSSFTTRDRAYYVIHKLWMESKDGIKLSNA 669
            +++ S+F   FKD +   +  LI D+SCA+   +  IL QGRMYI+   + F+S  + +   + + +K+I ++ K+ TA +F N I I T  + K+ F+SF +RD  + +I  +W +   G K  N 
Sbjct:  643 EKKNSEFHTLFKDCDINPNEKLIVDHSCAL---SRDILLQGRMYISDAHIGFFSNILGWVSTVFIPFKEIVQIEKKTTAGIFPNGIVIDTL-HTKYIFASFMSRDATFDLITDVWNQIILGKKYRNG 765          
BLAST of VASt domain-containing protein vs. Ensembl Yeast
Match: YFL042C_mRNA (Putative sterol transfer protein; one of six StART-like domain-containing proteins in yeast that may be involved in sterol transfer between intracellular membranes; conserved across eukaryotes; has both GRAM and StART-like (VASt) domains; localizes to membrane contact sites throughout the cell, including nucleus-vacuole junctions and ER-mitochondrial contact sites [Source:SGD;Acc:S000001852])

HSP 1 Score: 67.3958 bits (163), Expect = 3.886e-12
Identity = 39/130 (30.00%), Postives = 71/130 (54.62%), Query Frame = 1
Query:  244 FLENFTKKEPYMLKTYKQRRSDFKKSFKDTNAESSPLISDYSCAIYAGTPKILQQGRMYITTEFLCFYSRFITFEQKITVSYKDIKELTKEKTAMVFQNAIQIVTDNNEKHFFSSFTTRDRAYYVIHKLW 633
            F+E      PY   + +QR  DF ++FK    +   L+ D++C +     ++L QG++YIT   LCF S  + +  K+ ++++D+  + K   A +F +AI I T    K  F+ F +RD A+ ++ ++W
Sbjct:  179 FVEERYMDTPYHYAS-EQRNKDFHETFKSVPKDDR-LLDDFNCGLNR---ELLYQGKLYITETHLCFNSNVLGWIAKVLIAFEDVTFMEKTSAAGLFPSAISIETKMG-KTLFNGFISRDAAFGLMKEVW 302          
BLAST of VASt domain-containing protein vs. Ensembl Yeast
Match: LAM6 (Sterol transporter that transfers sterols between membranes; may regulate and coordinate formation of contact sites between organelles; localizes to ER-mitochondrial contact sites in a Tom70p- and Tom71p-dependent manner; mitochondrial localization requires GRAM domain; also localizes to ER-vacuole contact sites, in a Vac8p-dependent manner; has GRAM and StART-like (VASt) domains; one of six StART-like domain-containing proteins in yeast; conserved across eukaryotes [Source:SGD;Acc:S000004062])

HSP 1 Score: 53.1434 bits (126), Expect = 1.083e-7
Identity = 35/108 (32.41%), Postives = 57/108 (52.78%), Query Frame = 1
Query:  310 FKKSFKDTNAESSPLISDYSCAIYAGTPKILQQGRMYITTEFLCFYSRFITFEQKITVSYKDIKELTKEKTAMVFQNAIQIVTDNNEKHFFSSFTTRDRAYYVIHKLW 633
            F++ FK   A ++ LI+DY C  +   P    QGR+Y++   LCF S  + +  K+ +   +IK L K  T     +AI + T  N ++ FS F  RD  + +I ++W
Sbjct:  166 FRQMFKPL-APNTRLITDYFCYFHREFP---YQGRIYLSNTHLCFNSTVLNWMAKLQIPLNEIKYLDKVTTN---SSAISVETVTN-RYTFSGFIARDEVFQLITRVW 265          
BLAST of VASt domain-containing protein vs. Ensembl Nematostella
Match: EDO45283 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RTK5])

HSP 1 Score: 53.5286 bits (127), Expect = 2.158e-9
Identity = 27/68 (39.71%), Postives = 40/68 (58.82%), Query Frame = 1
Query:  277 MLKTYKQRRSDFKKSFKDTNAESSPLISDYSCAIYAGTPKILQQGRMYITTEFLCFYSRFITFEQKIT 480
            M  +YK +  DF++ FKD   +S  LI DYSCA+      IL  GR+YI+  +LCFY+    +E  ++
Sbjct:    1 MFSSYKSKSGDFRRLFKDL-PDSEQLIVDYSCAL---QRDILVHGRLYISQNWLCFYANIFGWETFVS 64          
BLAST of VASt domain-containing protein vs. Ensembl Nematostella
Match: EDO26770 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7TB47])

HSP 1 Score: 54.6842 bits (130), Expect = 3.269e-8
Identity = 24/55 (43.64%), Postives = 40/55 (72.73%), Query Frame = 1
Query:  472 KITVSYKDIKELTKEKTAMVFQNAIQIVTDNNEKHFFSSFTTRDRAYYVIHKLWM 636
            ++T++  ++  + KEKTA+V  NAIQI T+  EK+FF+SF +RD A+ V+ ++W 
Sbjct:   18 QVTINCSEVISIRKEKTALVIPNAIQISTE-GEKYFFASFISRDTAFTVLFRIWQ 71          
BLAST of VASt domain-containing protein vs. Ensembl Medaka
Match: gramd1bb (GRAM domain containing 1B [Source:NCBI gene;Acc:101169553])

HSP 1 Score: 176.792 bits (447), Expect = 2.169e-46
Identity = 139/474 (29.32%), Postives = 216/474 (45.57%), Query Frame = 1
Query:  286 TYKQRRSDFKKSFKDTNAESSPLISDYSCAIYAGTPKILQQGRMYITTEFLCFYSRFITFEQKITVSYKDIKELTKEKTAMVFQNAIQIVTDNNEKHFFSSFTTRDRAYYVIHKLWMESKDGIKLSNAAFWDRVRENYGNDLGFLLEDVEY----DESNATQFTARYKIPRRPSEIMSNTSSPDDSLYESLEESPVSDNVIDYSL--CNGHNLKSENFDKKPPSIPEEEIKFDLSFRNSTQXXXXXXXXXXXXXXXXXXXSSRPAAICSDHEHLPNMLLD------------------------EEFSINVHTLWTFIFTDNAFFRALCAMRFITEITQSNWSDDVDREKCRTIYYTVNLKNRIGPKKSPTVEKQVLLEGSCKDYIYYVESIVRTVGIPMSDSFHIVLRYCLLYINPNKSRIKISMKIVYDKTVFFATKSIIDSSVKSGCIDYHKDLKQALLIESQKINDVLTE 1617
            TYKQR  DF+K FK    ++  LI DYSCA+      IL QGR+Y++  ++CFYS    +E  +TV  KDI  +TKEKTA +  NAIQ+ TD  EKHFF+SF  RDR Y ++ +LW  +     L     W  V + YGN+LG   +D +Y    D+ N   F+             + T S  ++  E     P+   VI  S     G+N     FD     +P EE  F     +   +      EE +     +     P+   +D+E +P  L D                        E + I+V  L+  +F  + F       R  +++    W  D    + R I YT++L N + PK +   E Q L + S +   Y +++ V T  +P  D F+ + RY L  +  NK R++IS ++ + K  +   K +I+ +  SG  +  + L+    +E  K+ +V+ E
Sbjct:   58 TYKQRNEDFRKLFKQL-PDTERLIVDYSCALQR---DILLQGRLYLSENWICFYSNIFRWETLLTVRLKDICSMTKEKTARLIPNAIQVCTD-TEKHFFTSFGARDRTYMMMFRLWQNALLDKPLCPKELWHFVHQCYGNELGLTSDDEDYVPPDDDFNTMGFSEEIPNEENEINNDNLTKSSAEAKPEG-SPPPLLKKVIPNSAIPSPGNNDTPITFD-----LPVEE--FTDCLADGELLTVPLLEEEKKETSGPEGPVPSPSLDLNDNEDIPTELSDSSETHDEGEVQAFHDDLNGRQHINEVYRISVDKLYDILFNKSQFMSDFMEQRRFSDVVYHPWKKDEGGHQTREIMYTISLSNPLAPKTAAVTETQTLYKASQESECYIIDAEVITHDVPYHDYFYTLNRYMLTRVAKNKCRLRISTELRFRKQPWGLVKGLIEKNFWSGLEENFRHLE----MELAKLEEVMNE 514          
BLAST of VASt domain-containing protein vs. Ensembl Medaka
Match: gramd1bb (GRAM domain containing 1B [Source:NCBI gene;Acc:101169553])

HSP 1 Score: 177.178 bits (448), Expect = 2.173e-46
Identity = 139/474 (29.32%), Postives = 216/474 (45.57%), Query Frame = 1
Query:  286 TYKQRRSDFKKSFKDTNAESSPLISDYSCAIYAGTPKILQQGRMYITTEFLCFYSRFITFEQKITVSYKDIKELTKEKTAMVFQNAIQIVTDNNEKHFFSSFTTRDRAYYVIHKLWMESKDGIKLSNAAFWDRVRENYGNDLGFLLEDVEY----DESNATQFTARYKIPRRPSEIMSNTSSPDDSLYESLEESPVSDNVIDYSL--CNGHNLKSENFDKKPPSIPEEEIKFDLSFRNSTQXXXXXXXXXXXXXXXXXXXSSRPAAICSDHEHLPNMLLD------------------------EEFSINVHTLWTFIFTDNAFFRALCAMRFITEITQSNWSDDVDREKCRTIYYTVNLKNRIGPKKSPTVEKQVLLEGSCKDYIYYVESIVRTVGIPMSDSFHIVLRYCLLYINPNKSRIKISMKIVYDKTVFFATKSIIDSSVKSGCIDYHKDLKQALLIESQKINDVLTE 1617
            TYKQR  DF+K FK    ++  LI DYSCA+      IL QGR+Y++  ++CFYS    +E  +TV  KDI  +TKEKTA +  NAIQ+ TD  EKHFF+SF  RDR Y ++ +LW  +     L     W  V + YGN+LG   +D +Y    D+ N   F+             + T S  ++  E     P+   VI  S     G+N     FD     +P EE  F     +   +      EE +     +     P+   +D+E +P  L D                        E + I+V  L+  +F  + F       R  +++    W  D    + R I YT++L N + PK +   E Q L + S +   Y +++ V T  +P  D F+ + RY L  +  NK R++IS ++ + K  +   K +I+ +  SG  +  + L+    +E  K+ +V+ E
Sbjct:   90 TYKQRNEDFRKLFKQL-PDTERLIVDYSCALQR---DILLQGRLYLSENWICFYSNIFRWETLLTVRLKDICSMTKEKTARLIPNAIQVCTD-TEKHFFTSFGARDRTYMMMFRLWQNALLDKPLCPKELWHFVHQCYGNELGLTSDDEDYVPPDDDFNTMGFSEEIPNEENEINNDNLTKSSAEAKPEG-SPPPLLKKVIPNSAIPSPGNNDTPITFD-----LPVEE--FTDCLADGELLTVPLLEEEKKETSGPEGPVPSPSLDLNDNEDIPTELSDSSETHDEGEVQAFHDDLNGRQHINEVYRISVDKLYDILFNKSQFMSDFMEQRRFSDVVYHPWKKDEGGHQTREIMYTISLSNPLAPKTAAVTETQTLYKASQESECYIIDAEVITHDVPYHDYFYTLNRYMLTRVAKNKCRLRISTELRFRKQPWGLVKGLIEKNFWSGLEENFRHLE----MELAKLEEVMNE 546          
BLAST of VASt domain-containing protein vs. Ensembl Medaka
Match: gramd1bb (GRAM domain containing 1B [Source:NCBI gene;Acc:101169553])

HSP 1 Score: 176.792 bits (447), Expect = 2.214e-46
Identity = 139/474 (29.32%), Postives = 216/474 (45.57%), Query Frame = 1
Query:  286 TYKQRRSDFKKSFKDTNAESSPLISDYSCAIYAGTPKILQQGRMYITTEFLCFYSRFITFEQKITVSYKDIKELTKEKTAMVFQNAIQIVTDNNEKHFFSSFTTRDRAYYVIHKLWMESKDGIKLSNAAFWDRVRENYGNDLGFLLEDVEY----DESNATQFTARYKIPRRPSEIMSNTSSPDDSLYESLEESPVSDNVIDYSL--CNGHNLKSENFDKKPPSIPEEEIKFDLSFRNSTQXXXXXXXXXXXXXXXXXXXSSRPAAICSDHEHLPNMLLD------------------------EEFSINVHTLWTFIFTDNAFFRALCAMRFITEITQSNWSDDVDREKCRTIYYTVNLKNRIGPKKSPTVEKQVLLEGSCKDYIYYVESIVRTVGIPMSDSFHIVLRYCLLYINPNKSRIKISMKIVYDKTVFFATKSIIDSSVKSGCIDYHKDLKQALLIESQKINDVLTE 1617
            TYKQR  DF+K FK    ++  LI DYSCA+      IL QGR+Y++  ++CFYS    +E  +TV  KDI  +TKEKTA +  NAIQ+ TD  EKHFF+SF  RDR Y ++ +LW  +     L     W  V + YGN+LG   +D +Y    D+ N   F+             + T S  ++  E     P+   VI  S     G+N     FD     +P EE  F     +   +      EE +     +     P+   +D+E +P  L D                        E + I+V  L+  +F  + F       R  +++    W  D    + R I YT++L N + PK +   E Q L + S +   Y +++ V T  +P  D F+ + RY L  +  NK R++IS ++ + K  +   K +I+ +  SG  +  + L+    +E  K+ +V+ E
Sbjct:   65 TYKQRNEDFRKLFKQL-PDTERLIVDYSCALQR---DILLQGRLYLSENWICFYSNIFRWETLLTVRLKDICSMTKEKTARLIPNAIQVCTD-TEKHFFTSFGARDRTYMMMFRLWQNALLDKPLCPKELWHFVHQCYGNELGLTSDDEDYVPPDDDFNTMGFSEEIPNEENEINNDNLTKSSAEAKPEG-SPPPLLKKVIPNSAIPSPGNNDTPITFD-----LPVEE--FTDCLADGELLTVPLLEEEKKETSGPEGPVPSPSLDLNDNEDIPTELSDSSETHDEGEVQAFHDDLNGRQHINEVYRISVDKLYDILFNKSQFMSDFMEQRRFSDVVYHPWKKDEGGHQTREIMYTISLSNPLAPKTAAVTETQTLYKASQESECYIIDAEVITHDVPYHDYFYTLNRYMLTRVAKNKCRLRISTELRFRKQPWGLVKGLIEKNFWSGLEENFRHLE----MELAKLEEVMNE 521          
BLAST of VASt domain-containing protein vs. Ensembl Medaka
Match: gramd1bb (GRAM domain containing 1B [Source:NCBI gene;Acc:101169553])

HSP 1 Score: 176.792 bits (447), Expect = 2.640e-46
Identity = 139/474 (29.32%), Postives = 216/474 (45.57%), Query Frame = 1
Query:  286 TYKQRRSDFKKSFKDTNAESSPLISDYSCAIYAGTPKILQQGRMYITTEFLCFYSRFITFEQKITVSYKDIKELTKEKTAMVFQNAIQIVTDNNEKHFFSSFTTRDRAYYVIHKLWMESKDGIKLSNAAFWDRVRENYGNDLGFLLEDVEY----DESNATQFTARYKIPRRPSEIMSNTSSPDDSLYESLEESPVSDNVIDYSL--CNGHNLKSENFDKKPPSIPEEEIKFDLSFRNSTQXXXXXXXXXXXXXXXXXXXSSRPAAICSDHEHLPNMLLD------------------------EEFSINVHTLWTFIFTDNAFFRALCAMRFITEITQSNWSDDVDREKCRTIYYTVNLKNRIGPKKSPTVEKQVLLEGSCKDYIYYVESIVRTVGIPMSDSFHIVLRYCLLYINPNKSRIKISMKIVYDKTVFFATKSIIDSSVKSGCIDYHKDLKQALLIESQKINDVLTE 1617
            TYKQR  DF+K FK    ++  LI DYSCA+      IL QGR+Y++  ++CFYS    +E  +TV  KDI  +TKEKTA +  NAIQ+ TD  EKHFF+SF  RDR Y ++ +LW  +     L     W  V + YGN+LG   +D +Y    D+ N   F+             + T S  ++  E     P+   VI  S     G+N     FD     +P EE  F     +   +      EE +     +     P+   +D+E +P  L D                        E + I+V  L+  +F  + F       R  +++    W  D    + R I YT++L N + PK +   E Q L + S +   Y +++ V T  +P  D F+ + RY L  +  NK R++IS ++ + K  +   K +I+ +  SG  +  + L+    +E  K+ +V+ E
Sbjct:   94 TYKQRNEDFRKLFKQL-PDTERLIVDYSCALQR---DILLQGRLYLSENWICFYSNIFRWETLLTVRLKDICSMTKEKTARLIPNAIQVCTD-TEKHFFTSFGARDRTYMMMFRLWQNALLDKPLCPKELWHFVHQCYGNELGLTSDDEDYVPPDDDFNTMGFSEEIPNEENEINNDNLTKSSAEAKPEG-SPPPLLKKVIPNSAIPSPGNNDTPITFD-----LPVEE--FTDCLADGELLTVPLLEEEKKETSGPEGPVPSPSLDLNDNEDIPTELSDSSETHDEGEVQAFHDDLNGRQHINEVYRISVDKLYDILFNKSQFMSDFMEQRRFSDVVYHPWKKDEGGHQTREIMYTISLSNPLAPKTAAVTETQTLYKASQESECYIIDAEVITHDVPYHDYFYTLNRYMLTRVAKNKCRLRISTELRFRKQPWGLVKGLIEKNFWSGLEENFRHLE----MELAKLEEVMNE 550          
BLAST of VASt domain-containing protein vs. Ensembl Medaka
Match: gramd1bb (GRAM domain containing 1B [Source:NCBI gene;Acc:101169553])

HSP 1 Score: 176.792 bits (447), Expect = 3.418e-46
Identity = 139/474 (29.32%), Postives = 216/474 (45.57%), Query Frame = 1
Query:  286 TYKQRRSDFKKSFKDTNAESSPLISDYSCAIYAGTPKILQQGRMYITTEFLCFYSRFITFEQKITVSYKDIKELTKEKTAMVFQNAIQIVTDNNEKHFFSSFTTRDRAYYVIHKLWMESKDGIKLSNAAFWDRVRENYGNDLGFLLEDVEY----DESNATQFTARYKIPRRPSEIMSNTSSPDDSLYESLEESPVSDNVIDYSL--CNGHNLKSENFDKKPPSIPEEEIKFDLSFRNSTQXXXXXXXXXXXXXXXXXXXSSRPAAICSDHEHLPNMLLD------------------------EEFSINVHTLWTFIFTDNAFFRALCAMRFITEITQSNWSDDVDREKCRTIYYTVNLKNRIGPKKSPTVEKQVLLEGSCKDYIYYVESIVRTVGIPMSDSFHIVLRYCLLYINPNKSRIKISMKIVYDKTVFFATKSIIDSSVKSGCIDYHKDLKQALLIESQKINDVLTE 1617
            TYKQR  DF+K FK    ++  LI DYSCA+      IL QGR+Y++  ++CFYS    +E  +TV  KDI  +TKEKTA +  NAIQ+ TD  EKHFF+SF  RDR Y ++ +LW  +     L     W  V + YGN+LG   +D +Y    D+ N   F+             + T S  ++  E     P+   VI  S     G+N     FD     +P EE  F     +   +      EE +     +     P+   +D+E +P  L D                        E + I+V  L+  +F  + F       R  +++    W  D    + R I YT++L N + PK +   E Q L + S +   Y +++ V T  +P  D F+ + RY L  +  NK R++IS ++ + K  +   K +I+ +  SG  +  + L+    +E  K+ +V+ E
Sbjct:  128 TYKQRNEDFRKLFKQL-PDTERLIVDYSCALQR---DILLQGRLYLSENWICFYSNIFRWETLLTVRLKDICSMTKEKTARLIPNAIQVCTD-TEKHFFTSFGARDRTYMMMFRLWQNALLDKPLCPKELWHFVHQCYGNELGLTSDDEDYVPPDDDFNTMGFSEEIPNEENEINNDNLTKSSAEAKPEG-SPPPLLKKVIPNSAIPSPGNNDTPITFD-----LPVEE--FTDCLADGELLTVPLLEEEKKETSGPEGPVPSPSLDLNDNEDIPTELSDSSETHDEGEVQAFHDDLNGRQHINEVYRISVDKLYDILFNKSQFMSDFMEQRRFSDVVYHPWKKDEGGHQTREIMYTISLSNPLAPKTAAVTETQTLYKASQESECYIIDAEVITHDVPYHDYFYTLNRYMLTRVAKNKCRLRISTELRFRKQPWGLVKGLIEKNFWSGLEENFRHLE----MELAKLEEVMNE 584          
BLAST of VASt domain-containing protein vs. Planmine SMEST
Match: SMESG000033356.1 (SMESG000033356.1)

HSP 1 Score: 1142.87 bits (2955), Expect = 0.000e+0
Identity = 589/592 (99.49%), Postives = 591/592 (99.83%), Query Frame = 1
Query:  205 MSAQENVQKMKNYFLENFTKKEPYMLKTYKQRRSDFKKSFKDTNAESSPLISDYSCAIYAGTPKILQQGRMYITTEFLCFYSRFITFEQKITVSYKDIKELTKEKTAMVFQNAIQIVTDNNEKHFFSSFTTRDRAYYVIHKLWMESKDGIKLSNAAFWDRVRENYGNDLGFLLEDVEYDESNATQFTARYKIPRRPSEIMSNTSSPDDSLYESLEESPVSDNVIDYSLCNGHNLKSENFDKKPPSIPEEEIKFDLSFRNSTQXXXXXXXXXXXXXXXXXXXSSRPAAICSDHEHLPNMLLDEEFSINVHTLWTFIFTDNAFFRALCAMRFITEITQSNWSDDVDREKCRTIYYTVNLKNRIGPKKSPTVEKQVLLEGSCKDYIYYVESIVRTVGIPMSDSFHIVLRYCLLYINPNKSRIKISMKIVYDKTVFFATKSIIDSSVKSGCIDYHKDLKQALLIESQKINDVLTEQKSYCTQSSIEESYQKVDTNENISIVSALHNSQSETKISWIMMVIICCISFFMLYLIKEMYSDSSAFMELSDHNERSSQREFDQDSLXXXXXXXXXXXXXXDVLKVNIEMLNRSQNCSENS 1980
            MSAQENVQKMKNYFLENFTKKEPYMLKTYKQRRSDFKKSFKDTNAESSPLISDYSCAIYAGTPKILQQGRMYITTEFLCFYSRFITFEQKITVSYKDIKELTKEKTAMVFQNAIQIVTDNNEKHFFSSFTTRDRAYYVIHKLWME+KDGIKLSNAAFWDRVRENYGNDLGFLLEDVEYDESNATQFTARYKIPRRPSEIMSNTSSPDDSLYESLEESPVSDNVIDYSLCNGHNLKSENFDKKPPSIPEEEIKFDLSFRNSTQIPESNNIE NEIIPVEDIISSRPAAIC+DHEHLPNMLLDEEFSINVHTLWTFIFTDNAFFRALCAMRFITEITQSNWSDDVDREKCRTIYYTVNLKNRIGPKKSPTVEKQVLLEGSCKDYIYYVESIVRTVGIPMSDSFHIVLRYCLLYINPNKSRIKISMKIVYDKTVFFATKSIIDSSVKSGCIDYHKDLKQALLIESQKINDVLTEQKSYCTQSSIEESYQKVDTNENISIVSALHNSQSETKISWIMMVIICCISFFMLYLIKEMYSDSSAFMELSDHNERSSQREFDQDSLTEIMKIIKEMKTTIDVLKVNIEMLNRSQNCSENS
Sbjct:    1 MSAQENVQKMKNYFLENFTKKEPYMLKTYKQRRSDFKKSFKDTNAESSPLISDYSCAIYAGTPKILQQGRMYITTEFLCFYSRFITFEQKITVSYKDIKELTKEKTAMVFQNAIQIVTDNNEKHFFSSFTTRDRAYYVIHKLWMENKDGIKLSNAAFWDRVRENYGNDLGFLLEDVEYDESNATQFTARYKIPRRPSEIMSNTSSPDDSLYESLEESPVSDNVIDYSLCNGHNLKSENFDKKPPSIPEEEIKFDLSFRNSTQIPESNNIEVNEIIPVEDIISSRPAAICADHEHLPNMLLDEEFSINVHTLWTFIFTDNAFFRALCAMRFITEITQSNWSDDVDREKCRTIYYTVNLKNRIGPKKSPTVEKQVLLEGSCKDYIYYVESIVRTVGIPMSDSFHIVLRYCLLYINPNKSRIKISMKIVYDKTVFFATKSIIDSSVKSGCIDYHKDLKQALLIESQKINDVLTEQKSYCTQSSIEESYQKVDTNENISIVSALHNSQSETKISWIMMVIICCISFFMLYLIKEMYSDSSAFMELSDHNERSSQREFDQDSLTEIMKIIKEMKTTIDVLKVNIEMLNRSQNCSENS 592          
BLAST of VASt domain-containing protein vs. Planmine SMEST
Match: SMESG000033356.1 (SMESG000033356.1)

HSP 1 Score: 1122.84 bits (2903), Expect = 0.000e+0
Identity = 580/583 (99.49%), Postives = 582/583 (99.83%), Query Frame = 1
Query:  232 MKNYFLENFTKKEPYMLKTYKQRRSDFKKSFKDTNAESSPLISDYSCAIYAGTPKILQQGRMYITTEFLCFYSRFITFEQKITVSYKDIKELTKEKTAMVFQNAIQIVTDNNEKHFFSSFTTRDRAYYVIHKLWMESKDGIKLSNAAFWDRVRENYGNDLGFLLEDVEYDESNATQFTARYKIPRRPSEIMSNTSSPDDSLYESLEESPVSDNVIDYSLCNGHNLKSENFDKKPPSIPEEEIKFDLSFRNSTQXXXXXXXXXXXXXXXXXXXSSRPAAICSDHEHLPNMLLDEEFSINVHTLWTFIFTDNAFFRALCAMRFITEITQSNWSDDVDREKCRTIYYTVNLKNRIGPKKSPTVEKQVLLEGSCKDYIYYVESIVRTVGIPMSDSFHIVLRYCLLYINPNKSRIKISMKIVYDKTVFFATKSIIDSSVKSGCIDYHKDLKQALLIESQKINDVLTEQKSYCTQSSIEESYQKVDTNENISIVSALHNSQSETKISWIMMVIICCISFFMLYLIKEMYSDSSAFMELSDHNERSSQREFDQDSLXXXXXXXXXXXXXXDVLKVNIEMLNRSQNCSENS 1980
            MKNYFLENFTKKEPYMLKTYKQRRSDFKKSFKDTNAESSPLISDYSCAIYAGTPKILQQGRMYITTEFLCFYSRFITFEQKITVSYKDIKELTKEKTAMVFQNAIQIVTDNNEKHFFSSFTTRDRAYYVIHKLWME+KDGIKLSNAAFWDRVRENYGNDLGFLLEDVEYDESNATQFTARYKIPRRPSEIMSNTSSPDDSLYESLEESPVSDNVIDYSLCNGHNLKSENFDKKPPSIPEEEIKFDLSFRNSTQIPESNNIE NEIIPVEDIISSRPAAIC+DHEHLPNMLLDEEFSINVHTLWTFIFTDNAFFRALCAMRFITEITQSNWSDDVDREKCRTIYYTVNLKNRIGPKKSPTVEKQVLLEGSCKDYIYYVESIVRTVGIPMSDSFHIVLRYCLLYINPNKSRIKISMKIVYDKTVFFATKSIIDSSVKSGCIDYHKDLKQALLIESQKINDVLTEQKSYCTQSSIEESYQKVDTNENISIVSALHNSQSETKISWIMMVIICCISFFMLYLIKEMYSDSSAFMELSDHNERSSQREFDQDSLTEIMKIIKEMKTTIDVLKVNIEMLNRSQNCSENS
Sbjct:    1 MKNYFLENFTKKEPYMLKTYKQRRSDFKKSFKDTNAESSPLISDYSCAIYAGTPKILQQGRMYITTEFLCFYSRFITFEQKITVSYKDIKELTKEKTAMVFQNAIQIVTDNNEKHFFSSFTTRDRAYYVIHKLWMENKDGIKLSNAAFWDRVRENYGNDLGFLLEDVEYDESNATQFTARYKIPRRPSEIMSNTSSPDDSLYESLEESPVSDNVIDYSLCNGHNLKSENFDKKPPSIPEEEIKFDLSFRNSTQIPESNNIEVNEIIPVEDIISSRPAAICADHEHLPNMLLDEEFSINVHTLWTFIFTDNAFFRALCAMRFITEITQSNWSDDVDREKCRTIYYTVNLKNRIGPKKSPTVEKQVLLEGSCKDYIYYVESIVRTVGIPMSDSFHIVLRYCLLYINPNKSRIKISMKIVYDKTVFFATKSIIDSSVKSGCIDYHKDLKQALLIESQKINDVLTEQKSYCTQSSIEESYQKVDTNENISIVSALHNSQSETKISWIMMVIICCISFFMLYLIKEMYSDSSAFMELSDHNERSSQREFDQDSLTEIMKIIKEMKTTIDVLKVNIEMLNRSQNCSENS 583          
BLAST of VASt domain-containing protein vs. Planmine SMEST
Match: SMESG000033356.1 (SMESG000033356.1)

HSP 1 Score: 1118.22 bits (2891), Expect = 0.000e+0
Identity = 570/583 (97.77%), Postives = 573/583 (98.28%), Query Frame = 1
Query:  232 MKNYFLENFTKKEPYMLKTYKQRRSDFKKSFKDTNAESSPLISDYSCAIYAGTPKILQQGRMYITTEFLCFYSRFITFEQKITVSYKDIKELTKEKTAMVFQNAIQIVTDNNEKHFFSSFTTRDRAYYVIHKLWMESKDGIKLSNAAFWDRVRENYGNDLGFLLEDVEYDESNATQFTARYKIPRRPSEIMSNTSSPDDSLYESLEESPVSDNVIDYSLCNGHNLKSENFDKKPPSIPEEEIKFDLSFRNSTQXXXXXXXXXXXXXXXXXXXSSRPAAICSDHEHLPNMLLDEEFSINVHTLWTFIFTDNAFFRALCAMRFITEITQSNWSDDVDREKCRTIYYTVNLKNRIGPKKSPTVEKQVLLEGSCKDYIYYVESIVRTVGIPMSDSFHIVLRYCLLYINPNKSRIKISMKIVYDKTVFFATKSIIDSSVKSGCIDYHKDLKQALLIESQKINDVLTEQKSYCTQSSIEESYQKVDTNENISIVSALHNSQSETKISWIMMVIICCISFFMLYLIKEMYSDSSAFMELSDHNERSSQREFDQDSLXXXXXXXXXXXXXXDVLKVNIEMLNRSQNCSENS 1980
            MKNYFLENFTKKEPYMLKTYKQRRSDFKKSFKDTNAESSPLISDYSCAIYAGTPKILQQGRMYITTEFLCFYSRFITFEQKITVSYKDIKELTKEKTAMVFQNAIQIVTDNNEKHFFSSFTTRDRAYYVIHKLWME+KDGIKLSNAAFWDRVRENYGNDLGFLLEDVEYDESNATQFTARYKIPRRPSEIMSNTSSPDDSLYESLEESPVSDNVIDYSLCNGHNLKSENFDKKPPSIPEEEIKFDLSFRNSTQIPESNNIE      +    SSRPAAIC+DHEHLPNMLLDEEFSINVHTLWTFIFTDNAFFRALCAMRFITEITQSNWSDDVDREKCRTIYYTVNLKNRIGPKKSPTVEKQVLLEGSCKDYIYYVESIVRTVGIPMSDSFHIVLRYCLLYINPNKSRIKISMKIVYDKTVFFATKSIIDSSVKSGCIDYHKDLKQALLIESQKINDVLTEQKSYCTQSSIEESYQKVDTNENISIVSALHNSQSETKISWIMMVIICCISFFMLYLIKEMYSDSSAFMELSDHNERSSQREFDQDSLTEIMKIIKEMKTTIDVLKVNIEMLNRSQNCSENS
Sbjct:    1 MKNYFLENFTKKEPYMLKTYKQRRSDFKKSFKDTNAESSPLISDYSCAIYAGTPKILQQGRMYITTEFLCFYSRFITFEQKITVSYKDIKELTKEKTAMVFQNAIQIVTDNNEKHFFSSFTTRDRAYYVIHKLWMENKDGIKLSNAAFWDRVRENYGNDLGFLLEDVEYDESNATQFTARYKIPRRPSEIMSNTSSPDDSLYESLEESPVSDNVIDYSLCNGHNLKSENFDKKPPSIPEEEIKFDLSFRNSTQIPESNNIEIPVEDII----SSRPAAICADHEHLPNMLLDEEFSINVHTLWTFIFTDNAFFRALCAMRFITEITQSNWSDDVDREKCRTIYYTVNLKNRIGPKKSPTVEKQVLLEGSCKDYIYYVESIVRTVGIPMSDSFHIVLRYCLLYINPNKSRIKISMKIVYDKTVFFATKSIIDSSVKSGCIDYHKDLKQALLIESQKINDVLTEQKSYCTQSSIEESYQKVDTNENISIVSALHNSQSETKISWIMMVIICCISFFMLYLIKEMYSDSSAFMELSDHNERSSQREFDQDSLTEIMKIIKEMKTTIDVLKVNIEMLNRSQNCSENS 579          
BLAST of VASt domain-containing protein vs. Planmine SMEST
Match: SMESG000033356.1 (SMESG000033356.1)

HSP 1 Score: 1094.34 bits (2829), Expect = 0.000e+0
Identity = 558/571 (97.72%), Postives = 561/571 (98.25%), Query Frame = 1
Query:  268 EPYMLKTYKQRRSDFKKSFKDTNAESSPLISDYSCAIYAGTPKILQQGRMYITTEFLCFYSRFITFEQKITVSYKDIKELTKEKTAMVFQNAIQIVTDNNEKHFFSSFTTRDRAYYVIHKLWMESKDGIKLSNAAFWDRVRENYGNDLGFLLEDVEYDESNATQFTARYKIPRRPSEIMSNTSSPDDSLYESLEESPVSDNVIDYSLCNGHNLKSENFDKKPPSIPEEEIKFDLSFRNSTQXXXXXXXXXXXXXXXXXXXSSRPAAICSDHEHLPNMLLDEEFSINVHTLWTFIFTDNAFFRALCAMRFITEITQSNWSDDVDREKCRTIYYTVNLKNRIGPKKSPTVEKQVLLEGSCKDYIYYVESIVRTVGIPMSDSFHIVLRYCLLYINPNKSRIKISMKIVYDKTVFFATKSIIDSSVKSGCIDYHKDLKQALLIESQKINDVLTEQKSYCTQSSIEESYQKVDTNENISIVSALHNSQSETKISWIMMVIICCISFFMLYLIKEMYSDSSAFMELSDHNERSSQREFDQDSLXXXXXXXXXXXXXXDVLKVNIEMLNRSQNCSENS 1980
            EPYMLKTYKQRRSDFKKSFKDTNAESSPLISDYSCAIYAGTPKILQQGRMYITTEFLCFYSRFITFEQKITVSYKDIKELTKEKTAMVFQNAIQIVTDNNEKHFFSSFTTRDRAYYVIHKLWME+KDGIKLSNAAFWDRVRENYGNDLGFLLEDVEYDESNATQFTARYKIPRRPSEIMSNTSSPDDSLYESLEESPVSDNVIDYSLCNGHNLKSENFDKKPPSIPEEEIKFDLSFRNSTQIPESNNIE      +    SSRPAAIC+DHEHLPNMLLDEEFSINVHTLWTFIFTDNAFFRALCAMRFITEITQSNWSDDVDREKCRTIYYTVNLKNRIGPKKSPTVEKQVLLEGSCKDYIYYVESIVRTVGIPMSDSFHIVLRYCLLYINPNKSRIKISMKIVYDKTVFFATKSIIDSSVKSGCIDYHKDLKQALLIESQKINDVLTEQKSYCTQSSIEESYQKVDTNENISIVSALHNSQSETKISWIMMVIICCISFFMLYLIKEMYSDSSAFMELSDHNERSSQREFDQDSLTEIMKIIKEMKTTIDVLKVNIEMLNRSQNCSENS
Sbjct:    4 EPYMLKTYKQRRSDFKKSFKDTNAESSPLISDYSCAIYAGTPKILQQGRMYITTEFLCFYSRFITFEQKITVSYKDIKELTKEKTAMVFQNAIQIVTDNNEKHFFSSFTTRDRAYYVIHKLWMENKDGIKLSNAAFWDRVRENYGNDLGFLLEDVEYDESNATQFTARYKIPRRPSEIMSNTSSPDDSLYESLEESPVSDNVIDYSLCNGHNLKSENFDKKPPSIPEEEIKFDLSFRNSTQIPESNNIEIPVEDII----SSRPAAICADHEHLPNMLLDEEFSINVHTLWTFIFTDNAFFRALCAMRFITEITQSNWSDDVDREKCRTIYYTVNLKNRIGPKKSPTVEKQVLLEGSCKDYIYYVESIVRTVGIPMSDSFHIVLRYCLLYINPNKSRIKISMKIVYDKTVFFATKSIIDSSVKSGCIDYHKDLKQALLIESQKINDVLTEQKSYCTQSSIEESYQKVDTNENISIVSALHNSQSETKISWIMMVIICCISFFMLYLIKEMYSDSSAFMELSDHNERSSQREFDQDSLTEIMKIIKEMKTTIDVLKVNIEMLNRSQNCSENS 570          
BLAST of VASt domain-containing protein vs. Planmine SMEST
Match: SMESG000033356.1 (SMESG000033356.1)

HSP 1 Score: 1087.02 bits (2810), Expect = 0.000e+0
Identity = 555/568 (97.71%), Postives = 558/568 (98.24%), Query Frame = 1
Query:  277 MLKTYKQRRSDFKKSFKDTNAESSPLISDYSCAIYAGTPKILQQGRMYITTEFLCFYSRFITFEQKITVSYKDIKELTKEKTAMVFQNAIQIVTDNNEKHFFSSFTTRDRAYYVIHKLWMESKDGIKLSNAAFWDRVRENYGNDLGFLLEDVEYDESNATQFTARYKIPRRPSEIMSNTSSPDDSLYESLEESPVSDNVIDYSLCNGHNLKSENFDKKPPSIPEEEIKFDLSFRNSTQXXXXXXXXXXXXXXXXXXXSSRPAAICSDHEHLPNMLLDEEFSINVHTLWTFIFTDNAFFRALCAMRFITEITQSNWSDDVDREKCRTIYYTVNLKNRIGPKKSPTVEKQVLLEGSCKDYIYYVESIVRTVGIPMSDSFHIVLRYCLLYINPNKSRIKISMKIVYDKTVFFATKSIIDSSVKSGCIDYHKDLKQALLIESQKINDVLTEQKSYCTQSSIEESYQKVDTNENISIVSALHNSQSETKISWIMMVIICCISFFMLYLIKEMYSDSSAFMELSDHNERSSQREFDQDSLXXXXXXXXXXXXXXDVLKVNIEMLNRSQNCSENS 1980
            MLKTYKQRRSDFKKSFKDTNAESSPLISDYSCAIYAGTPKILQQGRMYITTEFLCFYSRFITFEQKITVSYKDIKELTKEKTAMVFQNAIQIVTDNNEKHFFSSFTTRDRAYYVIHKLWME+KDGIKLSNAAFWDRVRENYGNDLGFLLEDVEYDESNATQFTARYKIPRRPSEIMSNTSSPDDSLYESLEESPVSDNVIDYSLCNGHNLKSENFDKKPPSIPEEEIKFDLSFRNSTQIPESNNIE      +    SSRPAAIC+DHEHLPNMLLDEEFSINVHTLWTFIFTDNAFFRALCAMRFITEITQSNWSDDVDREKCRTIYYTVNLKNRIGPKKSPTVEKQVLLEGSCKDYIYYVESIVRTVGIPMSDSFHIVLRYCLLYINPNKSRIKISMKIVYDKTVFFATKSIIDSSVKSGCIDYHKDLKQALLIESQKINDVLTEQKSYCTQSSIEESYQKVDTNENISIVSALHNSQSETKISWIMMVIICCISFFMLYLIKEMYSDSSAFMELSDHNERSSQREFDQDSLTEIMKIIKEMKTTIDVLKVNIEMLNRSQNCSENS
Sbjct:    1 MLKTYKQRRSDFKKSFKDTNAESSPLISDYSCAIYAGTPKILQQGRMYITTEFLCFYSRFITFEQKITVSYKDIKELTKEKTAMVFQNAIQIVTDNNEKHFFSSFTTRDRAYYVIHKLWMENKDGIKLSNAAFWDRVRENYGNDLGFLLEDVEYDESNATQFTARYKIPRRPSEIMSNTSSPDDSLYESLEESPVSDNVIDYSLCNGHNLKSENFDKKPPSIPEEEIKFDLSFRNSTQIPESNNIEIPVEDII----SSRPAAICADHEHLPNMLLDEEFSINVHTLWTFIFTDNAFFRALCAMRFITEITQSNWSDDVDREKCRTIYYTVNLKNRIGPKKSPTVEKQVLLEGSCKDYIYYVESIVRTVGIPMSDSFHIVLRYCLLYINPNKSRIKISMKIVYDKTVFFATKSIIDSSVKSGCIDYHKDLKQALLIESQKINDVLTEQKSYCTQSSIEESYQKVDTNENISIVSALHNSQSETKISWIMMVIICCISFFMLYLIKEMYSDSSAFMELSDHNERSSQREFDQDSLTEIMKIIKEMKTTIDVLKVNIEMLNRSQNCSENS 564          
The following BLAST results are available for this feature:
BLAST of VASt domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
GRAMD1B1.693e-5031.30GRAM domain containing 1B [Source:HGNC Symbol;Acc:... [more]
GRAMD1B2.396e-5031.30GRAM domain containing 1B [Source:HGNC Symbol;Acc:... [more]
GRAMD1B2.847e-5031.30GRAM domain containing 1B [Source:HGNC Symbol;Acc:... [more]
GRAMD1B3.167e-5031.30GRAM domain containing 1B [Source:HGNC Symbol;Acc:... [more]
GRAMD1B3.519e-5031.30GRAM domain containing 1B [Source:HGNC Symbol;Acc:... [more]
back to top
BLAST of VASt domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ZC328.31.901e-1928.90pep chromosome:WBcel235:I:6409050:6412249:-1 gene:... [more]
ZC328.36.817e-1928.90pep chromosome:WBcel235:I:6409050:6417010:-1 gene:... [more]
back to top
BLAST of VASt domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
GramD1B7.138e-2737.33gene:FBgn0085423 transcript:FBtr0112639[more]
GramD1B7.716e-2737.33gene:FBgn0085423 transcript:FBtr0306333[more]
GramD1B8.050e-2737.33gene:FBgn0085423 transcript:FBtr0112638[more]
GramD1B1.006e-2637.33gene:FBgn0085423 transcript:FBtr0112641[more]
GramD1B1.137e-2637.33gene:FBgn0085423 transcript:FBtr0332409[more]
back to top
BLAST of VASt domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
AL953903.46.086e-4829.65GRAM domain containing 1Ba [Source:NCBI gene;Acc:5... [more]
AL953903.47.836e-4829.65GRAM domain containing 1Ba [Source:NCBI gene;Acc:5... [more]
gramd1ba9.729e-4829.58GRAM domain containing 1Ba [Source:ZFIN;Acc:ZDB-GE... [more]
gramd1ba1.010e-4729.58GRAM domain containing 1Ba [Source:ZFIN;Acc:ZDB-GE... [more]
gramd1ba1.076e-4729.58GRAM domain containing 1Ba [Source:ZFIN;Acc:ZDB-GE... [more]
back to top
BLAST of VASt domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gramd1c7.134e-4828.54GRAM domain containing 1C [Source:NCBI gene;Acc:10... [more]
gramd1c7.627e-4829.42GRAM domain containing 1C [Source:NCBI gene;Acc:10... [more]
nfxl13.991e-3726.42nuclear transcription factor, X-box binding like 1... [more]
gramd1c9.042e-3726.87GRAM domain containing 1C [Source:NCBI gene;Acc:10... [more]
nfxl11.079e-3427.55nuclear transcription factor, X-box binding like 1... [more]
back to top
BLAST of VASt domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Gramd1b1.939e-5031.09GRAM domain containing 1B [Source:MGI Symbol;Acc:M... [more]
Gramd1b2.975e-5031.09GRAM domain containing 1B [Source:MGI Symbol;Acc:M... [more]
Gramd1b4.670e-5031.09GRAM domain containing 1B [Source:MGI Symbol;Acc:M... [more]
Gramd1b5.420e-5031.09GRAM domain containing 1B [Source:MGI Symbol;Acc:M... [more]
Gramd1b6.089e-5031.09GRAM domain containing 1B [Source:MGI Symbol;Acc:M... [more]
back to top
BLAST of VASt domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q3KR37|ASTRB_HUMAN1.521e-4931.30Protein Aster-B OS=Homo sapiens OX=9606 GN=GRAMD1B... [more]
sp|Q80TI0|ASTRB_MOUSE1.915e-4931.09Protein Aster-B OS=Mus musculus OX=10090 GN=Gramd1... [more]
sp|Q8IYS0|ASTRC_HUMAN2.611e-4727.70Protein Aster-C OS=Homo sapiens OX=9606 GN=GRAMD1C... [more]
sp|Q8CI52|ASTRC_MOUSE4.930e-4728.82Protein Aster-C OS=Mus musculus OX=10090 GN=Gramd1... [more]
sp|Q5RC33|ASTRC_PONAB8.952e-4727.76Protein Aster-C OS=Pongo abelii OX=9601 GN=GRAMD1C... [more]
back to top
BLAST of VASt domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A2C9JP879.873e-6332.09VASt domain-containing protein OS=Biomphalaria gla... [more]
A0A2C9JP771.044e-6232.09VASt domain-containing protein OS=Biomphalaria gla... [more]
A0A2C9JP882.511e-6232.09VASt domain-containing protein OS=Biomphalaria gla... [more]
A0A2C9JP822.669e-6232.09VASt domain-containing protein OS=Biomphalaria gla... [more]
A0A2C9JP795.970e-6232.22VASt domain-containing protein OS=Biomphalaria gla... [more]
back to top
BLAST of VASt domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gramd1ba5.956e-4929.68GRAM domain-containing protein 1B-like [Source:NCB... [more]
gramd1ba8.551e-4929.68GRAM domain-containing protein 1B-like [Source:NCB... [more]
gramd1ba8.551e-4929.68GRAM domain-containing protein 1B-like [Source:NCB... [more]
gramd1ba1.325e-4829.68GRAM domain-containing protein 1B-like [Source:NCB... [more]
gramd1ba1.568e-4829.68GRAM domain-containing protein 1B-like [Source:NCB... [more]
back to top
BLAST of VASt domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 4
Match NameE-valueIdentityDescription
GRAMD1A6.117e-3927.50GRAM domain containing 1A [Source:HGNC Symbol;Acc:... [more]
gramd1bb7.969e-3144.37GRAM domain containing 1Bb [Source:ZFIN;Acc:ZDB-GE... [more]
ENSPMAT00000003678.12.030e-1033.73pep scaffold:Pmarinus_7.0:GL477104:103280:105081:-... [more]
ENSPMAT00000006389.18.896e-726.61pep scaffold:Pmarinus_7.0:GL481951:143257:161898:-... [more]
back to top
BLAST of VASt domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 4
Match NameE-valueIdentityDescription
LAM41.548e-1336.75Sterol-binding protein that localizes to puncta in... [more]
YSP22.299e-1233.07Sterol-binding protein; has a probable role in ret... [more]
YFL042C_mRNA3.886e-1230.00Putative sterol transfer protein; one of six StART... [more]
LAM61.083e-732.41Sterol transporter that transfers sterols between ... [more]
back to top
BLAST of VASt domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO452832.158e-939.71Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO267703.269e-843.64Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of VASt domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gramd1bb2.169e-4629.32GRAM domain containing 1B [Source:NCBI gene;Acc:10... [more]
gramd1bb2.173e-4629.32GRAM domain containing 1B [Source:NCBI gene;Acc:10... [more]
gramd1bb2.214e-4629.32GRAM domain containing 1B [Source:NCBI gene;Acc:10... [more]
gramd1bb2.640e-4629.32GRAM domain containing 1B [Source:NCBI gene;Acc:10... [more]
gramd1bb3.418e-4629.32GRAM domain containing 1B [Source:NCBI gene;Acc:10... [more]
back to top
BLAST of VASt domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000033356.10.000e+099.49SMESG000033356.1[more]
SMESG000033356.10.000e+099.49SMESG000033356.1[more]
SMESG000033356.10.000e+097.77SMESG000033356.1[more]
SMESG000033356.10.000e+097.72SMESG000033356.1[more]
SMESG000033356.10.000e+097.71SMESG000033356.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30000033 ID=SMED30000033|Name=VASt domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=2128bp
GTGTGATTGGTTATCTTCGTGGGCTGATTCGAATCTATTTTTAACTTTTG
ATTTGATTGGAGGATATGAAAATCGATATTCTTTTAATATTTCAACTAAG
TGTTTAATAACCAGGCTCCTTAAATCCATATCGCATGTTGTGAACTTTGA
TCATTTCTATCGTATTAATGCAGCTAAAAGTGAAAACCATTTGAATAAAC
CGAAATGTCAGCACAAGAAAATGTACAAAAAATGAAAAATTATTTTTTAG
AGAATTTTACGAAAAAGGAACCTTACATGTTAAAAACATACAAGCAAAGA
AGAAGCGATTTTAAAAAATCCTTCAAAGATACAAATGCAGAAAGTTCTCC
TTTGATTTCAGATTATTCCTGTGCTATATATGCTGGAACTCCAAAAATTC
TACAGCAGGGCCGCATGTATATCACGACAGAATTTTTATGCTTTTACAGT
AGATTTATAACTTTCGAACAAAAAATAACAGTTTCATATAAAGATATCAA
AGAATTAACTAAAGAAAAAACTGCCATGGTTTTCCAGAATGCCATTCAAA
TTGTCACAGATAATAATGAGAAACATTTTTTCTCTTCTTTTACGACACGA
GATCGAGCTTATTATGTTATTCACAAATTATGGATGGAAAGCAAAGATGG
AATTAAGTTATCTAATGCTGCATTTTGGGACAGAGTTCGGGAAAATTATG
GAAATGATTTGGGATTTCTTTTAGAAGATGTCGAATATGACGAATCTAAT
GCTACTCAATTTACTGCTCGCTATAAAATACCAAGACGGCCCAGTGAAAT
AATGAGTAACACGTCCTCTCCAGATGATTCCCTTTACGAAAGCCTTGAAG
AGTCTCCTGTCAGTGACAATGTTATTGATTATTCACTGTGTAATGGACAT
AATTTAAAGTCAGAAAATTTTGATAAAAAACCACCATCTATTCCCGAAGA
AGAAATAAAATTTGATCTATCATTTCGGAATTCAACACAAATTCCAGAAT
CTAATAATATTGAGGAAAATGAAATTATCCCAGTTGAAGACATCATATCA
AGTCGACCTGCAGCTATTTGTTCTGATCATGAACATCTTCCAAACATGTT
ACTAGATGAAGAATTCAGTATAAATGTTCACACTCTATGGACTTTTATTT
TTACTGATAATGCATTTTTTCGAGCGCTTTGCGCAATGAGATTCATCACT
GAAATCACACAGAGCAATTGGTCGGATGATGTTGACAGAGAAAAATGCAG
AACAATTTATTATACGGTTAATTTGAAAAATAGAATTGGTCCAAAAAAGT
CCCCGACAGTTGAGAAACAAGTATTATTAGAAGGCAGCTGTAAAGATTAT
ATTTACTATGTGGAATCTATTGTTCGTACTGTAGGCATTCCAATGTCAGA
TTCGTTCCATATTGTTCTGCGATATTGTTTGTTATATATAAATCCTAATA
AAAGTAGAATAAAAATATCCATGAAAATAGTATATGATAAAACTGTATTT
TTTGCTACTAAAAGTATTATAGATTCTAGTGTAAAAAGTGGATGTATAGA
TTACCATAAAGATCTCAAACAAGCTCTACTCATCGAATCACAGAAAATTA
ATGATGTTTTAACAGAACAGAAAAGTTATTGTACACAATCATCTATTGAA
GAAAGTTATCAAAAGGTTGATACTAATGAAAATATCTCTATTGTATCAGC
TTTACATAATTCACAAAGTGAAACGAAAATATCGTGGATAATGATGGTTA
TCATATGCTGCATTTCTTTTTTCATGCTCTACCTTATCAAAGAGATGTAT
TCTGACTCGTCGGCATTTATGGAACTGAGCGATCATAATGAGCGATCTAG
CCAGAGAGAATTTGATCAAGATTCGTTAACAGAAATAATGAAAATTATTA
AAGAGATGAAAACCACAATAGATGTTTTGAAAGTAAATATCGAAATGTTA
AACAGATCTCAGAATTGTTCTGAGAACTCCTGAAATTTTCAACATTTTAA
AAATAGTTTTAATTTAAGCTTTGTCCCAAACTTTCAATTTTCAAATTAAT
TTTTTTTATTTCAGAAAGCTCAAATGTGTTGTGATTTTATACATCATCGA
GTTTAAATACATTACTTATATATTAAAA
back to top

protein sequence of SMED30000033-orf-1

>SMED30000033-orf-1 ID=SMED30000033-orf-1|Name=SMED30000033-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=593bp
MSAQENVQKMKNYFLENFTKKEPYMLKTYKQRRSDFKKSFKDTNAESSPL
ISDYSCAIYAGTPKILQQGRMYITTEFLCFYSRFITFEQKITVSYKDIKE
LTKEKTAMVFQNAIQIVTDNNEKHFFSSFTTRDRAYYVIHKLWMESKDGI
KLSNAAFWDRVRENYGNDLGFLLEDVEYDESNATQFTARYKIPRRPSEIM
SNTSSPDDSLYESLEESPVSDNVIDYSLCNGHNLKSENFDKKPPSIPEEE
IKFDLSFRNSTQIPESNNIEENEIIPVEDIISSRPAAICSDHEHLPNMLL
DEEFSINVHTLWTFIFTDNAFFRALCAMRFITEITQSNWSDDVDREKCRT
IYYTVNLKNRIGPKKSPTVEKQVLLEGSCKDYIYYVESIVRTVGIPMSDS
FHIVLRYCLLYINPNKSRIKISMKIVYDKTVFFATKSIIDSSVKSGCIDY
HKDLKQALLIESQKINDVLTEQKSYCTQSSIEESYQKVDTNENISIVSAL
HNSQSETKISWIMMVIICCISFFMLYLIKEMYSDSSAFMELSDHNERSSQ
REFDQDSLTEIMKIIKEMKTTIDVLKVNIEMLNRSQNCSENS*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0000101muscle cell
PLANA:0000142posterior region of the whole animal
PLANA:0002056medial muscle cell
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR011993PH-like_dom_sf
IPR031968VASt
IPR004182GRAM
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 565..585
NoneNo IPR availablePANTHERPTHR23319UNCHARACTERIZEDcoord: 17..583
NoneNo IPR availableCDDcd13220PH-GRAM_GRAMDCcoord: 46..143
e-value: 4.74139E-35
score: 125.311
NoneNo IPR availableTMHMMTMhelixcoord: 509..528
IPR004182GRAM domainSMARTSM00568gram2001ccoord: 34..105
e-value: 5.1E-11
score: 52.6
IPR004182GRAM domainPFAMPF02893GRAMcoord: 35..143
e-value: 1.7E-19
score: 69.8
IPR011993PH-like domain superfamilyGENE3DG3DSA:2.30.29.30coord: 31..146
e-value: 1.6E-32
score: 113.7
IPR031968VASt domainPFAMPF16016VAStcoord: 299..446
e-value: 3.3E-24
score: 86.1
IPR031968VASt domainPROSITEPS51778VASTcoord: 295..466
score: 32.109