slc20a-1

Overview
Nameslc20a-1 (AKN21544.1)
Smed IDSMED30000014
Length (bp)1622
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of slc20a-1 (SMED30000014) t-SNE clustered cells

Violin plots show distribution of expression levels for slc20a-1 (SMED30000014) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of slc20a-1 (SMED30000014) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for slc20a-1 (SMED30000014) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30000014

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 16

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynxSMED30000014SMESG000012546.1 dd_Smed_v4_1270_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30000014SMESG000012546.1 dd_Smed_v4_1270_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult fluorescence in situ hybridization evidence
protonephridiaSMED30000014SMESG000012546.1 dd_Smed_v4_1270_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30000014SMESG000012546.1 dd_Smed_v4_1270_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30000014SMESG000012546.1 dd_Smed_v4_1270_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30000014SMESG000012546.1 dd_Smed_v4_1270_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
proximal tubuleSMED30000014SMESG000012546.1 dd_Smed_v4_1270_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult fluorescence in situ hybridization evidence
neuronSMED30000014SMESG000012546.1 dd_Smed_v4_1270_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
muscle cellSMED30000014SMESG000012546.1 dd_Smed_v4_1270_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parapharyngeal regionSMED30000014SMESG000012546.1 dd_Smed_v4_1270_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30000014SMESG000012546.1 dd_Smed_v4_1270_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30000014SMESG000012546.1 Contig42015newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30000014SMESG000012546.1 Contig42015uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
head regionSMED30000014SMESG000012546.1 dd_Smed_v6_1270_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30000014SMESG000012546.1 dd_Smed_v4_1270_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
proximal tubuleSMED30000014SMESG000012546.1 Smed-slc20a-1smed_ncbi_20200123PMID:21828097
Rink et al., 2011
whole organism asexual adult fluorescence in situ hybridization evidence
Note: Hover over icons to view figure legend
Homology
BLAST of slc20a-1 vs. Ensembl Human
Match: SLC20A1 (solute carrier family 20 member 1 [Source:HGNC Symbol;Acc:HGNC:10946])

HSP 1 Score: 269.626 bits (688), Expect = 1.558e-81
Identity = 132/269 (49.07%), Postives = 194/269 (72.12%), Query Frame = 1
Query:   73 NQIWIIVVGFLIAFILAFGIGANDVANSFGTSVGSKVLTLKQACVLASIFEILGSILLGAKVSDTIRKGVILPEYYNTQNMTDGIRIMMMGQLSSLSGACVWMMIATFFKLPVSGSHSIVGAVVGFALIIHGVKGIDWVKVGFIVASWFISPILSGSVSVLTFFIFDRFILKKSDPLEPGLTFLPFIYSITILINAFSIFISGPPLLGFDKIPLYGTFIASFGLAIITILVVRFVAVPYLRKKIQSNCSTATAKMSFGNGSSYVEDNHN 879
            + +W++++GF+IAF+LAF +GANDVANSFGT+VGS V+TLKQAC+LASIFE +GS+LLGAKVS+TIRKG+I  E YN+   T G+  +M G +S++ G+ VW ++A+F KLP+SG+H IVGA +GF+L+  G +G+ W ++  IV SWF+SP+LSG +S + FF+   FIL K+DP+  GL  LP  Y+ T+ IN FSI  +G PLLGFDK+PL+GT + S G A+   L+V F   P +++KI+     + ++       + ++++H 
Sbjct:   20 DYLWMLILGFIIAFVLAFSVGANDVANSFGTAVGSGVVTLKQACILASIFETVGSVLLGAKVSETIRKGLIDVEMYNS---TQGL--LMAGSVSAMFGSAVWQLVASFLKLPISGTHCIVGATIGFSLVAKGQEGVKWSELIKIVMSWFVSPLLSGIMSGILFFLVRAFILHKADPVPNGLRALPVFYACTVGINLFSIMYTGAPLLGFDKLPLWGTILISVGCAVFCALIVWFFVCPRMKRKIEREIKCSPSESPLMEKKNSLKEDHE 283          

HSP 2 Score: 226.868 bits (577), Expect = 1.662e-65
Identity = 108/156 (69.23%), Postives = 131/156 (83.97%), Query Frame = 1
Query:  979 LFSGLQILTAVFGGFAHGGNDVSNAIGPLVGLWIIGLTQDLSSKMAIPIWILLYGGFGITIGLWIWGRRVIKTMGDELTTITPSSGVCIELGSAITVTVASNIGLPISTTHCKVGSIVAVGRYRSNENVDWKIFRHICFAWFITLPVTGGVSALIM 1446
            LF  LQILTA FG FAHGGNDVSNAIGPLV L+++  T D+SSK+A PIW+LLYGG GI +GLW+WGRRVI+TMG +LT ITPSSG  IEL SA+TV +ASNIGLPISTTHCKVGS+V+VG  RS + VDW++FR+I  AWF+T+P++G +SA IM
Sbjct:  514 LFQFLQILTACFGSFAHGGNDVSNAIGPLVALYLVYDTGDVSSKVATPIWLLLYGGVGICVGLWVWGRRVIQTMGKDLTPITPSSGFSIELASALTVVIASNIGLPISTTHCKVGSVVSVGWLRSKKAVDWRLFRNIFMAWFVTVPISGVISAAIM 669          
BLAST of slc20a-1 vs. Ensembl Human
Match: SLC20A2 (solute carrier family 20 member 2 [Source:HGNC Symbol;Acc:HGNC:10947])

HSP 1 Score: 248.44 bits (633), Expect = 6.813e-74
Identity = 130/268 (48.51%), Postives = 183/268 (68.28%), Query Frame = 1
Query:   70 DNQIWIIVVGFLIAFILAFGIGANDVANSFGTSVGSKVLTLKQACVLASIFEILGSILLGAKVSDTIRKGVILPEYYNTQNMTDGIRIMMMGQLSSLSGACVWMMIATFFKLPVSGSHSIVGAVVGFALIIHGVKGIDWVKVGFIVASWFISPILSGSVSVLTFFIFDRFILKKSDPLEPGLTFLPFIYSITILINAFSIFISGPPLLGFDKIPLYGTFIASFGLAIITILVVRFVAVPYLRKKIQSNCSTATAKMSFGNGSSYVEDN 873
            D  +W++++GF+IAFILAF +GANDVANSFGT+VGS V+TL+QAC+LASIFE  GS+LLGAKV +TIRKG+I    YN     + +  +M G++S++ G+ VW +IA+F +LP+SG+H IVG+ +GF+L+  G KG+ W+++  IVASWFISP+LSG +S L F +   FILKK DP+  GL  LP  Y+ TI IN FSI  +G P+LG   +P++   + SFG+A++    V     P++R+KI       T K+      S V D 
Sbjct:    4 DEYLWMVILGFIIAFILAFSVGANDVANSFGTAVGSGVVTLRQACILASIFETTGSVLLGAKVGETIRKGIIDVNLYN-----ETVETLMAGEVSAMVGSAVWQLIASFLRLPISGTHCIVGSTIGFSLVAIGTKGVQWMELVKIVASWFISPLLSGFMSGLLFVLIRIFILKKEDPVPNGLRALPVFYAATIAINVFSIMYTGAPVLGL-VLPMWAIALISFGVALLFAFFVWLFVCPWMRRKI-------TGKLQKEGALSRVSDE 258          

HSP 2 Score: 214.157 bits (544), Expect = 4.773e-61
Identity = 103/159 (64.78%), Postives = 123/159 (77.36%), Query Frame = 1
Query:  979 LFSGLQILTAVFGGFAHGGNDVSNAIGPLVGLWIIGLTQDLSSKMAIPIWILLYGGFGITIGLWIWGRRVIKTMGDELTTITPSSGVCIELGSAITVTVASNIGLPISTTHCKVGSIVAVGRYRSNENVDWKIFRHICFAWFITLPVTGGVSALIMFCL 1455
            LF  LQ+LTA FG FAHGGNDVSNAIGPLV LW+I     ++ + A P+W+L YGG GI  GLW+WGRRVI+TMG +LT ITPSSG  IEL SA TV +ASNIGLP+STTHCKVGS+VAVG  RS + VDW++FR+I  AWF+T+PV G  SA +M  L
Sbjct:  486 LFHFLQVLTACFGSFAHGGNDVSNAIGPLVALWLIYKQGGVTQEAATPVWLLFYGGVGICTGLWVWGRRVIQTMGKDLTPITPSSGFTIELASAFTVVIASNIGLPVSTTHCKVGSVVAVGWIRSRKAVDWRLFRNIFVAWFVTVPVAGLFSAAVMALL 644          
BLAST of slc20a-1 vs. Ensembl Human
Match: SLC20A2 (solute carrier family 20 member 2 [Source:HGNC Symbol;Acc:HGNC:10947])

HSP 1 Score: 248.44 bits (633), Expect = 6.813e-74
Identity = 130/268 (48.51%), Postives = 183/268 (68.28%), Query Frame = 1
Query:   70 DNQIWIIVVGFLIAFILAFGIGANDVANSFGTSVGSKVLTLKQACVLASIFEILGSILLGAKVSDTIRKGVILPEYYNTQNMTDGIRIMMMGQLSSLSGACVWMMIATFFKLPVSGSHSIVGAVVGFALIIHGVKGIDWVKVGFIVASWFISPILSGSVSVLTFFIFDRFILKKSDPLEPGLTFLPFIYSITILINAFSIFISGPPLLGFDKIPLYGTFIASFGLAIITILVVRFVAVPYLRKKIQSNCSTATAKMSFGNGSSYVEDN 873
            D  +W++++GF+IAFILAF +GANDVANSFGT+VGS V+TL+QAC+LASIFE  GS+LLGAKV +TIRKG+I    YN     + +  +M G++S++ G+ VW +IA+F +LP+SG+H IVG+ +GF+L+  G KG+ W+++  IVASWFISP+LSG +S L F +   FILKK DP+  GL  LP  Y+ TI IN FSI  +G P+LG   +P++   + SFG+A++    V     P++R+KI       T K+      S V D 
Sbjct:    4 DEYLWMVILGFIIAFILAFSVGANDVANSFGTAVGSGVVTLRQACILASIFETTGSVLLGAKVGETIRKGIIDVNLYN-----ETVETLMAGEVSAMVGSAVWQLIASFLRLPISGTHCIVGSTIGFSLVAIGTKGVQWMELVKIVASWFISPLLSGFMSGLLFVLIRIFILKKEDPVPNGLRALPVFYAATIAINVFSIMYTGAPVLGL-VLPMWAIALISFGVALLFAFFVWLFVCPWMRRKI-------TGKLQKEGALSRVSDE 258          

HSP 2 Score: 214.157 bits (544), Expect = 4.773e-61
Identity = 103/159 (64.78%), Postives = 123/159 (77.36%), Query Frame = 1
Query:  979 LFSGLQILTAVFGGFAHGGNDVSNAIGPLVGLWIIGLTQDLSSKMAIPIWILLYGGFGITIGLWIWGRRVIKTMGDELTTITPSSGVCIELGSAITVTVASNIGLPISTTHCKVGSIVAVGRYRSNENVDWKIFRHICFAWFITLPVTGGVSALIMFCL 1455
            LF  LQ+LTA FG FAHGGNDVSNAIGPLV LW+I     ++ + A P+W+L YGG GI  GLW+WGRRVI+TMG +LT ITPSSG  IEL SA TV +ASNIGLP+STTHCKVGS+VAVG  RS + VDW++FR+I  AWF+T+PV G  SA +M  L
Sbjct:  486 LFHFLQVLTACFGSFAHGGNDVSNAIGPLVALWLIYKQGGVTQEAATPVWLLFYGGVGICTGLWVWGRRVIQTMGKDLTPITPSSGFTIELASAFTVVIASNIGLPVSTTHCKVGSVVAVGWIRSRKAVDWRLFRNIFVAWFVTVPVAGLFSAAVMALL 644          
BLAST of slc20a-1 vs. Ensembl Human
Match: SLC20A2 (solute carrier family 20 member 2 [Source:HGNC Symbol;Acc:HGNC:10947])

HSP 1 Score: 248.44 bits (633), Expect = 6.813e-74
Identity = 130/268 (48.51%), Postives = 183/268 (68.28%), Query Frame = 1
Query:   70 DNQIWIIVVGFLIAFILAFGIGANDVANSFGTSVGSKVLTLKQACVLASIFEILGSILLGAKVSDTIRKGVILPEYYNTQNMTDGIRIMMMGQLSSLSGACVWMMIATFFKLPVSGSHSIVGAVVGFALIIHGVKGIDWVKVGFIVASWFISPILSGSVSVLTFFIFDRFILKKSDPLEPGLTFLPFIYSITILINAFSIFISGPPLLGFDKIPLYGTFIASFGLAIITILVVRFVAVPYLRKKIQSNCSTATAKMSFGNGSSYVEDN 873
            D  +W++++GF+IAFILAF +GANDVANSFGT+VGS V+TL+QAC+LASIFE  GS+LLGAKV +TIRKG+I    YN     + +  +M G++S++ G+ VW +IA+F +LP+SG+H IVG+ +GF+L+  G KG+ W+++  IVASWFISP+LSG +S L F +   FILKK DP+  GL  LP  Y+ TI IN FSI  +G P+LG   +P++   + SFG+A++    V     P++R+KI       T K+      S V D 
Sbjct:    4 DEYLWMVILGFIIAFILAFSVGANDVANSFGTAVGSGVVTLRQACILASIFETTGSVLLGAKVGETIRKGIIDVNLYN-----ETVETLMAGEVSAMVGSAVWQLIASFLRLPISGTHCIVGSTIGFSLVAIGTKGVQWMELVKIVASWFISPLLSGFMSGLLFVLIRIFILKKEDPVPNGLRALPVFYAATIAINVFSIMYTGAPVLGL-VLPMWAIALISFGVALLFAFFVWLFVCPWMRRKI-------TGKLQKEGALSRVSDE 258          

HSP 2 Score: 214.157 bits (544), Expect = 4.773e-61
Identity = 103/159 (64.78%), Postives = 123/159 (77.36%), Query Frame = 1
Query:  979 LFSGLQILTAVFGGFAHGGNDVSNAIGPLVGLWIIGLTQDLSSKMAIPIWILLYGGFGITIGLWIWGRRVIKTMGDELTTITPSSGVCIELGSAITVTVASNIGLPISTTHCKVGSIVAVGRYRSNENVDWKIFRHICFAWFITLPVTGGVSALIMFCL 1455
            LF  LQ+LTA FG FAHGGNDVSNAIGPLV LW+I     ++ + A P+W+L YGG GI  GLW+WGRRVI+TMG +LT ITPSSG  IEL SA TV +ASNIGLP+STTHCKVGS+VAVG  RS + VDW++FR+I  AWF+T+PV G  SA +M  L
Sbjct:  486 LFHFLQVLTACFGSFAHGGNDVSNAIGPLVALWLIYKQGGVTQEAATPVWLLFYGGVGICTGLWVWGRRVIQTMGKDLTPITPSSGFTIELASAFTVVIASNIGLPVSTTHCKVGSVVAVGWIRSRKAVDWRLFRNIFVAWFVTVPVAGLFSAAVMALL 644          
BLAST of slc20a-1 vs. Ensembl Human
Match: SLC20A2 (solute carrier family 20 member 2 [Source:HGNC Symbol;Acc:HGNC:10947])

HSP 1 Score: 120.168 bits (300), Expect = 6.347e-32
Identity = 57/99 (57.58%), Postives = 78/99 (78.79%), Query Frame = 1
Query:   70 DNQIWIIVVGFLIAFILAFGIGANDVANSFGTSVGSKVLTLKQACVLASIFEILGSILLGAKVSDTIRKGVILPEYYNTQNMTDGIRIMMMGQLSSLSG 366
            D  +W++++GF+IAFILAF +GANDVANSFGT+VGS V+TL+QAC+LASIFE  GS+LLGAKV +TIRKG+I    YN     + +  +M G++S++ G
Sbjct:    4 DEYLWMVILGFIIAFILAFSVGANDVANSFGTAVGSGVVTLRQACILASIFETTGSVLLGAKVGETIRKGIIDVNLYN-----ETVETLMAGEVSAMVG 97          
BLAST of slc20a-1 vs. Ensembl Celegans
Match: pitr-1 (Phosphate transporter [Source:UniProtKB/TrEMBL;Acc:Q18697])

HSP 1 Score: 388.652 bits (997), Expect = 1.362e-129
Identity = 231/515 (44.85%), Postives = 305/515 (59.22%), Query Frame = 1
Query:   61 LFPDNQIWIIVVGFLIAFILAFGIGANDVANSFGTSVGSKVLTLKQACVLASIFEILGSILLGAKVSDTIRKGVI-LPEYYNTQNMT------DGIRIMMMGQLSSLSGACVWMMIATFFKLPVSGSHSIVGAVVGFALIIHGVKGIDWVKVGFIVASWFISPILSGSVSVLTFFIFDRFILKKSDPLEPGLTFLPFIYSITILINAFSIFISGPPLLGFDKIPLYGTFIAS--FGLAIITILVVRFVAVPYLRKKI---------------------QSNCSTATAKMSFGNGSSYVEDNHN----------------LNGHVETHLDNNIVHXXXXXXXXXXXXXXEQCE---LFSGLQILTAVFGGFAHGGNDVSNAIGPLVGLWIIGLTQDLSSKMAIPIWILLYGGFGITIGLWIWGRRVIKTMGDELTTITPSSGVCIELGSAITVTVASNIGLPISTTHCKVGSIVAVGRYRSNENVDWKIFRHICFAWFITLPVTGGVSALIMFCLK 1458
            + PD  + ++++G +IAFILAF IGAND ANSFGTSVGSKVLTL QA VLASIFE LG+ LLG +V+DT+RKGVI   E+   +N T      D    +M+GQ++ L+G  VWM++AT FKLPVS +HSIVGA +GFAL+  G + I W K+  I  SW ISP+LSG VSV  +   D  +L++  PL  G+  LP +Y I    N F+I   GP  L FD++ L    I S  FGLA+   L+  F   PYL+  I                     +S+      +M  GNG  Y+E ++N                 NG   +    N +   +         KPE  +   LFS LQ++TA FGGFAHGGNDVSNAI PLV L++I      S+ M  P ++LLYG FG+ +GLW+ G RVI T+G+ LT ITP+SG  +E G+A+TV +AS +GLPIS+T CKVGS+VAVG  +S   V W +FR+I  +W +TLPV G +S   M  L 
Sbjct:    1 MLPDPTV-LLIIGAVIAFILAFAIGANDTANSFGTSVGSKVLTLHQAYVLASIFETLGACLLGHQVTDTMRKGVIDFSEFGKHENGTVLMSENDLGHTIMLGQIAILTGCGVWMLLATAFKLPVSTTHSIVGATIGFALVAQGSRVIVWEKIYRIFFSWIISPLLSGIVSVFIYLSLDHLVLRREQPLHSGIRVLPALYFICFAFNVFAIVYKGPSFLYFDRLSLTQCLIISGVFGLAVA--LIFAFFLAPYLKDHILSKELLEITGKQRHSHHGHNEKSSSKRKEFEMEEGNGK-YLESDNNGQPLLDQPTIVVSTCPSNGESTSSFAKNTIRPSSSLASFFRSCKPEDPQASRLFSLLQVMTACFGGFAHGGNDVSNAIAPLVSLYLIANDGMKSADMETPWYLLLYGSFGMCLGLWVLGHRVIYTVGENLTKITPASGFAVEFGAAVTVLIASKLGLPISSTQCKVGSVVAVGLVQSRHQVHWGVFRNISLSWIVTLPVAGLLSGGTMMILH 511          
BLAST of slc20a-1 vs. Ensembl Celegans
Match: pitr-1 (Phosphate transporter [Source:UniProtKB/TrEMBL;Acc:Q18697])

HSP 1 Score: 388.652 bits (997), Expect = 1.362e-129
Identity = 231/515 (44.85%), Postives = 305/515 (59.22%), Query Frame = 1
Query:   61 LFPDNQIWIIVVGFLIAFILAFGIGANDVANSFGTSVGSKVLTLKQACVLASIFEILGSILLGAKVSDTIRKGVI-LPEYYNTQNMT------DGIRIMMMGQLSSLSGACVWMMIATFFKLPVSGSHSIVGAVVGFALIIHGVKGIDWVKVGFIVASWFISPILSGSVSVLTFFIFDRFILKKSDPLEPGLTFLPFIYSITILINAFSIFISGPPLLGFDKIPLYGTFIAS--FGLAIITILVVRFVAVPYLRKKI---------------------QSNCSTATAKMSFGNGSSYVEDNHN----------------LNGHVETHLDNNIVHXXXXXXXXXXXXXXEQCE---LFSGLQILTAVFGGFAHGGNDVSNAIGPLVGLWIIGLTQDLSSKMAIPIWILLYGGFGITIGLWIWGRRVIKTMGDELTTITPSSGVCIELGSAITVTVASNIGLPISTTHCKVGSIVAVGRYRSNENVDWKIFRHICFAWFITLPVTGGVSALIMFCLK 1458
            + PD  + ++++G +IAFILAF IGAND ANSFGTSVGSKVLTL QA VLASIFE LG+ LLG +V+DT+RKGVI   E+   +N T      D    +M+GQ++ L+G  VWM++AT FKLPVS +HSIVGA +GFAL+  G + I W K+  I  SW ISP+LSG VSV  +   D  +L++  PL  G+  LP +Y I    N F+I   GP  L FD++ L    I S  FGLA+   L+  F   PYL+  I                     +S+      +M  GNG  Y+E ++N                 NG   +    N +   +         KPE  +   LFS LQ++TA FGGFAHGGNDVSNAI PLV L++I      S+ M  P ++LLYG FG+ +GLW+ G RVI T+G+ LT ITP+SG  +E G+A+TV +AS +GLPIS+T CKVGS+VAVG  +S   V W +FR+I  +W +TLPV G +S   M  L 
Sbjct:    1 MLPDPTV-LLIIGAVIAFILAFAIGANDTANSFGTSVGSKVLTLHQAYVLASIFETLGACLLGHQVTDTMRKGVIDFSEFGKHENGTVLMSENDLGHTIMLGQIAILTGCGVWMLLATAFKLPVSTTHSIVGATIGFALVAQGSRVIVWEKIYRIFFSWIISPLLSGIVSVFIYLSLDHLVLRREQPLHSGIRVLPALYFICFAFNVFAIVYKGPSFLYFDRLSLTQCLIISGVFGLAVA--LIFAFFLAPYLKDHILSKELLEITGKQRHSHHGHNEKSSSKRKEFEMEEGNGK-YLESDNNGQPLLDQPTIVVSTCPSNGESTSSFAKNTIRPSSSLASFFRSCKPEDPQASRLFSLLQVMTACFGGFAHGGNDVSNAIAPLVSLYLIANDGMKSADMETPWYLLLYGSFGMCLGLWVLGHRVIYTVGENLTKITPASGFAVEFGAAVTVLIASKLGLPISSTQCKVGSVVAVGLVQSRHQVHWGVFRNISLSWIVTLPVAGLLSGGTMMILH 511          
BLAST of slc20a-1 vs. Ensembl Celegans
Match: pitr-3 (Phosphate transporter [Source:UniProtKB/TrEMBL;Acc:Q17455])

HSP 1 Score: 377.096 bits (967), Expect = 1.302e-125
Identity = 206/472 (43.64%), Postives = 294/472 (62.29%), Query Frame = 1
Query:   79 IWIIVVGFLIAFILAFGIGANDVANSFGTSVGSKVLTLKQACVLASIFEILGSILLGAKVSDTIRKGVI-LPEYYNTQNMTDGIRIMMMGQLSSLSGACVWMMIATFFKLPVSGSHSIVGAVVGFALIIHGVKGIDWVKVGFIVASWFISPILSGSVSVLTFFIFDRFILKKSDPLEPGLTFLPFIYSITILINAFSIFISGPPLLGFDKIPLYGTFIASFGLAIITILVVRFVAVPYLRKKIQSNCSTATAKM----SFGNGSSYVED--NHNLNGHVETHLDNNIVHXXXXXXXXXXXXXXEQ--CELFSGLQILTAVFGGFAHGGNDVSNAIGPLVGLWIIGLTQDLSSKMAIPIWILLYGGFGITIGLWIWGRRVIKTMGDELTTITPSSGVCIELGSAITVTVASNIGLPISTTHCKVGSIVAVGRYRSNENVDWKIFRHICFAWFITLPVTGGVSALIMFCLKKWA 1467
            +W ++VG ++AF+L  G+GANDV+N+FGTSVGS VLT+ QA +LASIFE LGS+L+G  V DT+RKGV+ + +Y NT       +  ++GQ++ L G   W++IAT   +PVS +HS+VGA +GF++++ G  GI W+ +  IV SWFISP+LSG +S + + I D  +L+ ++PL+ GL  LP  Y + +  NA  +F  G  LL FD+IP++G  I   G+  I      FV  P +R KIQ + +  T  M        GS+ +E+    ++    +T      +                +   +LFS +Q+ TA F GFAHG NDVSNA+ PL  +  +  T+ +  K A+PI++LLYG   I IGLW +G  VIKT+G +++ I P+SG  IE G+A+T  VAS +GLPISTTHC VGS+VAVG  RS + V W  FR+I  +W ITLPV+G +SA IM  + KWA
Sbjct:   28 LWALIVGIILAFLLGAGMGANDVSNAFGTSVGSGVLTIIQAYILASIFETLGSVLVGWSVVDTMRKGVVDISQYENTP------KEFLLGQIAVLGGCSAWLLIATVLHMPVSTTHSLVGATIGFSVVLRGFNGIQWMAIVKIVCSWFISPVLSGIISSIIYMIVDHTVLRTANPLKNGLRALPVFYFVCMAFNALMVFWDGSKLLHFDEIPVWGIVIIVLGVGTIAAAFANFVMKPRIRAKIQDSEAPPTPPMFSDVESARGSAELEEFTEGSVTNQQKTMSTPGKIRKFFTWLLPDRTRSDSRSITQLFSTIQVFTACFAGFAHGANDVSNAVAPLAAIISVYRTKSVEQKEAVPIYVLLYGVLAICIGLWTFGHYVIKTVGTKMSEINPASGFTIEFGAAMTSLVASKLGLPISTTHCLVGSVVAVGALRSEDGVKWSTFRNIFMSWVITLPVSGLISAGIMLII-KWA 492          
BLAST of slc20a-1 vs. Ensembl Celegans
Match: pitr-2 (Phosphate transporter [Source:UniProtKB/TrEMBL;Acc:Q17454])

HSP 1 Score: 354.755 bits (909), Expect = 7.629e-117
Identity = 205/474 (43.25%), Postives = 292/474 (61.60%), Query Frame = 1
Query:   79 IWIIVVGFLIAFILAFGIGANDVANSFGTSVGSKVLTLKQACVLASIFEILGSILLGAKVSDTIRKGVILPEYYNTQNMTDGIRIMMMGQLSSLSGACVWMMIATFFKLPVSGSHSIVGAVVGFALIIHGVKGIDWVKVGFIVASWFISPILSGSVSVLTFFIFDRFILKKSDPLEPGLTFLPFIYSITILINAFSIFISGPPLLGFDKIPLYGTFIASFGLAIITILVVRFVAVPYLRKKIQSNCSTATAKMSFGNGSSYVEDNHNLNGHVETHLDNNIVHXXXX----------XXXXXXXXXXEQCELFSGLQILTAVFGGFAHGGNDVSNAIGPLVGLWIIGLTQDLSSKMAIPIWILLYGGFGITIGLWIWGRRVIKTMGDELTTITPSSGVCIELGSAITVTVASNIGLPISTTHCKVGSIVAVGRYRSNENVDWKIFRHICFAWFITLPVTGGVSALIMFCLKKWAV 1470
            +W ++VG ++AF+L  G+GANDV+N+FGTSVGS VLT+ QA +LASIFE LGSIL+G  V+DT+RKGV+     +T    D  + +++GQ++ L G   W++IAT   +PVS +HS+VGA +GF++++ G++GI W+ +  IV SWF+SPILSG +S + + I D  +L+  DPL+ GL  LP  Y + +  NA  +F  G  LL F++IP +G      G+  +   +  FV  P ++  I+ +   +T    F +  S   D+  L G  E  L N                         D     +LFS +Q+ TA F GFAHG NDVSNAI PL  +  I  T+ +    ++PI++LLYG F I +GLW++G  VIKT+G  ++ I P+SG  IE G+A+T  +AS +GLP+STTHC VGS+VAVG  RS   V W IFR I  +W +TLPV+G +SA IMF + KWAV
Sbjct:   28 LWALIVGIILAFLLGNGMGANDVSNAFGTSVGSGVLTMVQAYILASIFEALGSILVGWSVADTMRKGVV-----DTSQYADDPKELLLGQVAILGGCAAWLLIATVLHMPVSTTHSLVGATIGFSIVLRGLEGIQWMTIVRIVCSWFLSPILSGIISSIIYMIVDHTVLRTGDPLKNGLRALPVFYFVCMAFNALVVFWDGSKLLHFNEIPAWGIAAIVIGVGCVAAALAHFVLKPRIKSNIKGSKVQSTPS-RFSDVES-ANDSEKLKGLPEQKLQNVQQRKTPSGKIRKFYVWLLPDRTRVDGRNITKLFSTIQVFTACFAGFAHGANDVSNAIAPLAAIISIYRTKSVEQTESVPIYVLLYGVFAICVGLWLFGHYVIKTVGTNMSEINPASGFTIEFGAAMTSLLASKVGLPLSTTHCLVGSVVAVGMIRSENGVKWSIFRDIAISWVVTLPVSGLISAGIMFVI-KWAV 493          
BLAST of slc20a-1 vs. Ensembl Celegans
Match: pitr-5 (Phosphate transporter [Source:UniProtKB/TrEMBL;Acc:O17404])

HSP 1 Score: 342.813 bits (878), Expect = 5.494e-112
Identity = 195/479 (40.71%), Postives = 283/479 (59.08%), Query Frame = 1
Query:   79 IWIIVVGFLIAFILAFGIGANDVANSFGTSVGSKVLTLKQACVLASIFEILGSILLGAKVSDTIRKGVILPEYYNTQNMTDGIRIMMMGQLSSLSGACVWMMIATFFKLPVSGSHSIVGAVVGFALIIHGVKGIDWVKVGFIVASWFISPILSGSVSVLTFFIFDRFILKKSDPLEPGLTFLPFIYSITILINAFSIFISGPPLLGFDKIPLYGTFIASFGLAIITILVVRFVAVPYLRKKI----QSNCSTATAKMSFGNGSSYVEDNHNLNGHVETHLDNNIVHXXXXXXX----------------XXXXXXXEQCELFSGLQILTAVFGGFAHGGNDVSNAIGPLVGLWIIGLTQDLSSKMAIPIWILLYGGFGITIGLWIWGRRVIKTMGDELTTITPSSGVCIELGSAITVTVASNIGLPISTTHCKVGSIVAVGRYRSNENVDWKIFRHICFAWFITLPVTGGVSALIMFCL 1455
            +W ++VG  +AF+L FG+GANDVAN+FGTSVGSK LTL QA  LA+IFE LG++L+G  V DT+R+GV+    YN     +     M+GQ++ L G   W++IAT  +LPVS +H++VGA +GF++   G +GI W+KV  IVASWFISPI +G+VS++ +   D  IL+ S+P+  GL +LP  Y   +  N F I   G  +L    +PL+   + S G  II   V  F+  P +RK I    ++  S  ++ +    G   ++     +    T+  N+   + T                        +  +   +F+ +Q+LTA F GFAHG NDV NAI PLV L  +    D+  K   PI +LLYG F I +GLW  G +VI+T+G  ++ + P+SG CIE G+A+T  +AS +GLPISTTHC VG++VAVG  +  +  DW +FR++ F+W +TLPV G  +AL M+ L
Sbjct:   27 LWALIVGICLAFLLGFGMGANDVANAFGTSVGSKALTLFQAYCLATIFETLGAVLVGYNVIDTMRRGVVDVAVYN-----NSAGDFMVGQVAVLGGTATWLLIATCLQLPVSTTHAVVGATLGFSIACKGFQGIQWMKVVNIVASWFISPIFAGTVSLILYLFVDHVILRTSNPVANGLMWLPIFYFACLTFNMFMISYQGSKVLHLSNVPLWAAIVVSLGAGIIAAAVCYFLVNPRIRKYIAKGKEARESPTSSVVISVTGDPELDKVAIRSESTTTNASNSCDSLQTPSPSEPQGKIRKFFKWLFPDKSRVESEDTLRMFTSVQVLTACFAGFAHGANDVCNAIAPLVALIAVYRDFDVYQKKETPITVLLYGVFAICVGLWCLGHKVIRTVGTNMSEVNPASGFCIEFGAAVTALLASKMGLPISTTHCLVGAVVAVGSVKGGKETDWSLFRNVAFSWVVTLPVAGLFAALYMWLL 500          
BLAST of slc20a-1 vs. Ensembl Fly
Match: NaPi-III (gene:FBgn0260795 transcript:FBtr0301438)

HSP 1 Score: 261.536 bits (667), Expect = 6.362e-79
Identity = 127/247 (51.42%), Postives = 176/247 (71.26%), Query Frame = 1
Query:   64 FPDNQIWIIVVGFLIAFILAFGIGANDVANSFGTSVGSKVLTLKQACVLASIFEILGSILLGAKVSDTIRKGVILPEYYNTQNMTDGIRIMMMGQLSSLSGACVWMMIATFFKLPVSGSHSIVGAVVGFALIIHGVKGIDWVKVGFIVASWFISPILSGSVSVLTFFIFDRFILKKSDPLEPGLTFLPFIYSITILINAFSIFISGPPLLGFDKIPLYGTFIASFGLAIITILVVRFVAVPYLRKKI 804
            F    +W++V+GFLIAF+LAFGIGANDVANSFGTSVGS VLT++QACVLA+I EI G++L+G KVSDT+RKG++    Y          ++M+G +++L+ + VW+++ATF KLP+SG+HSIVG+ +GF+L+  GV+G+ W  +G IV SWFISP+LSG VS+L F    RFIL+  +PL+ G   LP  Y +T  IN  S+ + GP LL  D IP +    ASFGL+++  L+ + V VP  R+KI
Sbjct:    4 FAPELLWMVVIGFLIAFVLAFGIGANDVANSFGTSVGSGVLTIRQACVLATICEISGAVLIGYKVSDTMRKGILEVGLYEGAE-----EVLMLGCVAALASSAVWLLVATFLKLPISGTHSIVGSTIGFSLVARGVQGLKWSTLGTIVGSWFISPVLSGIVSILLFLAIRRFILRAQEPLKAGFRSLPIFYGVTFFINVISVVLDGPKLLYMDNIPTWIALTASFGLSLLVALLTQLVVVPLQRRKI 245          

HSP 2 Score: 189.504 bits (480), Expect = 2.854e-52
Identity = 99/189 (52.38%), Postives = 130/189 (68.78%), Query Frame = 1
Query:  979 LFSGLQILTAVFGGFAHGGNDVSNAIGPLVGLWIIGLTQDLSSKMAIPIWILLYGGFGITIGLWIWGRRVIKTMGDELTTITPSSGVCIELGSAITVTVASNIGLPISTTHCKVGSIV------AVGRYRSNE-------------------NVDWKIFRHICFAWFITLPVTGGVSALIMFCLKKWAV 1470
            LFS LQILTA FG FAHGGNDVSNAIGPL+ L++I     +  +   PI+IL+YGG GI++GLW+WGRRVI+T+G++LT IT S+G  IE+G+AITV +AS IGLPISTTHCKVGS+V      A GR + ++                   +VDW +FR+I +AW +T+PVT  +SA +M+ L   AV
Sbjct:  473 LFSFLQILTATFGSFAHGGNDVSNAIGPLIALYMIYREGSVMQQAESPIYILIYGGIGISVGLWLWGRRVIETIGNDLTKITSSTGFTIEVGAAITVLLASKIGLPISTTHCKVGSVVFVGHVSASGRKKKSQPNDQTDKETHNEVAPMDDGSVDWHLFRNIAYAWIVTVPVTALLSAGMMYVLCAIAV 661          
BLAST of slc20a-1 vs. Ensembl Fly
Match: NaPi-III (gene:FBgn0260795 transcript:FBtr0332705)

HSP 1 Score: 261.536 bits (667), Expect = 6.362e-79
Identity = 127/247 (51.42%), Postives = 176/247 (71.26%), Query Frame = 1
Query:   64 FPDNQIWIIVVGFLIAFILAFGIGANDVANSFGTSVGSKVLTLKQACVLASIFEILGSILLGAKVSDTIRKGVILPEYYNTQNMTDGIRIMMMGQLSSLSGACVWMMIATFFKLPVSGSHSIVGAVVGFALIIHGVKGIDWVKVGFIVASWFISPILSGSVSVLTFFIFDRFILKKSDPLEPGLTFLPFIYSITILINAFSIFISGPPLLGFDKIPLYGTFIASFGLAIITILVVRFVAVPYLRKKI 804
            F    +W++V+GFLIAF+LAFGIGANDVANSFGTSVGS VLT++QACVLA+I EI G++L+G KVSDT+RKG++    Y          ++M+G +++L+ + VW+++ATF KLP+SG+HSIVG+ +GF+L+  GV+G+ W  +G IV SWFISP+LSG VS+L F    RFIL+  +PL+ G   LP  Y +T  IN  S+ + GP LL  D IP +    ASFGL+++  L+ + V VP  R+KI
Sbjct:    4 FAPELLWMVVIGFLIAFVLAFGIGANDVANSFGTSVGSGVLTIRQACVLATICEISGAVLIGYKVSDTMRKGILEVGLYEGAE-----EVLMLGCVAALASSAVWLLVATFLKLPISGTHSIVGSTIGFSLVARGVQGLKWSTLGTIVGSWFISPVLSGIVSILLFLAIRRFILRAQEPLKAGFRSLPIFYGVTFFINVISVVLDGPKLLYMDNIPTWIALTASFGLSLLVALLTQLVVVPLQRRKI 245          

HSP 2 Score: 189.504 bits (480), Expect = 2.854e-52
Identity = 99/189 (52.38%), Postives = 130/189 (68.78%), Query Frame = 1
Query:  979 LFSGLQILTAVFGGFAHGGNDVSNAIGPLVGLWIIGLTQDLSSKMAIPIWILLYGGFGITIGLWIWGRRVIKTMGDELTTITPSSGVCIELGSAITVTVASNIGLPISTTHCKVGSIV------AVGRYRSNE-------------------NVDWKIFRHICFAWFITLPVTGGVSALIMFCLKKWAV 1470
            LFS LQILTA FG FAHGGNDVSNAIGPL+ L++I     +  +   PI+IL+YGG GI++GLW+WGRRVI+T+G++LT IT S+G  IE+G+AITV +AS IGLPISTTHCKVGS+V      A GR + ++                   +VDW +FR+I +AW +T+PVT  +SA +M+ L   AV
Sbjct:  473 LFSFLQILTATFGSFAHGGNDVSNAIGPLIALYMIYREGSVMQQAESPIYILIYGGIGISVGLWLWGRRVIETIGNDLTKITSSTGFTIEVGAAITVLLASKIGLPISTTHCKVGSVVFVGHVSASGRKKKSQPNDQTDKETHNEVAPMDDGSVDWHLFRNIAYAWIVTVPVTALLSAGMMYVLCAIAV 661          
BLAST of slc20a-1 vs. Ensembl Zebrafish
Match: slc20a1a (solute carrier family 20 member 1a [Source:NCBI gene;Acc:406458])

HSP 1 Score: 274.248 bits (700), Expect = 7.834e-84
Identity = 135/275 (49.09%), Postives = 197/275 (71.64%), Query Frame = 1
Query:   79 IWIIVVGFLIAFILAFGIGANDVANSFGTSVGSKVLTLKQACVLASIFEILGSILLGAKVSDTIRKGVILPEYYNTQNMTDGIRIMMMGQLSSLSGACVWMMIATFFKLPVSGSHSIVGAVVGFALIIHGVKGIDWVKVGFIVASWFISPILSGSVSVLTFFIFDRFILKKSDPLEPGLTFLPFIYSITILINAFSIFISGPPLLGFDKIPLYGTFIASFGLAIITILVVRFVAVPYLRKKIQSNCSTATAKMSFGNGSSYVEDNHNLNGHVETH 903
            +W++++GF+IAFILAF +GANDVANSFGT+VGS V+TL+QAC+LA+IFE +G++LLGAKVS+TIR G+I    YN         ++M G +S++ G+ VW + A+F KLP+SG+H IVGA +GF+++  G +G+ W+++  IVASWF+SP+LSG +S + F+   +FIL K DP+  GL  LP  Y++T+ IN FSI  +G P+LGFD+IP +GT + S G AI+T LVV F+  P L+KK+QS C      ++  +G+  VE   + NG ++ H
Sbjct:   27 LWLLILGFVIAFILAFSVGANDVANSFGTAVGSGVVTLRQACILATIFETVGAMLLGAKVSETIRSGIIDVHMYNGSEA-----VLMAGSISAMFGSAVWQLAASFLKLPISGTHCIVGATIGFSMVARGHQGVKWLELLRIVASWFLSPLLSGIMSAVLFYFVRKFILNKDDPVPNGLRALPVFYAVTMGINLFSIMFTGAPMLGFDRIPWWGTLLISLGCAILTALVVWFIVCPRLKKKMQSKC--LGPNIADTSGTQLVEKKPSSNGLMDHH 294          

HSP 2 Score: 217.624 bits (553), Expect = 1.661e-62
Identity = 107/160 (66.88%), Postives = 125/160 (78.12%), Query Frame = 1
Query:  967 EQCELFSGLQILTAVFGGFAHGGNDVSNAIGPLVGLWIIGLTQDLSSKMAIPIWILLYGGFGITIGLWIWGRRVIKTMGDELTTITPSSGVCIELGSAITVTVASNIGLPISTTHCKVGSIVAVGRYRSNENVDWKIFRHICFAWFITLPVTGGVSALIM 1446
            E   LF  LQILTA FG FAHGGNDVSNAIGPLV LW+I  +  ++     PIW+LLYGG GI  GLWIWGRRVI+TMG +LT ITPSSG  IEL SAITV VASNIGLP+STTHCKVGS+V+VG  RS + VDW +FR+I  AWF+T+P++G +SA IM
Sbjct:  482 EVSTLFQFLQILTACFGSFAHGGNDVSNAIGPLVALWLIYDSASVAPSAPTPIWLLLYGGVGICTGLWIWGRRVIQTMGKDLTPITPSSGFSIELASAITVVVASNIGLPVSTTHCKVGSVVSVGWLRSRKAVDWHLFRNIFIAWFVTVPISGLISAAIM 641          
BLAST of slc20a-1 vs. Ensembl Zebrafish
Match: slc20a1a (solute carrier family 20 member 1a [Source:NCBI gene;Acc:406458])

HSP 1 Score: 274.248 bits (700), Expect = 7.834e-84
Identity = 135/275 (49.09%), Postives = 197/275 (71.64%), Query Frame = 1
Query:   79 IWIIVVGFLIAFILAFGIGANDVANSFGTSVGSKVLTLKQACVLASIFEILGSILLGAKVSDTIRKGVILPEYYNTQNMTDGIRIMMMGQLSSLSGACVWMMIATFFKLPVSGSHSIVGAVVGFALIIHGVKGIDWVKVGFIVASWFISPILSGSVSVLTFFIFDRFILKKSDPLEPGLTFLPFIYSITILINAFSIFISGPPLLGFDKIPLYGTFIASFGLAIITILVVRFVAVPYLRKKIQSNCSTATAKMSFGNGSSYVEDNHNLNGHVETH 903
            +W++++GF+IAFILAF +GANDVANSFGT+VGS V+TL+QAC+LA+IFE +G++LLGAKVS+TIR G+I    YN         ++M G +S++ G+ VW + A+F KLP+SG+H IVGA +GF+++  G +G+ W+++  IVASWF+SP+LSG +S + F+   +FIL K DP+  GL  LP  Y++T+ IN FSI  +G P+LGFD+IP +GT + S G AI+T LVV F+  P L+KK+QS C      ++  +G+  VE   + NG ++ H
Sbjct:   27 LWLLILGFVIAFILAFSVGANDVANSFGTAVGSGVVTLRQACILATIFETVGAMLLGAKVSETIRSGIIDVHMYNGSEA-----VLMAGSISAMFGSAVWQLAASFLKLPISGTHCIVGATIGFSMVARGHQGVKWLELLRIVASWFLSPLLSGIMSAVLFYFVRKFILNKDDPVPNGLRALPVFYAVTMGINLFSIMFTGAPMLGFDRIPWWGTLLISLGCAILTALVVWFIVCPRLKKKMQSKC--LGPNIADTSGTQLVEKKPSSNGLMDHH 294          

HSP 2 Score: 217.624 bits (553), Expect = 1.661e-62
Identity = 107/160 (66.88%), Postives = 125/160 (78.12%), Query Frame = 1
Query:  967 EQCELFSGLQILTAVFGGFAHGGNDVSNAIGPLVGLWIIGLTQDLSSKMAIPIWILLYGGFGITIGLWIWGRRVIKTMGDELTTITPSSGVCIELGSAITVTVASNIGLPISTTHCKVGSIVAVGRYRSNENVDWKIFRHICFAWFITLPVTGGVSALIM 1446
            E   LF  LQILTA FG FAHGGNDVSNAIGPLV LW+I  +  ++     PIW+LLYGG GI  GLWIWGRRVI+TMG +LT ITPSSG  IEL SAITV VASNIGLP+STTHCKVGS+V+VG  RS + VDW +FR+I  AWF+T+P++G +SA IM
Sbjct:  482 EVSTLFQFLQILTACFGSFAHGGNDVSNAIGPLVALWLIYDSASVAPSAPTPIWLLLYGGVGICTGLWIWGRRVIQTMGKDLTPITPSSGFSIELASAITVVVASNIGLPVSTTHCKVGSVVSVGWLRSRKAVDWHLFRNIFIAWFVTVPISGLISAAIM 641          
BLAST of slc20a-1 vs. Ensembl Zebrafish
Match: slc20a1b (solute carrier family 20 member 1b [Source:NCBI gene;Acc:321541])

HSP 1 Score: 271.937 bits (694), Expect = 9.004e-83
Identity = 132/254 (51.97%), Postives = 186/254 (73.23%), Query Frame = 1
Query:   79 IWIIVVGFLIAFILAFGIGANDVANSFGTSVGSKVLTLKQACVLASIFEILGSILLGAKVSDTIRKGVILPEYYNTQNMTDGIRIMMMGQLSSLSGACVWMMIATFFKLPVSGSHSIVGAVVGFALIIHGVKGIDWVKVGFIVASWFISPILSGSVSVLTFFIFDRFILKKSDPLEPGLTFLPFIYSITILINAFSIFISGPPLLGFDKIPLYGTFIASFGLAIITILVVRFVAVPYLRKKIQSNCSTATAKMS 840
            +W+++VGF+IAF+LAF +GANDVANSFGT+VGS V+TL+QAC+LASIFE LGS+LLGAKVS+TIRKG+I    YN     D   ++M G +S++ G+ VW + A+F KLP+SG+H IVGA +GF+L+  G +G+ W+++  I+ASWF+SP+LSG +S + F+    FIL+K DP+  GL  LPF Y++T+ IN FSI  +G P+LGFDK+P +G  + S G  IIT L+V F   P L+KKI+    +++   S
Sbjct:   27 MWLLIVGFIIAFVLAFSVGANDVANSFGTAVGSGVVTLRQACILASIFETLGSVLLGAKVSETIRKGIIDVTMYN-----DYEHVLMAGSVSAMFGSAVWQLAASFLKLPISGTHCIVGATIGFSLVAKGQQGVKWLELLRIIASWFLSPLLSGVMSAVLFYFVRMFILQKKDPVPNGLRALPFFYAVTMGINLFSIMFTGAPMLGFDKLPWWGVLLISIGFGIITALIVWFAVCPRLKKKIECEVKSSSPSES 275          

HSP 2 Score: 219.55 bits (558), Expect = 3.351e-63
Identity = 106/160 (66.25%), Postives = 127/160 (79.38%), Query Frame = 1
Query:  967 EQCELFSGLQILTAVFGGFAHGGNDVSNAIGPLVGLWIIGLTQDLSSKMAIPIWILLYGGFGITIGLWIWGRRVIKTMGDELTTITPSSGVCIELGSAITVTVASNIGLPISTTHCKVGSIVAVGRYRSNENVDWKIFRHICFAWFITLPVTGGVSALIM 1446
            E   LF  LQILTA FG FAHGGNDVSNAIGPLV LW++  +  + S    PIW+LLYGG GI +GLW+WGRRVI+TMG +LT ITPSSG  IEL SA+TV VASNIGLP+STTHCKVGS+VAVG  RS + VDW++FR+I  AWF+T+P++G +SA IM
Sbjct:  498 EVSMLFQFLQILTACFGSFAHGGNDVSNAIGPLVALWLVYESGSVISSAPTPIWLLLYGGVGICVGLWVWGRRVIQTMGRDLTPITPSSGFSIELASAVTVVVASNIGLPVSTTHCKVGSVVAVGWLRSRKAVDWRLFRNIFMAWFVTVPISGLISAAIM 657          
BLAST of slc20a-1 vs. Ensembl Zebrafish
Match: slc20a1b (solute carrier family 20 member 1b [Source:NCBI gene;Acc:321541])

HSP 1 Score: 271.937 bits (694), Expect = 9.004e-83
Identity = 132/254 (51.97%), Postives = 186/254 (73.23%), Query Frame = 1
Query:   79 IWIIVVGFLIAFILAFGIGANDVANSFGTSVGSKVLTLKQACVLASIFEILGSILLGAKVSDTIRKGVILPEYYNTQNMTDGIRIMMMGQLSSLSGACVWMMIATFFKLPVSGSHSIVGAVVGFALIIHGVKGIDWVKVGFIVASWFISPILSGSVSVLTFFIFDRFILKKSDPLEPGLTFLPFIYSITILINAFSIFISGPPLLGFDKIPLYGTFIASFGLAIITILVVRFVAVPYLRKKIQSNCSTATAKMS 840
            +W+++VGF+IAF+LAF +GANDVANSFGT+VGS V+TL+QAC+LASIFE LGS+LLGAKVS+TIRKG+I    YN     D   ++M G +S++ G+ VW + A+F KLP+SG+H IVGA +GF+L+  G +G+ W+++  I+ASWF+SP+LSG +S + F+    FIL+K DP+  GL  LPF Y++T+ IN FSI  +G P+LGFDK+P +G  + S G  IIT L+V F   P L+KKI+    +++   S
Sbjct:   27 MWLLIVGFIIAFVLAFSVGANDVANSFGTAVGSGVVTLRQACILASIFETLGSVLLGAKVSETIRKGIIDVTMYN-----DYEHVLMAGSVSAMFGSAVWQLAASFLKLPISGTHCIVGATIGFSLVAKGQQGVKWLELLRIIASWFLSPLLSGVMSAVLFYFVRMFILQKKDPVPNGLRALPFFYAVTMGINLFSIMFTGAPMLGFDKLPWWGVLLISIGFGIITALIVWFAVCPRLKKKIECEVKSSSPSES 275          

HSP 2 Score: 219.55 bits (558), Expect = 3.351e-63
Identity = 106/160 (66.25%), Postives = 127/160 (79.38%), Query Frame = 1
Query:  967 EQCELFSGLQILTAVFGGFAHGGNDVSNAIGPLVGLWIIGLTQDLSSKMAIPIWILLYGGFGITIGLWIWGRRVIKTMGDELTTITPSSGVCIELGSAITVTVASNIGLPISTTHCKVGSIVAVGRYRSNENVDWKIFRHICFAWFITLPVTGGVSALIM 1446
            E   LF  LQILTA FG FAHGGNDVSNAIGPLV LW++  +  + S    PIW+LLYGG GI +GLW+WGRRVI+TMG +LT ITPSSG  IEL SA+TV VASNIGLP+STTHCKVGS+VAVG  RS + VDW++FR+I  AWF+T+P++G +SA IM
Sbjct:  498 EVSMLFQFLQILTACFGSFAHGGNDVSNAIGPLVALWLVYESGSVISSAPTPIWLLLYGGVGICVGLWVWGRRVIQTMGRDLTPITPSSGFSIELASAVTVVVASNIGLPVSTTHCKVGSVVAVGWLRSRKAVDWRLFRNIFMAWFVTVPISGLISAAIM 657          
BLAST of slc20a-1 vs. Ensembl Zebrafish
Match: slc20a2 (solute carrier family 20 member 2 [Source:ZFIN;Acc:ZDB-GENE-060929-828])

HSP 1 Score: 243.817 bits (621), Expect = 2.839e-72
Identity = 127/254 (50.00%), Postives = 181/254 (71.26%), Query Frame = 1
Query:   70 DNQIWIIVVGFLIAFILAFGIGANDVANSFGTSVGSKVLTLKQACVLASIFEILGSILLGAKVSDTIRKGVILPEYYNTQNMTDGIRIMMMGQLSSLSGACVWMMIATFFKLPVSGSHSIVGAVVGFALIIHGVKGIDWVKVGFIVASWFISPILSGSVSVLTFFIFDRFILKKSDPLEPGLTFLPFIYSITILINAFSIFISGPPLLGFDKIPLYGTFIASFGLAIITILVVRFVAVPYLRKKIQSNCSTATA 831
            ++ +W++V+GF+IAFILAF +GANDVANSFGT+VGS V+TL+QAC+LASIFE LGS+LLGAKV +TIRKG+I    YN     D + I+M G++S++ G+ VW +IA+F KLP+SG+H IVG+ +GF+++  G KG+ W+++  IV+SWFISP+LSG +S L FF+   FIL K DP+  GL  LP  Y+ TI IN FSI  +G PLLG + +P++   + +   A++   +V     P++R+KI S      A
Sbjct:    4 ESYLWMVVIGFIIAFILAFSVGANDVANSFGTAVGSGVVTLRQACILASIFETLGSMLLGAKVGETIRKGIIDVSLYN-----DTVPILMAGEVSAMVGSAVWQLIASFLKLPISGTHCIVGSTIGFSMVAIGTKGVQWMQLVKIVSSWFISPLLSGLMSGLLFFVIRYFILSKDDPVPNGLRALPLFYASTIGINTFSIMYTGAPLLGLEMLPVWAIALITLAGALVCAGLVWIFVCPWMRRKIASRLKKEHA 252          

HSP 2 Score: 213.001 bits (541), Expect = 9.545e-61
Identity = 104/156 (66.67%), Postives = 121/156 (77.56%), Query Frame = 1
Query:  979 LFSGLQILTAVFGGFAHGGNDVSNAIGPLVGLWIIGLTQDLSSKMAIPIWILLYGGFGITIGLWIWGRRVIKTMGDELTTITPSSGVCIELGSAITVTVASNIGLPISTTHCKVGSIVAVGRYRSNENVDWKIFRHICFAWFITLPVTGGVSALIM 1446
            LF  LQILTA FG FAHGGNDVSNAIGPLV LW+I     +    A P+W+L YGG GI  GLW+WGRRVI+TMG +LT ITPSSG  IEL SA+TV +ASNIGLPISTTHCKVGS+VAVG  RS + VDW++FR+I  AWF+T+PV G  SA +M
Sbjct:  496 LFHFLQILTACFGSFAHGGNDVSNAIGPLVALWMIYDQGGVMQDAATPVWLLFYGGVGICAGLWVWGRRVIQTMGKDLTPITPSSGFTIELASAVTVVLASNIGLPISTTHCKVGSVVAVGWIRSRKAVDWRLFRNIFLAWFVTVPVAGLFSAAVM 651          
BLAST of slc20a-1 vs. Ensembl Xenopus
Match: slc20a1 (solute carrier family 20 member 1 [Source:NCBI gene;Acc:594956])

HSP 1 Score: 266.159 bits (679), Expect = 1.499e-80
Identity = 132/252 (52.38%), Postives = 183/252 (72.62%), Query Frame = 1
Query:   79 IWIIVVGFLIAFILAFGIGANDVANSFGTSVGSKVLTLKQACVLASIFEILGSILLGAKVSDTIRKGVILPEYYNTQNMTDGIRIMMMGQLSSLSGACVWMMIATFFKLPVSGSHSIVGAVVGFALIIHGVKGIDWVKVGFIVASWFISPILSGSVSVLTFFIFDRFILKKSDPLEPGLTFLPFIYSITILINAFSIFISGPPLLGFDKIPLYGTFIASFGLAIITILVVRFVAVPYLRKKIQSNCSTATAK 834
            +W++V+GF+IAF+LAF +GANDVANSFGT+VGS V+TL+QAC+LASIFE +GS+LLGAKVS+TIRKG+I    YNT        ++M G +S++ G+ VW + A+F KLP+SG+H IVGA +GF+L+  G + I W ++  IV SWFISP+LSG +S L F+    FIL+K+DP+  GL  LP  Y+ TI +N FSI  SG PLLGFDKIPL+G  + S G A++  LVV F   P +++KI+    ++ ++
Sbjct:   26 LWMLVLGFVIAFVLAFSVGANDVANSFGTAVGSGVVTLRQACILASIFETVGSVLLGAKVSETIRKGLIDVNTYNTTQ-----ELLMAGSISAMFGSAVWQLAASFLKLPISGTHCIVGATIGFSLVAKGQQAIQWYELLRIVLSWFISPLLSGIMSALLFYFVRMFILRKADPVPNGLRALPIFYACTIGVNLFSIMYSGAPLLGFDKIPLWGIILISVGCAVLCALVVWFFVCPRMKRKIECEFKSSPSE 272          

HSP 2 Score: 224.942 bits (572), Expect = 4.548e-65
Identity = 106/160 (66.25%), Postives = 131/160 (81.88%), Query Frame = 1
Query:  979 LFSGLQILTAVFGGFAHGGNDVSNAIGPLVGLWIIGLTQDLSSKMAIPIWILLYGGFGITIGLWIWGRRVIKTMGDELTTITPSSGVCIELGSAITVTVASNIGLPISTTHCKVGSIVAVGRYRSNENVDWKIFRHICFAWFITLPVTGGVSALIMFCLK 1458
            LF  LQILTA FG FAHGGNDVSNAIGPLV L+++  + D+++K A PIW+LLYGG GI IGLW+WGRRVI+TMG +LT ITPSSG  IEL SA+TV +ASN+GLPISTTHCKVGS+V+VG  RS + VDW++FR+I  AWF+T+P++G +SA IM   K
Sbjct:  484 LFQFLQILTACFGSFAHGGNDVSNAIGPLVALYLVYESGDVTTKAATPIWLLLYGGVGICIGLWVWGRRVIQTMGKDLTPITPSSGFSIELASALTVVIASNVGLPISTTHCKVGSVVSVGWLRSKKAVDWRLFRNIFLAWFVTVPISGLISAAIMAVFK 643          
BLAST of slc20a-1 vs. Ensembl Xenopus
Match: slc20a1 (solute carrier family 20 member 1 [Source:NCBI gene;Acc:594956])

HSP 1 Score: 265.774 bits (678), Expect = 4.282e-80
Identity = 132/252 (52.38%), Postives = 183/252 (72.62%), Query Frame = 1
Query:   79 IWIIVVGFLIAFILAFGIGANDVANSFGTSVGSKVLTLKQACVLASIFEILGSILLGAKVSDTIRKGVILPEYYNTQNMTDGIRIMMMGQLSSLSGACVWMMIATFFKLPVSGSHSIVGAVVGFALIIHGVKGIDWVKVGFIVASWFISPILSGSVSVLTFFIFDRFILKKSDPLEPGLTFLPFIYSITILINAFSIFISGPPLLGFDKIPLYGTFIASFGLAIITILVVRFVAVPYLRKKIQSNCSTATAK 834
            +W++V+GF+IAF+LAF +GANDVANSFGT+VGS V+TL+QAC+LASIFE +GS+LLGAKVS+TIRKG+I    YNT        ++M G +S++ G+ VW + A+F KLP+SG+H IVGA +GF+L+  G + I W ++  IV SWFISP+LSG +S L F+    FIL+K+DP+  GL  LP  Y+ TI +N FSI  SG PLLGFDKIPL+G  + S G A++  LVV F   P +++KI+    ++ ++
Sbjct:   26 LWMLVLGFVIAFVLAFSVGANDVANSFGTAVGSGVVTLRQACILASIFETVGSVLLGAKVSETIRKGLIDVNTYNTTQ-----ELLMAGSISAMFGSAVWQLAASFLKLPISGTHCIVGATIGFSLVAKGQQAIQWYELLRIVLSWFISPLLSGIMSALLFYFVRMFILRKADPVPNGLRALPIFYACTIGVNLFSIMYSGAPLLGFDKIPLWGIILISVGCAVLCALVVWFFVCPRMKRKIECEFKSSPSE 272          

HSP 2 Score: 224.942 bits (572), Expect = 8.263e-65
Identity = 106/160 (66.25%), Postives = 131/160 (81.88%), Query Frame = 1
Query:  979 LFSGLQILTAVFGGFAHGGNDVSNAIGPLVGLWIIGLTQDLSSKMAIPIWILLYGGFGITIGLWIWGRRVIKTMGDELTTITPSSGVCIELGSAITVTVASNIGLPISTTHCKVGSIVAVGRYRSNENVDWKIFRHICFAWFITLPVTGGVSALIMFCLK 1458
            LF  LQILTA FG FAHGGNDVSNAIGPLV L+++  + D+++K A PIW+LLYGG GI IGLW+WGRRVI+TMG +LT ITPSSG  IEL SA+TV +ASN+GLPISTTHCKVGS+V+VG  RS + VDW++FR+I  AWF+T+P++G +SA IM   K
Sbjct:  520 LFQFLQILTACFGSFAHGGNDVSNAIGPLVALYLVYESGDVTTKAATPIWLLLYGGVGICIGLWVWGRRVIQTMGKDLTPITPSSGFSIELASALTVVIASNVGLPISTTHCKVGSVVSVGWLRSKKAVDWRLFRNIFLAWFVTVPISGLISAAIMAVFK 679          
BLAST of slc20a-1 vs. Ensembl Xenopus
Match: slc20a1 (solute carrier family 20 member 1 [Source:NCBI gene;Acc:594956])

HSP 1 Score: 265.774 bits (678), Expect = 4.607e-80
Identity = 132/252 (52.38%), Postives = 183/252 (72.62%), Query Frame = 1
Query:   79 IWIIVVGFLIAFILAFGIGANDVANSFGTSVGSKVLTLKQACVLASIFEILGSILLGAKVSDTIRKGVILPEYYNTQNMTDGIRIMMMGQLSSLSGACVWMMIATFFKLPVSGSHSIVGAVVGFALIIHGVKGIDWVKVGFIVASWFISPILSGSVSVLTFFIFDRFILKKSDPLEPGLTFLPFIYSITILINAFSIFISGPPLLGFDKIPLYGTFIASFGLAIITILVVRFVAVPYLRKKIQSNCSTATAK 834
            +W++V+GF+IAF+LAF +GANDVANSFGT+VGS V+TL+QAC+LASIFE +GS+LLGAKVS+TIRKG+I    YNT        ++M G +S++ G+ VW + A+F KLP+SG+H IVGA +GF+L+  G + I W ++  IV SWFISP+LSG +S L F+    FIL+K+DP+  GL  LP  Y+ TI +N FSI  SG PLLGFDKIPL+G  + S G A++  LVV F   P +++KI+    ++ ++
Sbjct:   27 LWMLVLGFVIAFVLAFSVGANDVANSFGTAVGSGVVTLRQACILASIFETVGSVLLGAKVSETIRKGLIDVNTYNTTQ-----ELLMAGSISAMFGSAVWQLAASFLKLPISGTHCIVGATIGFSLVAKGQQAIQWYELLRIVLSWFISPLLSGIMSALLFYFVRMFILRKADPVPNGLRALPIFYACTIGVNLFSIMYSGAPLLGFDKIPLWGIILISVGCAVLCALVVWFFVCPRMKRKIECEFKSSPSE 273          

HSP 2 Score: 224.557 bits (571), Expect = 1.119e-64
Identity = 106/160 (66.25%), Postives = 131/160 (81.88%), Query Frame = 1
Query:  979 LFSGLQILTAVFGGFAHGGNDVSNAIGPLVGLWIIGLTQDLSSKMAIPIWILLYGGFGITIGLWIWGRRVIKTMGDELTTITPSSGVCIELGSAITVTVASNIGLPISTTHCKVGSIVAVGRYRSNENVDWKIFRHICFAWFITLPVTGGVSALIMFCLK 1458
            LF  LQILTA FG FAHGGNDVSNAIGPLV L+++  + D+++K A PIW+LLYGG GI IGLW+WGRRVI+TMG +LT ITPSSG  IEL SA+TV +ASN+GLPISTTHCKVGS+V+VG  RS + VDW++FR+I  AWF+T+P++G +SA IM   K
Sbjct:  521 LFQFLQILTACFGSFAHGGNDVSNAIGPLVALYLVYESGDVTTKAATPIWLLLYGGVGICIGLWVWGRRVIQTMGKDLTPITPSSGFSIELASALTVVIASNVGLPISTTHCKVGSVVSVGWLRSKKAVDWRLFRNIFLAWFVTVPISGLISAAIMAVFK 680          
BLAST of slc20a-1 vs. Ensembl Xenopus
Match: p3h2 (prolyl 3-hydroxylase 2 [Source:Xenbase;Acc:XB-GENE-1001232])

HSP 1 Score: 258.07 bits (658), Expect = 7.372e-78
Identity = 130/245 (53.06%), Postives = 179/245 (73.06%), Query Frame = 1
Query:   79 IWIIVVGFLIAFILAFGIGANDVANSFGTSVGSKVLTLKQACVLASIFEILGSILLGAKVSDTIRKGVILPEYYNTQNMTDGIRIMMMGQLSSLSGACVWMMIATFFKLPVSGSHSIVGAVVGFALIIHGVKGIDWVKVGFIVASWFISPILSGSVSVLTFFIFDRFILKKSDPLEPGLTFLPFIYSITILINAFSIFISGPPLLGFDKIPLYGTFIASFGLAIITILVVRFVAVPYLRKKIQSN 813
            +W+++VGF+IAFILAF +GANDVANSFGT+VGS V+TL+QAC+LASIFE  GS+LLGAKV +TIRKG+I    YN     + + ++M G++S++ G+ VW +IA+F +LP+SG+H IVGA +GF+L+  G  G+ W+++  IVASWFISP+LSG +S   F +   FILKK DP+  GL  LP  Y+ TI IN FSI  +G PLLG +  P++ T + S G+AII  L+V F   P+++KKI S 
Sbjct:    7 LWMVIVGFIIAFILAFSVGANDVANSFGTAVGSGVVTLRQACILASIFETTGSVLLGAKVGETIRKGIIDVNLYN-----NTVDLLMAGEVSAMVGSAVWQLIASFLRLPISGTHCIVGATIGFSLVAIGTHGVQWMQLVKIVASWFISPLLSGLMSGALFLMIKFFILKKEDPVPNGLKALPVFYAATIGINVFSILYTGAPLLGLESFPVWATALLSIGIAIIFALIVWFFVCPWMKKKIASK 246          

HSP 2 Score: 214.542 bits (545), Expect = 1.439e-61
Identity = 106/160 (66.25%), Postives = 124/160 (77.50%), Query Frame = 1
Query:  979 LFSGLQILTAVFGGFAHGGNDVSNAIGPLVGLWIIGLTQDLSSKMAIPIWILLYGGFGITIGLWIWGRRVIKTMGDELTTITPSSGVCIELGSAITVTVASNIGLPISTTHCKVGSIVAVGRYRSNENVDWKIFRHICFAWFITLPVTGGVSALIMFCLK 1458
            LF  LQILTA FG FAHGGNDVSNAIGPLV LW+I     +  + + P+W+LLYGG GI  GLW+WGRRVI+TMG +LT ITPSSG  IEL SA TV VASNIGLPISTTHCKVGS+VAVG  RS + VDW++FR+I  AWF+T+PV G  SA +M  L+
Sbjct:  445 LFHFLQILTACFGSFAHGGNDVSNAIGPLVALWLIYEQGGVMQEASTPVWLLLYGGVGICAGLWVWGRRVIQTMGKDLTPITPSSGFTIELASAFTVVVASNIGLPISTTHCKVGSVVAVGWIRSRKAVDWRLFRNIFLAWFVTVPVAGLFSAGVMAILQ 604          
BLAST of slc20a-1 vs. Ensembl Xenopus
Match: slc20a1 (solute carrier family 20 member 1 [Source:NCBI gene;Acc:594956])

HSP 1 Score: 255.373 bits (651), Expect = 2.743e-76
Identity = 130/256 (50.78%), Postives = 179/256 (69.92%), Query Frame = 1
Query:   67 PDNQIWIIVVGFLIAFILAFGIGANDVANSFGTSVGSKVLTLKQACVLASIFEILGSILLGAKVSDTIRKGVILPEYYNTQNMTDGIRIMMMGQLSSLSGACVWMMIATFFKLPVSGSHSIVGAVVGFALIIHGVKGIDWVKVGFIVASWFISPILSGSVSVLTFFIFDRFILKKSDPLEPGLTFLPFIYSITILINAFSIFISGPPLLGFDKIPLYGTFIASFGLAIITILVVRFVAVPYLRKKIQSNCSTATAK 834
            P   I  ++   +IAF+LAF +GANDVANSFGT+VGS V+TL+QAC+LASIFE +GS+LLGAKVS+TIRKG+I    YNT        ++M G +S++ G+ VW + A+F KLP+SG+H IVGA +GF+L+  G + I W ++  IV SWFISP+LSG +S L F+    FIL+K+DP+  GL  LP  Y+ TI +N FSI  SG PLLGFDKIPL+G  + S G A++  LVV F   P +++KI+    ++ ++
Sbjct:    6 PSPNIHALINVQIIAFVLAFSVGANDVANSFGTAVGSGVVTLRQACILASIFETVGSVLLGAKVSETIRKGLIDVNTYNTTQ-----ELLMAGSISAMFGSAVWQLAASFLKLPISGTHCIVGATIGFSLVAKGQQAIQWYELLRIVLSWFISPLLSGIMSALLFYFVRMFILRKADPVPNGLRALPIFYACTIGVNLFSIMYSGAPLLGFDKIPLWGIILISVGCAVLCALVVWFFVCPRMKRKIECEFKSSPSE 256          

HSP 2 Score: 224.942 bits (572), Expect = 5.732e-65
Identity = 106/160 (66.25%), Postives = 131/160 (81.88%), Query Frame = 1
Query:  979 LFSGLQILTAVFGGFAHGGNDVSNAIGPLVGLWIIGLTQDLSSKMAIPIWILLYGGFGITIGLWIWGRRVIKTMGDELTTITPSSGVCIELGSAITVTVASNIGLPISTTHCKVGSIVAVGRYRSNENVDWKIFRHICFAWFITLPVTGGVSALIMFCLK 1458
            LF  LQILTA FG FAHGGNDVSNAIGPLV L+++  + D+++K A PIW+LLYGG GI IGLW+WGRRVI+TMG +LT ITPSSG  IEL SA+TV +ASN+GLPISTTHCKVGS+V+VG  RS + VDW++FR+I  AWF+T+P++G +SA IM   K
Sbjct:  504 LFQFLQILTACFGSFAHGGNDVSNAIGPLVALYLVYESGDVTTKAATPIWLLLYGGVGICIGLWVWGRRVIQTMGKDLTPITPSSGFSIELASALTVVIASNVGLPISTTHCKVGSVVSVGWLRSKKAVDWRLFRNIFLAWFVTVPISGLISAAIMAVFK 663          
BLAST of slc20a-1 vs. Ensembl Mouse
Match: Slc20a1 (solute carrier family 20, member 1 [Source:MGI Symbol;Acc:MGI:108392])

HSP 1 Score: 273.478 bits (698), Expect = 3.902e-83
Identity = 134/270 (49.63%), Postives = 195/270 (72.22%), Query Frame = 1
Query:   73 NQIWIIVVGFLIAFILAFGIGANDVANSFGTSVGSKVLTLKQACVLASIFEILGSILLGAKVSDTIRKGVILPEYYN-TQNMTDGIRIMMMGQLSSLSGACVWMMIATFFKLPVSGSHSIVGAVVGFALIIHGVKGIDWVKVGFIVASWFISPILSGSVSVLTFFIFDRFILKKSDPLEPGLTFLPFIYSITILINAFSIFISGPPLLGFDKIPLYGTFIASFGLAIITILVVRFVAVPYLRKKIQSNCSTATAKMSFGNGSSYVEDNHN 879
            + +W++++GF+IAF+LAF +GANDVANSFGT+VGS V+TLKQAC+LASIFE +GS LLGAKVS+TIR G+I  E YN TQ++      +M G +S++ G+ VW ++A+F KLP+SG+H IVGA +GF+L+ +G KG+ W ++  IV SWF+SP+LSG +S + FF+   FIL+K+DP+  GL  LP  Y+ TI IN FSI  +G PLLGFDK+PL+GT + S G A+   L+V F   P +++KI+    ++ ++       S ++++H 
Sbjct:   24 DNLWMLILGFIIAFVLAFSVGANDVANSFGTAVGSGVVTLKQACILASIFETVGSALLGAKVSETIRNGLIDVELYNETQDL------LMAGSVSAMFGSAVWQLVASFLKLPISGTHCIVGATIGFSLVANGQKGVKWSELIKIVMSWFVSPLLSGIMSGILFFLVRAFILRKADPVPNGLRALPIFYACTIGINLFSIMYTGAPLLGFDKLPLWGTILISVGCAVFCALIVWFFVCPRMKRKIEREVKSSPSESPLMEKKSNLKEDHE 287          

HSP 2 Score: 223.016 bits (567), Expect = 3.076e-64
Identity = 107/160 (66.88%), Postives = 130/160 (81.25%), Query Frame = 1
Query:  979 LFSGLQILTAVFGGFAHGGNDVSNAIGPLVGLWIIGLTQDLSSKMAIPIWILLYGGFGITIGLWIWGRRVIKTMGDELTTITPSSGVCIELGSAITVTVASNIGLPISTTHCKVGSIVAVGRYRSNENVDWKIFRHICFAWFITLPVTGGVSALIMFCLK 1458
            LF  LQILTA FG FAHGGNDVSNAIGPLV L+++   Q+ S+K A PIW+LLYGG GI +GLW+WGRRVI+TMG +LT ITPSSG  IEL SA+TV +ASNIGLPISTTHCKVGS+V+VG  RS + VDW++FR+I  AWF+T+P++G +SA IM   K
Sbjct:  517 LFQFLQILTACFGSFAHGGNDVSNAIGPLVALYLV-YKQEASTKAATPIWLLLYGGVGICMGLWVWGRRVIQTMGKDLTPITPSSGFSIELASALTVVIASNIGLPISTTHCKVGSVVSVGWLRSKKAVDWRLFRNIFMAWFVTVPISGVISAAIMAVFK 675          
BLAST of slc20a-1 vs. Ensembl Mouse
Match: Slc20a1 (solute carrier family 20, member 1 [Source:MGI Symbol;Acc:MGI:108392])

HSP 1 Score: 273.478 bits (698), Expect = 3.902e-83
Identity = 134/270 (49.63%), Postives = 195/270 (72.22%), Query Frame = 1
Query:   73 NQIWIIVVGFLIAFILAFGIGANDVANSFGTSVGSKVLTLKQACVLASIFEILGSILLGAKVSDTIRKGVILPEYYN-TQNMTDGIRIMMMGQLSSLSGACVWMMIATFFKLPVSGSHSIVGAVVGFALIIHGVKGIDWVKVGFIVASWFISPILSGSVSVLTFFIFDRFILKKSDPLEPGLTFLPFIYSITILINAFSIFISGPPLLGFDKIPLYGTFIASFGLAIITILVVRFVAVPYLRKKIQSNCSTATAKMSFGNGSSYVEDNHN 879
            + +W++++GF+IAF+LAF +GANDVANSFGT+VGS V+TLKQAC+LASIFE +GS LLGAKVS+TIR G+I  E YN TQ++      +M G +S++ G+ VW ++A+F KLP+SG+H IVGA +GF+L+ +G KG+ W ++  IV SWF+SP+LSG +S + FF+   FIL+K+DP+  GL  LP  Y+ TI IN FSI  +G PLLGFDK+PL+GT + S G A+   L+V F   P +++KI+    ++ ++       S ++++H 
Sbjct:   24 DNLWMLILGFIIAFVLAFSVGANDVANSFGTAVGSGVVTLKQACILASIFETVGSALLGAKVSETIRNGLIDVELYNETQDL------LMAGSVSAMFGSAVWQLVASFLKLPISGTHCIVGATIGFSLVANGQKGVKWSELIKIVMSWFVSPLLSGIMSGILFFLVRAFILRKADPVPNGLRALPIFYACTIGINLFSIMYTGAPLLGFDKLPLWGTILISVGCAVFCALIVWFFVCPRMKRKIEREVKSSPSESPLMEKKSNLKEDHE 287          

HSP 2 Score: 223.016 bits (567), Expect = 3.076e-64
Identity = 107/160 (66.88%), Postives = 130/160 (81.25%), Query Frame = 1
Query:  979 LFSGLQILTAVFGGFAHGGNDVSNAIGPLVGLWIIGLTQDLSSKMAIPIWILLYGGFGITIGLWIWGRRVIKTMGDELTTITPSSGVCIELGSAITVTVASNIGLPISTTHCKVGSIVAVGRYRSNENVDWKIFRHICFAWFITLPVTGGVSALIMFCLK 1458
            LF  LQILTA FG FAHGGNDVSNAIGPLV L+++   Q+ S+K A PIW+LLYGG GI +GLW+WGRRVI+TMG +LT ITPSSG  IEL SA+TV +ASNIGLPISTTHCKVGS+V+VG  RS + VDW++FR+I  AWF+T+P++G +SA IM   K
Sbjct:  517 LFQFLQILTACFGSFAHGGNDVSNAIGPLVALYLV-YKQEASTKAATPIWLLLYGGVGICMGLWVWGRRVIQTMGKDLTPITPSSGFSIELASALTVVIASNIGLPISTTHCKVGSVVSVGWLRSKKAVDWRLFRNIFMAWFVTVPISGVISAAIMAVFK 675          
BLAST of slc20a-1 vs. Ensembl Mouse
Match: Slc20a2 (solute carrier family 20, member 2 [Source:MGI Symbol;Acc:MGI:97851])

HSP 1 Score: 245.743 bits (626), Expect = 6.289e-73
Identity = 123/254 (48.43%), Postives = 178/254 (70.08%), Query Frame = 1
Query:   70 DNQIWIIVVGFLIAFILAFGIGANDVANSFGTSVGSKVLTLKQACVLASIFEILGSILLGAKVSDTIRKGVILPEYYNTQNMTDGIRIMMMGQLSSLSGACVWMMIATFFKLPVSGSHSIVGAVVGFALIIHGVKGIDWVKVGFIVASWFISPILSGSVSVLTFFIFDRFILKKSDPLEPGLTFLPFIYSITILINAFSIFISGPPLLGFDKIPLYGTFIASFGLAIITILVVRFVAVPYLRKKIQSNCSTATA 831
            D  +W++++GF+IAFILAF +GANDVANSFGT+VGS V+TL+QAC+LASIFE  GS+LLGAKV +TIRKG+I    YN     + +  +M G++S++ G+ VW +IA+F +LP+SG+H IVG+ +GF+L+  G KG+ W+++  IVASWFISP+LSG +S + F +   FIL K DP+  GL  LP  Y+ TI IN FSI  +G P+LG   +P++   + SFG+A++    V     P++++KI       +A
Sbjct:    4 DGYLWMVILGFIIAFILAFSVGANDVANSFGTAVGSGVVTLRQACILASIFETTGSVLLGAKVGETIRKGIIDVNLYN-----ETVETLMAGEVSAMVGSAVWQLIASFLRLPISGTHCIVGSTIGFSLVAIGPKGVQWMELVKIVASWFISPLLSGFMSGVLFILIRMFILTKEDPVPNGLQALPLFYAATIAINVFSIMYTGAPVLGLS-LPIWAIALISFGVALLFAFFVWLFVCPWMKRKIAGRLEKESA 251          

HSP 2 Score: 214.542 bits (545), Expect = 2.102e-61
Identity = 104/159 (65.41%), Postives = 123/159 (77.36%), Query Frame = 1
Query:  979 LFSGLQILTAVFGGFAHGGNDVSNAIGPLVGLWIIGLTQDLSSKMAIPIWILLYGGFGITIGLWIWGRRVIKTMGDELTTITPSSGVCIELGSAITVTVASNIGLPISTTHCKVGSIVAVGRYRSNENVDWKIFRHICFAWFITLPVTGGVSALIMFCL 1455
            LF  LQ+LTA FG FAHGGNDVSNAIGPLV LW+I     ++ + A P+W+L YGG GI  GLW+WGRRVI+TMG +LT ITPSSG  IEL SA TV +ASNIGLP+STTHCKVGS+VAVG  RS + VDW++FR+I  AWF+T+PV G  SA IM  L
Sbjct:  487 LFHFLQVLTACFGSFAHGGNDVSNAIGPLVALWLIYQQGGVTQEAATPVWLLFYGGVGICTGLWVWGRRVIQTMGKDLTPITPSSGFTIELASAFTVVIASNIGLPVSTTHCKVGSVVAVGWIRSRKAVDWRLFRNIFVAWFVTVPVAGLFSAAIMALL 645          
BLAST of slc20a-1 vs. UniProt/SwissProt
Match: sp|Q9JJP0|S20A1_RAT (Sodium-dependent phosphate transporter 1 OS=Rattus norvegicus OX=10116 GN=Slc20a1 PE=1 SV=1)

HSP 1 Score: 277.33 bits (708), Expect = 7.539e-84
Identity = 140/279 (50.18%), Postives = 199/279 (71.33%), Query Frame = 1
Query:   73 NQIWIIVVGFLIAFILAFGIGANDVANSFGTSVGSKVLTLKQACVLASIFEILGSILLGAKVSDTIRKGVILPEYYN-TQNMTDGIRIMMMGQLSSLSGACVWMMIATFFKLPVSGSHSIVGAVVGFALIIHGVKGIDWVKVGFIVASWFISPILSGSVSVLTFFIFDRFILKKSDPLEPGLTFLPFIYSITILINAFSIFISGPPLLGFDKIPLYGTFIASFGLAIITILVVRFVAVPYLRKKIQSNCSTATAKMSFGNGSSYVEDNHNLNGHVETHL 906
            + +W++++GF+IAF+LAF +GANDVANSFGT+VGS V+TLKQAC+LASIFE +GS LLGAKVS+TIRKG+I  E YN TQ++      +M G +S++ G+ VW ++A+F KLP+SG+H IVGA +GF+L+  G +GI W ++  IV SWF+SP+LSG +S + FF+   FIL+K+DP+  GL  LP  Y+ TI IN FSI  +G PLLGFDK+PL+GT + S G A+   L+V F   P +++KI+    ++ ++      S  +E  +NL  H ET +
Sbjct:   24 DNLWMLILGFIIAFVLAFSVGANDVANSFGTAVGSGVVTLKQACILASIFETVGSALLGAKVSETIRKGLIDVEKYNATQDL------LMAGSVSAMFGSAVWQLVASFLKLPISGTHCIVGATIGFSLVAKGQEGIKWSELIKIVMSWFVSPLLSGIMSGILFFLVRAFILRKADPVPNGLRALPIFYACTIGINLFSIMYTGAPLLGFDKLPLWGTILISVGCAVFCALIVWFFVCPRMKRKIEREVKSSPSE------SPLMEKKNNLKDHEETKM 290          

HSP 2 Score: 226.483 bits (576), Expect = 1.183e-64
Identity = 108/160 (67.50%), Postives = 131/160 (81.88%), Query Frame = 1
Query:  979 LFSGLQILTAVFGGFAHGGNDVSNAIGPLVGLWIIGLTQDLSSKMAIPIWILLYGGFGITIGLWIWGRRVIKTMGDELTTITPSSGVCIELGSAITVTVASNIGLPISTTHCKVGSIVAVGRYRSNENVDWKIFRHICFAWFITLPVTGGVSALIMFCLK 1458
            LF  LQILTA FG FAHGGNDVSNAIGPLV L+++  T+D+++K A PIW+LLYGG GI +GLW+WGRRVI+TMG +LT ITPSSG  IEL SA TV VASNIGLPISTTHCKVGS+V+VG  RS + VDW++FR+I  AWF+T+P++G +SA IM   K
Sbjct:  516 LFQFLQILTACFGSFAHGGNDVSNAIGPLVALYLVYETRDVTTKEATPIWLLLYGGVGICMGLWVWGRRVIQTMGKDLTPITPSSGFSIELASAFTVVVASNIGLPISTTHCKVGSVVSVGWLRSKKAVDWRLFRNIFMAWFVTVPISGVISAAIMAVFK 675          
BLAST of slc20a-1 vs. UniProt/SwissProt
Match: sp|Q6NV12|S20AA_DANRE (Sodium-dependent phosphate transporter 1-A OS=Danio rerio OX=7955 GN=slc20a1a PE=2 SV=1)

HSP 1 Score: 274.248 bits (700), Expect = 7.298e-83
Identity = 135/275 (49.09%), Postives = 197/275 (71.64%), Query Frame = 1
Query:   79 IWIIVVGFLIAFILAFGIGANDVANSFGTSVGSKVLTLKQACVLASIFEILGSILLGAKVSDTIRKGVILPEYYNTQNMTDGIRIMMMGQLSSLSGACVWMMIATFFKLPVSGSHSIVGAVVGFALIIHGVKGIDWVKVGFIVASWFISPILSGSVSVLTFFIFDRFILKKSDPLEPGLTFLPFIYSITILINAFSIFISGPPLLGFDKIPLYGTFIASFGLAIITILVVRFVAVPYLRKKIQSNCSTATAKMSFGNGSSYVEDNHNLNGHVETH 903
            +W++++GF+IAFILAF +GANDVANSFGT+VGS V+TL+QAC+LA+IFE +G++LLGAKVS+TIR G+I    YN         ++M G +S++ G+ VW + A+F KLP+SG+H IVGA +GF+++  G +G+ W+++  IVASWF+SP+LSG +S + F+   +FIL K DP+  GL  LP  Y++T+ IN FSI  +G P+LGFD+IP +GT + S G AI+T LVV F+  P L+KK+QS C      ++  +G+  VE   + NG ++ H
Sbjct:   27 LWLLILGFVIAFILAFSVGANDVANSFGTAVGSGVVTLRQACILATIFETVGAMLLGAKVSETIRSGIIDVHMYNGSEA-----VLMAGSISAMFGSAVWQLAASFLKLPISGTHCIVGATIGFSMVARGHQGVKWLELLRIVASWFLSPLLSGIMSAVLFYFVRKFILNKDDPVPNGLRALPVFYAVTMGINLFSIMFTGAPMLGFDRIPWWGTLLISLGCAILTALVVWFIVCPRLKKKMQSKC--LGPNIADTSGTQLVEKKPSSNGLMDHH 294          

HSP 2 Score: 217.624 bits (553), Expect = 1.241e-61
Identity = 107/160 (66.88%), Postives = 125/160 (78.12%), Query Frame = 1
Query:  967 EQCELFSGLQILTAVFGGFAHGGNDVSNAIGPLVGLWIIGLTQDLSSKMAIPIWILLYGGFGITIGLWIWGRRVIKTMGDELTTITPSSGVCIELGSAITVTVASNIGLPISTTHCKVGSIVAVGRYRSNENVDWKIFRHICFAWFITLPVTGGVSALIM 1446
            E   LF  LQILTA FG FAHGGNDVSNAIGPLV LW+I  +  ++     PIW+LLYGG GI  GLWIWGRRVI+TMG +LT ITPSSG  IEL SAITV VASNIGLP+STTHCKVGS+V+VG  RS + VDW +FR+I  AWF+T+P++G +SA IM
Sbjct:  482 EVSTLFQFLQILTACFGSFAHGGNDVSNAIGPLVALWLIYDSASVAPSAPTPIWLLLYGGVGICTGLWIWGRRVIQTMGKDLTPITPSSGFSIELASAITVVVASNIGLPVSTTHCKVGSVVSVGWLRSRKAVDWHLFRNIFIAWFVTVPISGLISAAIM 641          
BLAST of slc20a-1 vs. UniProt/SwissProt
Match: sp|O97596|S20A1_FELCA (Sodium-dependent phosphate transporter 1 OS=Felis catus OX=9685 GN=Slc20a1 PE=2 SV=2)

HSP 1 Score: 275.018 bits (702), Expect = 7.433e-83
Identity = 132/269 (49.07%), Postives = 195/269 (72.49%), Query Frame = 1
Query:   73 NQIWIIVVGFLIAFILAFGIGANDVANSFGTSVGSKVLTLKQACVLASIFEILGSILLGAKVSDTIRKGVILPEYYNTQNMTDGIRIMMMGQLSSLSGACVWMMIATFFKLPVSGSHSIVGAVVGFALIIHGVKGIDWVKVGFIVASWFISPILSGSVSVLTFFIFDRFILKKSDPLEPGLTFLPFIYSITILINAFSIFISGPPLLGFDKIPLYGTFIASFGLAIITILVVRFVAVPYLRKKIQSNCSTATAKMSFGNGSSYVEDNHN 879
            + +W++++GF+IAF+LAF +GANDVANSFGT+VGS V+TLKQAC+LASIFE +GS+LLGAKVS+TIRKG+I  E YNT       +++M G +S++ G+ VW ++A+F KLP+SG+H IVGA +GF+L+  G +G+ W ++  IV SWFISP+LSG +S + FF+   FIL+K+DP+  GL  LP  Y+ T+ IN FSI  +G PLLGFDK+PL+GT + S G A+   L+V F   P +++KI+    ++ ++       + ++++H 
Sbjct:   24 DYLWMLILGFIIAFVLAFSVGANDVANSFGTAVGSGVVTLKQACILASIFETVGSVLLGAKVSETIRKGLIDVEMYNTTQ-----QLLMAGSVSAMFGSAVWQLVASFLKLPISGTHCIVGATIGFSLVAKGQEGVKWSELIKIVMSWFISPLLSGIMSGILFFLVRAFILRKTDPVPNGLRALPVFYACTVGINLFSIMYTGAPLLGFDKLPLWGTILISVGCAVFCALIVWFFVCPRMKRKIEREIKSSPSESPLMEKKNSLKEDHE 287          

HSP 2 Score: 228.794 bits (582), Expect = 1.301e-65
Identity = 110/160 (68.75%), Postives = 132/160 (82.50%), Query Frame = 1
Query:  979 LFSGLQILTAVFGGFAHGGNDVSNAIGPLVGLWIIGLTQDLSSKMAIPIWILLYGGFGITIGLWIWGRRVIKTMGDELTTITPSSGVCIELGSAITVTVASNIGLPISTTHCKVGSIVAVGRYRSNENVDWKIFRHICFAWFITLPVTGGVSALIMFCLK 1458
            LF  LQILTA FG FAHGGNDVSNAIGPLV L+++  T D+SSK+A PIW+LLYGG GI IGLW+WGRRVI+TMG +LT ITPSSG  IEL SA+TV +ASNIGLPISTTHCKVGS+V+VG  RS + VDW++FR+I  AWF+T+P++G +SA IM   K
Sbjct:  518 LFQFLQILTACFGSFAHGGNDVSNAIGPLVALYLVYDTGDVSSKVATPIWLLLYGGVGICIGLWVWGRRVIQTMGKDLTPITPSSGFSIELASALTVVIASNIGLPISTTHCKVGSVVSVGWLRSKKAVDWRLFRNIFMAWFVTVPISGVISAAIMAVFK 677          
BLAST of slc20a-1 vs. UniProt/SwissProt
Match: sp|Q61609|S20A1_MOUSE (Sodium-dependent phosphate transporter 1 OS=Mus musculus OX=10090 GN=Slc20a1 PE=1 SV=1)

HSP 1 Score: 273.478 bits (698), Expect = 2.729e-82
Identity = 134/270 (49.63%), Postives = 195/270 (72.22%), Query Frame = 1
Query:   73 NQIWIIVVGFLIAFILAFGIGANDVANSFGTSVGSKVLTLKQACVLASIFEILGSILLGAKVSDTIRKGVILPEYYN-TQNMTDGIRIMMMGQLSSLSGACVWMMIATFFKLPVSGSHSIVGAVVGFALIIHGVKGIDWVKVGFIVASWFISPILSGSVSVLTFFIFDRFILKKSDPLEPGLTFLPFIYSITILINAFSIFISGPPLLGFDKIPLYGTFIASFGLAIITILVVRFVAVPYLRKKIQSNCSTATAKMSFGNGSSYVEDNHN 879
            + +W++++GF+IAF+LAF +GANDVANSFGT+VGS V+TLKQAC+LASIFE +GS LLGAKVS+TIR G+I  E YN TQ++      +M G +S++ G+ VW ++A+F KLP+SG+H IVGA +GF+L+ +G KG+ W ++  IV SWF+SP+LSG +S + FF+   FIL+K+DP+  GL  LP  Y+ TI IN FSI  +G PLLGFDK+PL+GT + S G A+   L+V F   P +++KI+    ++ ++       S ++++H 
Sbjct:   24 DNLWMLILGFIIAFVLAFSVGANDVANSFGTAVGSGVVTLKQACILASIFETVGSALLGAKVSETIRNGLIDVELYNETQDL------LMAGSVSAMFGSAVWQLVASFLKLPISGTHCIVGATIGFSLVANGQKGVKWSELIKIVMSWFVSPLLSGIMSGILFFLVRAFILRKADPVPNGLRALPIFYACTIGINLFSIMYTGAPLLGFDKLPLWGTILISVGCAVFCALIVWFFVCPRMKRKIEREVKSSPSESPLMEKKSNLKEDHE 287          

HSP 2 Score: 223.016 bits (567), Expect = 2.151e-63
Identity = 107/160 (66.88%), Postives = 130/160 (81.25%), Query Frame = 1
Query:  979 LFSGLQILTAVFGGFAHGGNDVSNAIGPLVGLWIIGLTQDLSSKMAIPIWILLYGGFGITIGLWIWGRRVIKTMGDELTTITPSSGVCIELGSAITVTVASNIGLPISTTHCKVGSIVAVGRYRSNENVDWKIFRHICFAWFITLPVTGGVSALIMFCLK 1458
            LF  LQILTA FG FAHGGNDVSNAIGPLV L+++   Q+ S+K A PIW+LLYGG GI +GLW+WGRRVI+TMG +LT ITPSSG  IEL SA+TV +ASNIGLPISTTHCKVGS+V+VG  RS + VDW++FR+I  AWF+T+P++G +SA IM   K
Sbjct:  517 LFQFLQILTACFGSFAHGGNDVSNAIGPLVALYLV-YKQEASTKAATPIWLLLYGGVGICMGLWVWGRRVIQTMGKDLTPITPSSGFSIELASALTVVIASNIGLPISTTHCKVGSVVSVGWLRSKKAVDWRLFRNIFMAWFVTVPISGVISAAIMAVFK 675          
BLAST of slc20a-1 vs. UniProt/SwissProt
Match: sp|Q6PFM1|S20AB_DANRE (Sodium-dependent phosphate transporter 1-B OS=Danio rerio OX=7955 GN=slc20a1b PE=2 SV=1)

HSP 1 Score: 270.011 bits (689), Expect = 3.212e-81
Identity = 132/256 (51.56%), Postives = 186/256 (72.66%), Query Frame = 1
Query:   73 NQIWIIVVGFLIAFILAFGIGANDVANSFGTSVGSKVLTLKQACVLASIFEILGSILLGAKVSDTIRKGVILPEYYNTQNMTDGIRIMMMGQLSSLSGACVWMMIATFFKLPVSGSHSIVGAVVGFALIIHGVKGIDWVKVGFIVASWFISPILSGSVSVLTFFIFDRFILKKSDPLEPGLTFLPFIYSITILINAFSIFISGPPLLGFDKIPLYGTFIASFGLAIITILVVRFVAVPYLRKKIQSNCSTATAKMS 840
            + +W+++VGF+IAF+LAF +GANDVANSFGT+VGS V+TL+QAC+LASIFE LGS+LLGAKVS+TIRKG+I    Y      D   ++M G +S++ G+ VW + A+F KLP+SG+H IVGA +GF+L+  G +G+ W+++  IVASWF+SP+LSG +S + F+    FIL+K DP+  GL  LPF Y++T+ IN FSI  +G P+LGFDK+P +G  + S G  IIT L+V F   P L+KKI+    +++   S
Sbjct:   25 DYMWLLIVGFIIAFVLAFSVGANDVANSFGTAVGSGVVTLRQACILASIFETLGSVLLGAKVSETIRKGIIDVTMYK-----DIEHVLMAGSVSAMFGSAVWQLAASFLKLPISGTHCIVGATIGFSLVAKGQQGVKWLELLRIVASWFLSPLLSGVMSAVLFYFVRMFILQKKDPVPNGLRALPFFYAVTMGINLFSIMFTGAPMLGFDKLPWWGVLLISIGFGIITALIVWFAVCPRLKKKIECEVKSSSPSES 275          

HSP 2 Score: 219.935 bits (559), Expect = 2.354e-62
Identity = 106/160 (66.25%), Postives = 127/160 (79.38%), Query Frame = 1
Query:  967 EQCELFSGLQILTAVFGGFAHGGNDVSNAIGPLVGLWIIGLTQDLSSKMAIPIWILLYGGFGITIGLWIWGRRVIKTMGDELTTITPSSGVCIELGSAITVTVASNIGLPISTTHCKVGSIVAVGRYRSNENVDWKIFRHICFAWFITLPVTGGVSALIM 1446
            E   LF  LQILTA FG FAHGGNDVSNAIGPLV LW++  +  + S    PIW+LLYGG GI +GLW+WGRRVI+TMG +LT ITPSSG  IEL SA+TV VASNIGLP+STTHCKVGS+VAVG  RS + VDW++FR+I  AWF+T+P++G +SA IM
Sbjct:  498 EVSMLFQFLQILTACFGSFAHGGNDVSNAIGPLVALWLVYESGSVISSAPTPIWLLLYGGVGICVGLWVWGRRVIQTMGRDLTPITPSSGFSIELASAVTVVVASNIGLPVSTTHCKVGSVVAVGWLRSRKAVDWRLFRNIFMAWFVTVPISGLISAAIM 657          
BLAST of slc20a-1 vs. TrEMBL
Match: A0A0H3YJ89 (Phosphate transporter OS=Schmidtea mediterranea OX=79327 GN=slc20a-1 PE=2 SV=1)

HSP 1 Score: 905.205 bits (2338), Expect = 0.000e+0
Identity = 471/471 (100.00%), Postives = 471/471 (100.00%), Query Frame = 1
Query:   58 MLFPDNQIWIIVVGFLIAFILAFGIGANDVANSFGTSVGSKVLTLKQACVLASIFEILGSILLGAKVSDTIRKGVILPEYYNTQNMTDGIRIMMMGQLSSLSGACVWMMIATFFKLPVSGSHSIVGAVVGFALIIHGVKGIDWVKVGFIVASWFISPILSGSVSVLTFFIFDRFILKKSDPLEPGLTFLPFIYSITILINAFSIFISGPPLLGFDKIPLYGTFIASFGLAIITILVVRFVAVPYLRKKIQSNCSTATAKMSFGNGSSYVEDNHNLNGHVETHLDNNIVHXXXXXXXXXXXXXXEQCELFSGLQILTAVFGGFAHGGNDVSNAIGPLVGLWIIGLTQDLSSKMAIPIWILLYGGFGITIGLWIWGRRVIKTMGDELTTITPSSGVCIELGSAITVTVASNIGLPISTTHCKVGSIVAVGRYRSNENVDWKIFRHICFAWFITLPVTGGVSALIMFCLKKWAV 1470
            MLFPDNQIWIIVVGFLIAFILAFGIGANDVANSFGTSVGSKVLTLKQACVLASIFEILGSILLGAKVSDTIRKGVILPEYYNTQNMTDGIRIMMMGQLSSLSGACVWMMIATFFKLPVSGSHSIVGAVVGFALIIHGVKGIDWVKVGFIVASWFISPILSGSVSVLTFFIFDRFILKKSDPLEPGLTFLPFIYSITILINAFSIFISGPPLLGFDKIPLYGTFIASFGLAIITILVVRFVAVPYLRKKIQSNCSTATAKMSFGNGSSYVEDNHNLNGHVETHLDNNIVHIITKPKHIPIKDKPEQCELFSGLQILTAVFGGFAHGGNDVSNAIGPLVGLWIIGLTQDLSSKMAIPIWILLYGGFGITIGLWIWGRRVIKTMGDELTTITPSSGVCIELGSAITVTVASNIGLPISTTHCKVGSIVAVGRYRSNENVDWKIFRHICFAWFITLPVTGGVSALIMFCLKKWAV
Sbjct:    1 MLFPDNQIWIIVVGFLIAFILAFGIGANDVANSFGTSVGSKVLTLKQACVLASIFEILGSILLGAKVSDTIRKGVILPEYYNTQNMTDGIRIMMMGQLSSLSGACVWMMIATFFKLPVSGSHSIVGAVVGFALIIHGVKGIDWVKVGFIVASWFISPILSGSVSVLTFFIFDRFILKKSDPLEPGLTFLPFIYSITILINAFSIFISGPPLLGFDKIPLYGTFIASFGLAIITILVVRFVAVPYLRKKIQSNCSTATAKMSFGNGSSYVEDNHNLNGHVETHLDNNIVHIITKPKHIPIKDKPEQCELFSGLQILTAVFGGFAHGGNDVSNAIGPLVGLWIIGLTQDLSSKMAIPIWILLYGGFGITIGLWIWGRRVIKTMGDELTTITPSSGVCIELGSAITVTVASNIGLPISTTHCKVGSIVAVGRYRSNENVDWKIFRHICFAWFITLPVTGGVSALIMFCLKKWAV 471          
BLAST of slc20a-1 vs. TrEMBL
Match: A0A1I8GFH2 (Phosphate transporter OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig001071g2 PE=3 SV=1)

HSP 1 Score: 541.576 bits (1394), Expect = 0.000e+0
Identity = 272/497 (54.73%), Postives = 356/497 (71.63%), Query Frame = 1
Query:   55 YMLFPDNQIWIIVVGFLIAFILAFGIGANDVANSFGTSVGSKVLTLKQACVLASIFEILGSILLGAKVSDTIRKGVILPEYY----NTQNMTDGIRIMMMGQLSSLSGACVWMMIATFFKLPVSGSHSIVGAVVGFALIIHGVKGIDWVKVGFIVASWFISPILSGSVSVLTFFIFDRFILKKSDPLEPGLTFLPFIYSITILINAFSIFISGPPLLGFDKIPLYGTFIASFGLAIITILVVRFVAVPYLRKKIQSNCSTATAKMSFGNGSSYVEDNHNLNGH--------------VETHLDNNIVHXXXXX----------XXXXXXXXXEQCELFSGLQILTAVFGGFAHGGNDVSNAIGPLVGLWIIGLTQDLSSKMAIPIWILLYGGFGITIGLWIWGRRVIKTMGDELTTITPSSGVCIELGSAITVTVASNIGLPISTTHCKVGSIVAVGRYRSNENVDWKIFRHICFAWFITLPVTGGVSALIMFCLKK 1461
            ++  P+  +WI+V+GF+IAF+LAFGIGANDVANSFGTSVGSKVLTLKQAC+LA+IFE  G++LLGAKVS+TIRKG+I  +YY    N    T G +++M+GQLSSLSG C+W+++ATFF++PVSG+HSIVGA VGFAL+ +   G+DW ++G IVASWFISP+LSG +S+  F+    FIL K D LEPGL FLP IYS+TI IN FS    GP  L F  IPL+G  +ASFG+ II  ++V+ V +P+ RK+I +       + S  +  S    +  L+ H              +E+  D   +    +               I D+PEQ  +F+ LQILTA+FG FAHGGNDVSNAIGPL+GLW++  T D++ K+A PIWIL+YGGFGI+IGLWIWGRRVI+T+G++LTTITPSSG CIELG+A+ V +ASNIG+PISTTHCKVGS+V VG +RS +NV+W IFR+I  AW +TLP +G +SA +M  L +
Sbjct:    6 FLGIPEEYLWIVVLGFIIAFVLAFGIGANDVANSFGTSVGSKVLTLKQACILATIFETAGAVLLGAKVSETIRKGIIDTDYYVELNNNGTSTTGSQLLMIGQLSSLSGTCIWLLVATFFRVPVSGTHSIVGATVGFALVANAQTGVDWARLGLIVASWFISPLLSGGISIALFYFIKVFILTKPDALEPGLRFLPLIYSVTIAINVFSTVYEGPESLYFHVIPLWGAILASFGVGIICSILVKLVLIPWQRKRIIAELRDNPPEESVADAPSEAGSSVALSSHSDSTTQQRKAKYKPIESAEDEEPIQSEQQQGAKGGKADNKSKKAIVDRPEQARIFAWLQILTAIFGAFAHGGNDVSNAIGPLIGLWVVATTGDIAGKVASPIWILVYGGFGISIGLWIWGRRVIQTLGEDLTTITPSSGFCIELGAAMAVLIASNIGIPISTTHCKVGSVVLVGFFRSRDNVEWSIFRNIIIAWLVTLPASGAISAALMAGLSR 502          
BLAST of slc20a-1 vs. TrEMBL
Match: T1FS88 (Phosphate transporter OS=Helobdella robusta OX=6412 GN=20211685 PE=3 SV=1)

HSP 1 Score: 517.694 bits (1332), Expect = 3.899e-177
Identity = 276/487 (56.67%), Postives = 348/487 (71.46%), Query Frame = 1
Query:   52 IYMLFPDNQIWIIVVGFLIAFILAFGIGANDVANSFGTSVGSKVLTLKQACVLASIFEILGSILLGAKVSDTIRKGVILPEYYNTQNMTDGIRIMMMGQLSSLSGACVWMMIATFFKLPVSGSHSIVGAVVGFALIIHGVKGIDWVKVGFIVASWFISPILSGSVSVLTFFIFDRFILKKSDPLEPGLTFLPFIYSITILINAFSIFISGPPLLGFDKIPLYGTFIASFGLAIITILVVRFVAVPYLRKKIQSNCST------------------ATAKMSFGNGSSYVEDNHNLNGHVETHLDNNIVHXXXXXXXXXXXXXXEQCELFSGLQILTAVFGGFAHGGNDVSNAIGPLVGLWIIGLTQDLSSKMAIPIWILLYGGFGITIGLWIWGRRVIKTMGDELTTITPSSGVCIELGSAITVTVASNIGLPISTTHCKVGSIVAVGRYRSNENVDWKIFRHICFAWFITLPVTGGVSALIMFCLK 1458
            I +  P +QIW+IVVGF IAF+LAFGIGANDVANSFGTSVGSKVLTL+QA +LASIFE LG++LLGAKVSDTIRKG+I    Y  QN T   +++M+G ++SLSG+CVW++ AT  +LPVS +HSIVG+ VGFAL+IHG  GI WVK+  I+ SWFISPIL+G VS++ F+   +FIL K  PLEPGL FLP  Y++TI++N FS+F  GP +L F+ IPL+GTFI SFG   I  +++ F  VP+ RKKIQ   S                   +T   S       ++ +H  + + E   D +      +     + D PE   LFS LQILTA+FG FAHGGNDVSN+IGPLV LW+IG T  +S + + PI ILLYGGFGI++GL + GR+VIKT+G++L  +TPSSG CIE+GSA+TV VASNIGLPISTTHCKVGS+V VGRYR+ ENVDW IFR+I  AW +TLP+ GGVSA IM  L+
Sbjct:    4 INVTVPQDQIWMIVVGFFIAFLLAFGIGANDVANSFGTSVGSKVLTLRQAFILASIFETLGAVLLGAKVSDTIRKGIIDLTPY--QNNT---KLLMLGNVASLSGSCVWLIAATLLRLPVSATHSIVGSTVGFALVIHGSNGIHWVKLATIITSWFISPILAGIVSIMLFWTCKKFILSKHQPLEPGLRFLPIFYAMTIVVNIFSVFYEGPEMLRFNLIPLWGTFIISFGAGTIGGIIIYFFIVPWQRKKIQEEVSRVSVVSTLLNMNDSEETGGSTNTTSIKMPKESIKKHHKFDENTEQS-DTSSTPTHLRQGRSTVTDAPEAARLFSFLQILTAIFGSFAHGGNDVSNSIGPLVSLWLIGTTGYISQETSTPILILLYGGFGISVGLVVLGRKVIKTIGEDLAKVTPSSGFCIEIGSALTVLVASNIGLPISTTHCKVGSVVFVGRYRARENVDWSIFRNIVLAWLVTLPICGGVSAAIMAGLR 484          
BLAST of slc20a-1 vs. TrEMBL
Match: A0A210QKP1 (Phosphate transporter OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT24012 PE=3 SV=1)

HSP 1 Score: 510.76 bits (1314), Expect = 3.264e-174
Identity = 261/476 (54.83%), Postives = 336/476 (70.59%), Query Frame = 1
Query:   49 LIYMLFPDNQIWIIVVGFLIAFILAFGIGANDVANSFGTSVGSKVLTLKQACVLASIFEILGSILLGAKVSDTIRKGVILPEYYNTQNMTDGIRIMMMGQLSSLSGACVWMMIATFFKLPVSGSHSIVGAVVGFALIIHGVKGIDWVKVGFIVASWFISPILSGSVSVLTFFIFDRFILKKSDPLEPGLTFLPFIYSITILINAFSIFISGPPLLGFDKIPLYGTFIASFGLAIITILVVRFVAVPYLRKKIQSNCSTA----TAKMSFGNGSSYVEDNHNLNGHV-ETHLDNNIVHXXXXXXXXXXXXXXEQCELFSGLQILTAVFGGFAHGGNDVSNAIGPLVGLWIIGLTQDLSSKMAIPIWILLYGGFGITIGLWIWGRRVIKTMGDELTTITPSSGVCIELGSAITVTVASNIGLPISTTHCKVGSIVAVGRYRSNENVDWKIFRHICFAWFITLPVTGGVSALIMFCLKK 1461
            L  M  P+  +W+++VGF+IAFIL+ GIGANDVANSFGTSVGS+VLTL+QAC+L SIFE+LG+IL+G +VSDTIRKG+I  E YN  +     +++M G +++L+G+CVW++ AT    PVS +HSIVGA +GF+L+  G  GI W+K+GFIV SWF SPILSG VS+LTF   ++ +L+K   LE GL  LPF Y +T  IN FSIF  G  LL FDKIPLYG F+ + GL+++  + VR   VP+ R+KI   C+        ++        + DN +L   V E  + +  +    K K        E  +LFS LQILTAVFG FAHGGNDVSN+IGPLV +W+I          + P+WIL+YGG GI IGLWIWGRRVIKT+GD+LT ITPSSG CIELGSA+TV +ASNIG+PISTTHCK+GS+V VGR RS ENVDWK+FR+I  AW +TLPV+G +SAL M  L++
Sbjct:   32 LANMEIPEEYLWMVIVGFIIAFILSCGIGANDVANSFGTSVGSRVLTLRQACILGSIFEMLGAILIGYRVSDTIRKGIIDVEMYNNGSE----KVLMAGNIATLTGSCVWLIAATIMCFPVSTTHSIVGAAIGFSLVAKGASGIKWIKIGFIVGSWFFSPILSGVVSLLTFMFINKMVLQKEKSLESGLMLLPFFYGLTAAINLFSIFYEGSNLLQFDKIPLYGVFVITCGLSLLVAIGVRVFVVPWSRRKITDECNQKIDEKNQEVENATELEQLNDNEDLPDIVFENEVPSKKIRESIKDKP-------EVVKLFSFLQILTAVFGSFAHGGNDVSNSIGPLVAIWMIAKEGTAMQASSTPLWILVYGGVGIVIGLWIWGRRVIKTVGDDLTKITPSSGFCIELGSALTVLIASNIGIPISTTHCKIGSVVFVGRVRSKENVDWKLFRNIIIAWVVTLPVSGAISALAMLGLQE 496          
BLAST of slc20a-1 vs. TrEMBL
Match: A0A210QKB7 (Phosphate transporter OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT24013 PE=3 SV=1)

HSP 1 Score: 508.449 bits (1308), Expect = 6.159e-174
Identity = 263/472 (55.72%), Postives = 338/472 (71.61%), Query Frame = 1
Query:   58 MLFPDNQIWIIVVGFLIAFILAFGIGANDVANSFGTSVGSKVLTLKQACVLASIFEILGSILLGAKVSDTIRKGVILPEYYNTQNMTDGIRIMMMGQLSSLSGACVWMMIATFFKLPVSGSHSIVGAVVGFALIIHGVKGIDWVKVGFIVASWFISPILSGSVSVLTFFIFDRFILKKSDPLEPGLTFLPFIYSITILINAFSIFISGPPLLGFDKIPLYGTFIASFGLAIITILVVRFVAVPYLRKKIQSNCST----ATAKMSFGNGSSYVEDNHNLNGHVETHLDNNIVHXXXXXXXXXXXXXXEQCELFSGLQILTAVFGGFAHGGNDVSNAIGPLVGLWIIGLTQDLSSKMAIPIWILLYGGFGITIGLWIWGRRVIKTMGDELTTITPSSGVCIELGSAITVTVASNIGLPISTTHCKVGSIVAVGRYRSNENVDWKIFRHICFAWFITLPVTGGVSALIMFCLKK 1461
            M  P+  +W+++VGF+IAFIL+ GIGANDVANSFGTSVGS+VLTL+QAC+L SIFE+LG+IL+G +VSDTIRKG+I  E YN  +     +++M G +S+L+G+CVWM+ AT  +LPVS +HSIVGA +GF+L+  G  GI W+K+G IV SWF+SPILSG VS+LTF   ++ +L+K   LE GL  LP  Y +T  INAFSIF  G  LL F+KIPLYG FI + GL+I+  + V F  VP+ R+KI   C+        ++        + DN +L    E   +  +     K     IKDKPE  +LFS LQILTAVFG FAHGGNDVSN+IGPLV +W+I          + P+W L+YGG GI IGLWIWGRRVIKT+GD+LT ITPSSG CIELGSA+TV +ASN+G+P+STTHCK+GS+V VGR RS  NVDWK+FR+I  AW +TLPV+GG+SAL M  L++
Sbjct:    1 MEIPEEYLWMVIVGFIIAFILSCGIGANDVANSFGTSVGSRVLTLRQACILGSIFEMLGAILIGYRVSDTIRKGIIDVEMYNNGSE----KVLMAGNISALTGSCVWMIAATIMRLPVSTTHSIVGAALGFSLVAKGASGIKWIKLGLIVGSWFVSPILSGVVSMLTFMFINKMVLQKEKALESGLMLLPLFYGLTAAINAFSIFYKGSNLLHFNKIPLYGVFIITCGLSILVAIGVSFFVVPWYRRKITDECNQKIDEKNQEVENATELEQLNDNEDLP---EIGFEKKVPR---KKIRESIKDKPEVVKLFSFLQILTAVFGSFAHGGNDVSNSIGPLVAIWMIAKEGTAMQTSSTPLWTLVYGGAGIVIGLWIWGRRVIKTVGDDLTKITPSSGFCIELGSALTVLIASNVGIPVSTTHCKIGSVVFVGRVRSKVNVDWKLFRNIIIAWVVTLPVSGGISALAMLGLQE 462          
BLAST of slc20a-1 vs. Ensembl Cavefish
Match: slc20a1a (sodium-dependent phosphate transporter 1-A-like [Source:NCBI gene;Acc:103027865])

HSP 1 Score: 264.233 bits (674), Expect = 3.123e-80
Identity = 133/290 (45.86%), Postives = 197/290 (67.93%), Query Frame = 1
Query:   79 IWIIVVGFLIAFILAFGIGANDVANSFGTSVGSKVLTLKQACVLASIFEILGSILLGAKVSDTIRKGVILPEYYNTQNMTDGIRIMMMGQLSSLSGACVWMMIATFFKLPVSGSHSIVGAVVGFALIIHGVKGIDWVKVGFIVASWFISPILSGSVSVLTFFIFDRFILKKSDPLEPGLTFLPFIYSITILINAFSIFISGPPLLGFDKIPLYGTFIASFGLAIITILVVRFVAVPYLRKKIQS-----NCS--------TATAKMSFGNGSSYVEDNHNLNGHVETHLD 909
            +W++++GF+IAFILAF +GANDVANSFGT+VGS V+TL+QAC+LA+IFE +G+ILLGAKVS+TIR G+I    YN         ++M G +S++ G+ VW ++A+F KLP+SG+H IVGA +GF+++  G +G+ W+++  IVASWF+SP+LSG +S + F+   +FIL K DP+  GL  LP  Y++T+ IN FSI  +G P+LGF+K+P +GT + S G A++T ++V FV  P L+KK++S     NC         T T++       S+  D+  L    +   D
Sbjct:   27 LWLLILGFIIAFILAFSVGANDVANSFGTAVGSGVVTLRQACILATIFETIGAILLGAKVSETIRSGIIDINMYNGSE-----PLLMAGSISAMFGSAVWQLVASFLKLPISGTHCIVGATIGFSMVARGYQGVRWLELLRIVASWFLSPLLSGMMSAVLFYTVRKFILNKDDPMVNGLRALPIFYAVTMGINLFSIMFTGAPMLGFNKVPWWGTLLISLGCALLTAVLVWFVVCPRLKKKVKSVVTSKNCEESLLEKAPTDTSRKHPETLRSHSPDSQTLVERTKATFD 311          

HSP 2 Score: 218.779 bits (556), Expect = 3.088e-63
Identity = 104/160 (65.00%), Postives = 126/160 (78.75%), Query Frame = 1
Query:  967 EQCELFSGLQILTAVFGGFAHGGNDVSNAIGPLVGLWIIGLTQDLSSKMAIPIWILLYGGFGITIGLWIWGRRVIKTMGDELTTITPSSGVCIELGSAITVTVASNIGLPISTTHCKVGSIVAVGRYRSNENVDWKIFRHICFAWFITLPVTGGVSALIM 1446
            E   LF  LQILTA FG FAHGGNDVSNAIGPL+ LW++     ++S    PIW+LLYGG GI +GLW+WGRRVI+TMG +LT ITPSSG  IEL SA+TV VASNIGLP+STTHCKVGS+VAVG  RS + VDW +FR+I  AWF+T+P++G +SA +M
Sbjct:  464 EVSMLFRFLQILTACFGSFAHGGNDVSNAIGPLIALWVVYKNASVTSNAPTPIWLLLYGGLGICMGLWVWGRRVIQTMGKDLTPITPSSGFSIELASAVTVVVASNIGLPVSTTHCKVGSVVAVGWLRSRKAVDWLLFRNIFIAWFVTVPISGLISAAVM 623          

HSP 3 Score: 51.6026 bits (122), Expect = 1.944e-6
Identity = 47/169 (27.81%), Postives = 77/169 (45.56%), Query Frame = 1
Query: 1018 GFAHGGNDVSNAIGPLVGLWIIGLTQDLSSKMAIPIWILLYGGFGITIGLWIWGRRVIKTMGDELTTITPSSG---------VCIELGSAITVTVASNIGLPISTTHCKVGSIVAVGRY-RSNENVDWKIFRHICFAWFITLPVTGGVSALIMFCLKKWAV*YFLNTLD 1494
             F+ G NDV+N+ G  VG  ++ L Q             +      TIG  + G +V +T+   +  I   +G         +    GSA+   VAS + LPIS THC VG+ +      R  + V W     I  +WF++  ++G +SA++ + ++K    + LN  D
Sbjct:   41 AFSVGANDVANSFGTAVGSGVVTLRQ-----------ACILATIFETIGAILLGAKVSETIRSGIIDINMYNGSEPLLMAGSISAMFGSAVWQLVASFLKLPISGTHCIVGATIGFSMVARGYQGVRWLELLRIVASWFLSPLLSGMMSAVLFYTVRK----FILNKDD 194          
BLAST of slc20a-1 vs. Ensembl Cavefish
Match: slc20a1b (solute carrier family 20 member 1 [Source:NCBI gene;Acc:103043057])

HSP 1 Score: 264.233 bits (674), Expect = 6.729e-80
Identity = 127/256 (49.61%), Postives = 186/256 (72.66%), Query Frame = 1
Query:   73 NQIWIIVVGFLIAFILAFGIGANDVANSFGTSVGSKVLTLKQACVLASIFEILGSILLGAKVSDTIRKGVILPEYYNTQNMTDGIRIMMMGQLSSLSGACVWMMIATFFKLPVSGSHSIVGAVVGFALIIHGVKGIDWVKVGFIVASWFISPILSGSVSVLTFFIFDRFILKKSDPLEPGLTFLPFIYSITILINAFSIFISGPPLLGFDKIPLYGTFIASFGLAIITILVVRFVAVPYLRKKIQSNCSTATAKMS 840
            + +W+++VGF+IAFILAF +GANDVANSFGT+VGS V+TLK ACVLA++FE LGS++LGAKVS+TIRKG+I    YN         ++M G +S++ G+ VW ++A+F KLP+SG+H IVGA +G++L+  G +G+ W ++  IVASWF+SP+LSG +S + F+    FIL+K DP+  GL  LP  Y++T+ IN FSI  +G P++GFDK+P +GT + S G AI+T ++V F   P L++KI+    +++   S
Sbjct:   25 DYMWLLIVGFIIAFILAFSVGANDVANSFGTAVGSGVVTLKVACVLATVFETLGSVMLGAKVSETIRKGIIDVNMYNGTE-----HVLMAGSVSAMVGSAVWQLVASFLKLPISGTHCIVGATIGYSLVAKGQQGVQWFQLLRIVASWFLSPLLSGLMSAILFYFVRMFILQKKDPVPNGLKALPVFYAVTMGINLFSIMFTGAPVMGFDKLPWWGTLLISIGCAILTGIIVWFAVCPCLKRKIEREIKSSSPSES 275          

HSP 2 Score: 220.705 bits (561), Expect = 1.129e-63
Identity = 105/156 (67.31%), Postives = 125/156 (80.13%), Query Frame = 1
Query:  979 LFSGLQILTAVFGGFAHGGNDVSNAIGPLVGLWIIGLTQDLSSKMAIPIWILLYGGFGITIGLWIWGRRVIKTMGDELTTITPSSGVCIELGSAITVTVASNIGLPISTTHCKVGSIVAVGRYRSNENVDWKIFRHICFAWFITLPVTGGVSALIM 1446
            LF  LQILTA FG FAHGGNDVSNAIGPLV LW++  +  + S    PIW+LLYGG GI  GLW+WGRRVI+TMG +LT ITPSSG  IEL SA+TV VASNIGLP+STTHCKVGS+VAVG  RS + VDW++FR+I  AWF+T+P++G +SA IM
Sbjct:  501 LFQFLQILTACFGSFAHGGNDVSNAIGPLVALWLVYESGSVESNAPTPIWLLLYGGVGICAGLWVWGRRVIQTMGKDLTPITPSSGFSIELASAVTVVVASNIGLPVSTTHCKVGSVVAVGWMRSRKAVDWRLFRNIFMAWFVTVPISGLISAAIM 656          
BLAST of slc20a-1 vs. Ensembl Cavefish
Match: slc20a2 (solute carrier family 20 member 2 [Source:NCBI gene;Acc:103032054])

HSP 1 Score: 247.669 bits (631), Expect = 9.502e-74
Identity = 121/245 (49.39%), Postives = 178/245 (72.65%), Query Frame = 1
Query:   79 IWIIVVGFLIAFILAFGIGANDVANSFGTSVGSKVLTLKQACVLASIFEILGSILLGAKVSDTIRKGVILPEYYNTQNMTDGIRIMMMGQLSSLSGACVWMMIATFFKLPVSGSHSIVGAVVGFALIIHGVKGIDWVKVGFIVASWFISPILSGSVSVLTFFIFDRFILKKSDPLEPGLTFLPFIYSITILINAFSIFISGPPLLGFDKIPLYGTFIASFGLAIITILVVRFVAVPYLRKKIQSN 813
            +W++++GF+IAF+LAF +GANDVANSFGT+VGS V+TL+QAC+LASIFE LGS+LLGAKV +TIRKG+I    YN     + + I+M G++S++ G+ VW +IA+F KLP+SG+H IVG+ +GF+++  G KG+ W+++  IVASWFISP+LSG +S L F++   FIL K DP+  GL  LP  Y+ TI IN FSI  +G P+LG + +P++   + +   +++   +V     P++R+KI S 
Sbjct:    7 LWMVIIGFIIAFVLAFSVGANDVANSFGTAVGSGVVTLRQACILASIFETLGSMLLGAKVGETIRKGIIDVSLYN-----ETVPILMAGEVSAMVGSAVWQLIASFLKLPISGTHCIVGSTIGFSMVAIGTKGVQWMQLVKIVASWFISPLLSGIMSGLLFYVIRYFILSKDDPVPNGLRALPLFYASTIGINTFSIMYTGAPMLGIEMLPVWAIALITLAGSLVCSALVWIFVCPWMRRKIASQ 246          

HSP 2 Score: 211.846 bits (538), Expect = 2.311e-60
Identity = 103/156 (66.03%), Postives = 120/156 (76.92%), Query Frame = 1
Query:  979 LFSGLQILTAVFGGFAHGGNDVSNAIGPLVGLWIIGLTQDLSSKMAIPIWILLYGGFGITIGLWIWGRRVIKTMGDELTTITPSSGVCIELGSAITVTVASNIGLPISTTHCKVGSIVAVGRYRSNENVDWKIFRHICFAWFITLPVTGGVSALIM 1446
            LF  LQILTA FG FAHGGNDVSNAIGPLV LW+I     +      P+W+L YGG GI  GLW+WGRRVI+TMG +LT ITPSSG  IEL SA+TV +ASNIGLPISTTHCKVGS+VAVG  RS + VDW++FR+I  AWF+T+PV G  SA +M
Sbjct:  496 LFHFLQILTACFGSFAHGGNDVSNAIGPLVALWMIYEQGGVMQNSTTPVWLLFYGGVGICAGLWVWGRRVIQTMGKDLTPITPSSGFTIELASAVTVVLASNIGLPISTTHCKVGSVVAVGWLRSQKAVDWRLFRNIFLAWFVTVPVAGLFSAAVM 651          

HSP 3 Score: 51.2174 bits (121), Expect = 2.103e-6
Identity = 52/166 (31.33%), Postives = 82/166 (49.40%), Query Frame = 1
Query: 1018 GFAHGGNDVSNAIGPLVGLWIIGLTQD--LSSKMAIPIWILLYGGFGITIGLWIWGRRVIKTMGDELTTITPSSGVCIELGSAITVTVASNIGLPISTTHCKVG-----SIVAVGRYRSNENVDWKIFRHICFAWFITLPVTGGVSALIMFCLKKWAV*YFLNTLD 1494
             F+ G NDV+N+ G  VG  ++ L Q   L+S       +LL    G TI   I    +  ++ +E   I  +  V   +GSA+   +AS + LPIS THC VG     S+VA+G     + V W     I  +WFI+  ++G +S L+ + ++     YF+ + D
Sbjct:   21 AFSVGANDVANSFGTAVGSGVVTLRQACILASIFETLGSMLLGAKVGETIRKGI----IDVSLYNETVPILMAGEVSAMVGSAVWQLIASFLKLPISGTHCIVGSTIGFSMVAIG----TKGVQWMQLVKIVASWFISPLLSGIMSGLLFYVIR-----YFILSKD 173          
BLAST of slc20a-1 vs. Ensembl Cavefish
Match: slc20a2 (solute carrier family 20 member 2 [Source:NCBI gene;Acc:103032054])

HSP 1 Score: 247.669 bits (631), Expect = 9.502e-74
Identity = 121/245 (49.39%), Postives = 178/245 (72.65%), Query Frame = 1
Query:   79 IWIIVVGFLIAFILAFGIGANDVANSFGTSVGSKVLTLKQACVLASIFEILGSILLGAKVSDTIRKGVILPEYYNTQNMTDGIRIMMMGQLSSLSGACVWMMIATFFKLPVSGSHSIVGAVVGFALIIHGVKGIDWVKVGFIVASWFISPILSGSVSVLTFFIFDRFILKKSDPLEPGLTFLPFIYSITILINAFSIFISGPPLLGFDKIPLYGTFIASFGLAIITILVVRFVAVPYLRKKIQSN 813
            +W++++GF+IAF+LAF +GANDVANSFGT+VGS V+TL+QAC+LASIFE LGS+LLGAKV +TIRKG+I    YN     + + I+M G++S++ G+ VW +IA+F KLP+SG+H IVG+ +GF+++  G KG+ W+++  IVASWFISP+LSG +S L F++   FIL K DP+  GL  LP  Y+ TI IN FSI  +G P+LG + +P++   + +   +++   +V     P++R+KI S 
Sbjct:    7 LWMVIIGFIIAFVLAFSVGANDVANSFGTAVGSGVVTLRQACILASIFETLGSMLLGAKVGETIRKGIIDVSLYN-----ETVPILMAGEVSAMVGSAVWQLIASFLKLPISGTHCIVGSTIGFSMVAIGTKGVQWMQLVKIVASWFISPLLSGIMSGLLFYVIRYFILSKDDPVPNGLRALPLFYASTIGINTFSIMYTGAPMLGIEMLPVWAIALITLAGSLVCSALVWIFVCPWMRRKIASQ 246          

HSP 2 Score: 211.846 bits (538), Expect = 2.311e-60
Identity = 103/156 (66.03%), Postives = 120/156 (76.92%), Query Frame = 1
Query:  979 LFSGLQILTAVFGGFAHGGNDVSNAIGPLVGLWIIGLTQDLSSKMAIPIWILLYGGFGITIGLWIWGRRVIKTMGDELTTITPSSGVCIELGSAITVTVASNIGLPISTTHCKVGSIVAVGRYRSNENVDWKIFRHICFAWFITLPVTGGVSALIM 1446
            LF  LQILTA FG FAHGGNDVSNAIGPLV LW+I     +      P+W+L YGG GI  GLW+WGRRVI+TMG +LT ITPSSG  IEL SA+TV +ASNIGLPISTTHCKVGS+VAVG  RS + VDW++FR+I  AWF+T+PV G  SA +M
Sbjct:  496 LFHFLQILTACFGSFAHGGNDVSNAIGPLVALWMIYEQGGVMQNSTTPVWLLFYGGVGICAGLWVWGRRVIQTMGKDLTPITPSSGFTIELASAVTVVLASNIGLPISTTHCKVGSVVAVGWLRSQKAVDWRLFRNIFLAWFVTVPVAGLFSAAVM 651          

HSP 3 Score: 51.2174 bits (121), Expect = 2.103e-6
Identity = 52/166 (31.33%), Postives = 82/166 (49.40%), Query Frame = 1
Query: 1018 GFAHGGNDVSNAIGPLVGLWIIGLTQD--LSSKMAIPIWILLYGGFGITIGLWIWGRRVIKTMGDELTTITPSSGVCIELGSAITVTVASNIGLPISTTHCKVG-----SIVAVGRYRSNENVDWKIFRHICFAWFITLPVTGGVSALIMFCLKKWAV*YFLNTLD 1494
             F+ G NDV+N+ G  VG  ++ L Q   L+S       +LL    G TI   I    +  ++ +E   I  +  V   +GSA+   +AS + LPIS THC VG     S+VA+G     + V W     I  +WFI+  ++G +S L+ + ++     YF+ + D
Sbjct:   21 AFSVGANDVANSFGTAVGSGVVTLRQACILASIFETLGSMLLGAKVGETIRKGI----IDVSLYNETVPILMAGEVSAMVGSAVWQLIASFLKLPISGTHCIVGSTIGFSMVAIG----TKGVQWMQLVKIVASWFISPLLSGIMSGLLFYVIR-----YFILSKD 173          
BLAST of slc20a-1 vs. Ensembl Cavefish
Match: slc20a2 (solute carrier family 20 member 2 [Source:NCBI gene;Acc:103032054])

HSP 1 Score: 247.669 bits (631), Expect = 9.502e-74
Identity = 121/245 (49.39%), Postives = 178/245 (72.65%), Query Frame = 1
Query:   79 IWIIVVGFLIAFILAFGIGANDVANSFGTSVGSKVLTLKQACVLASIFEILGSILLGAKVSDTIRKGVILPEYYNTQNMTDGIRIMMMGQLSSLSGACVWMMIATFFKLPVSGSHSIVGAVVGFALIIHGVKGIDWVKVGFIVASWFISPILSGSVSVLTFFIFDRFILKKSDPLEPGLTFLPFIYSITILINAFSIFISGPPLLGFDKIPLYGTFIASFGLAIITILVVRFVAVPYLRKKIQSN 813
            +W++++GF+IAF+LAF +GANDVANSFGT+VGS V+TL+QAC+LASIFE LGS+LLGAKV +TIRKG+I    YN     + + I+M G++S++ G+ VW +IA+F KLP+SG+H IVG+ +GF+++  G KG+ W+++  IVASWFISP+LSG +S L F++   FIL K DP+  GL  LP  Y+ TI IN FSI  +G P+LG + +P++   + +   +++   +V     P++R+KI S 
Sbjct:    7 LWMVIIGFIIAFVLAFSVGANDVANSFGTAVGSGVVTLRQACILASIFETLGSMLLGAKVGETIRKGIIDVSLYN-----ETVPILMAGEVSAMVGSAVWQLIASFLKLPISGTHCIVGSTIGFSMVAIGTKGVQWMQLVKIVASWFISPLLSGIMSGLLFYVIRYFILSKDDPVPNGLRALPLFYASTIGINTFSIMYTGAPMLGIEMLPVWAIALITLAGSLVCSALVWIFVCPWMRRKIASQ 246          

HSP 2 Score: 211.846 bits (538), Expect = 2.311e-60
Identity = 103/156 (66.03%), Postives = 120/156 (76.92%), Query Frame = 1
Query:  979 LFSGLQILTAVFGGFAHGGNDVSNAIGPLVGLWIIGLTQDLSSKMAIPIWILLYGGFGITIGLWIWGRRVIKTMGDELTTITPSSGVCIELGSAITVTVASNIGLPISTTHCKVGSIVAVGRYRSNENVDWKIFRHICFAWFITLPVTGGVSALIM 1446
            LF  LQILTA FG FAHGGNDVSNAIGPLV LW+I     +      P+W+L YGG GI  GLW+WGRRVI+TMG +LT ITPSSG  IEL SA+TV +ASNIGLPISTTHCKVGS+VAVG  RS + VDW++FR+I  AWF+T+PV G  SA +M
Sbjct:  496 LFHFLQILTACFGSFAHGGNDVSNAIGPLVALWMIYEQGGVMQNSTTPVWLLFYGGVGICAGLWVWGRRVIQTMGKDLTPITPSSGFTIELASAVTVVLASNIGLPISTTHCKVGSVVAVGWLRSQKAVDWRLFRNIFLAWFVTVPVAGLFSAAVM 651          

HSP 3 Score: 51.2174 bits (121), Expect = 2.103e-6
Identity = 52/166 (31.33%), Postives = 82/166 (49.40%), Query Frame = 1
Query: 1018 GFAHGGNDVSNAIGPLVGLWIIGLTQD--LSSKMAIPIWILLYGGFGITIGLWIWGRRVIKTMGDELTTITPSSGVCIELGSAITVTVASNIGLPISTTHCKVG-----SIVAVGRYRSNENVDWKIFRHICFAWFITLPVTGGVSALIMFCLKKWAV*YFLNTLD 1494
             F+ G NDV+N+ G  VG  ++ L Q   L+S       +LL    G TI   I    +  ++ +E   I  +  V   +GSA+   +AS + LPIS THC VG     S+VA+G     + V W     I  +WFI+  ++G +S L+ + ++     YF+ + D
Sbjct:   21 AFSVGANDVANSFGTAVGSGVVTLRQACILASIFETLGSMLLGAKVGETIRKGI----IDVSLYNETVPILMAGEVSAMVGSAVWQLIASFLKLPISGTHCIVGSTIGFSMVAIG----TKGVQWMQLVKIVASWFISPLLSGIMSGLLFYVIR-----YFILSKD 173          
BLAST of slc20a-1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009357.1 (pep scaffold:Pmarinus_7.0:GL476813:1208:13102:-1 gene:ENSPMAG00000008446.1 transcript:ENSPMAT00000009357.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 244.202 bits (622), Expect = 6.043e-73
Identity = 121/246 (49.19%), Postives = 171/246 (69.51%), Query Frame = 1
Query:   70 DNQIWIIVVGFLIAFILAFGIGANDVANSFGTSVGSKVLTLKQACVLASIFEILGSILLGAKVSDTIRKGVILPEYYNTQNMTDGIRIMMMGQLSSLSGACVWMMIATFFKLPVSGSHSIVGAVVGFALIIHGVKGIDWVKVGFIVASWFISPILSGSVSVLTFFIFDRFILKKSDPLEPGLTFLPFIYSITILINAFSIFISGPPLLGFDKIPLYGTFIASFGLAIITILVVRFVAVPYLRKKIQ 807
            +   W+++VGF+IAF+LAF +GANDVANSFGT+VGS VLTL+QAC+LAS+FE +GS+LLGAKV  TIR G++    YN    T     +M GQ+S++ G+  W +IA+F KLP+SG+H IVGA +GF ++  G   + W K+  IVASWF+SP+LSG +S + FF+   FIL K DP+  GL  LP  Y + + +N FSI ++G PLLGF+ +P++   + S   A+   LVV F+  P +R+KI+
Sbjct:   23 EEYKWMLIVGFIIAFVLAFSVGANDVANSFGTAVGSGVLTLRQACILASVFETVGSVLLGAKVGQTIRNGIVDVNLYNGSEST-----LMAGQVSAMVGSAAWQLIASFLKLPISGTHCIVGATIGFTMVSMGAGSVQWTKLISIVASWFVSPLLSGIMSAIFFFMVRFFILNKDDPVPNGLRALPLFYGVVMWVNCFSIMLTGLPLLGFE-LPIWALVLVSLTFAVACGLVVWFIVCPRMRRKIE 262          

HSP 2 Score: 216.083 bits (549), Expect = 1.795e-62
Identity = 104/156 (66.67%), Postives = 126/156 (80.77%), Query Frame = 1
Query:  979 LFSGLQILTAVFGGFAHGGNDVSNAIGPLVGLWIIGLTQDLSSKMAIPIWILLYGGFGITIGLWIWGRRVIKTMGDELTTITPSSGVCIELGSAITVTVASNIGLPISTTHCKVGSIVAVGRYRSNENVDWKIFRHICFAWFITLPVTGGVSALIM 1446
            LF  LQILTA FG FAHGGNDVSNAIGPLV LWII  T  ++ + A P W+LL+GG GI +GLW+WGRRVI+TMG +LT ITPSSG  IEL SA+TV +ASNIGLPISTTHCKVGS+V+VG  RS + VDW++FR+I  AWF+T+P++G  SA +M
Sbjct:  525 LFHFLQILTACFGSFAHGGNDVSNAIGPLVALWIIYSTGSVNQEAATPAWLLLFGGVGICLGLWVWGRRVIQTMGKDLTPITPSSGFSIELASAMTVVIASNIGLPISTTHCKVGSVVSVGWLRSRKAVDWRLFRNIFMAWFVTVPISGLFSAGVM 680          
BLAST of slc20a-1 vs. Ensembl Sea Lamprey
Match: slc20a2 (solute carrier family 20 member 2 [Source:ZFIN;Acc:ZDB-GENE-060929-828])

HSP 1 Score: 240.35 bits (612), Expect = 9.425e-72
Identity = 126/276 (45.65%), Postives = 184/276 (66.67%), Query Frame = 1
Query:   79 IWIIVVGFLIAFILAFGIGANDVANSFGTSVGSKVLTLKQACVLASIFEILGSILLGAKVSDTIRKGVILPEYYNTQNMTDGIRIMMMGQLSSLSGACVWMMIATFFKLPVSGSHSIVGAVVGFALIIHGVKGIDWVKVGFIVASWFISPILSGSVSVLTFFIFDRFILKKSDPLEPGLTFLPFIYSITILINAFSIFISGPP---LLGFDKIPLYGTFIASFGLAIITILVVRFVAVPYLRKKIQSNCSTATAKMSFGNGSSYVEDNHNLNGHVE 897
            +W+++VGF+IAFILAF +GANDVANSFGT+VGS V+TLKQAC+LASIFE LGSI+LGAKV +TIRKG++  + YN     +   ++M G++S++ G+  W +IA+F KLP+SG+H IVGA +GF+L+  G   + W ++  IV+SWFISP+LSG +S L F++   FIL K DPL  GL  LP  Y+ T+ IN FSI  +G P   +LGF  +  +   + + G++IIT ++V F   P ++K+I+        +    N   + +D+     H +
Sbjct:    7 MWMVIVGFIIAFILAFSVGANDVANSFGTAVGSGVVTLKQACILASIFETLGSIMLGAKVGETIRKGIVDVDLYN-----ETAEVLMAGEVSAMVGSAAWQLIASFLKLPISGTHCIVGATIGFSLVAIGTHSVQWFQLIKIVSSWFISPLLSGIMSALLFYLVRYFILNKEDPLPNGLRALPVFYAATMGINIFSIMYTGAPRCAVLGFHFVQTWIIALITVGISIITGILVWFCVCPRMKKRIEKGSPARVGREVVQN-PMFADDSSEDRDHED 276          

HSP 2 Score: 219.55 bits (558), Expect = 5.702e-64
Identity = 106/160 (66.25%), Postives = 125/160 (78.12%), Query Frame = 1
Query:  967 EQCELFSGLQILTAVFGGFAHGGNDVSNAIGPLVGLWIIGLTQDLSSKMAIPIWILLYGGFGITIGLWIWGRRVIKTMGDELTTITPSSGVCIELGSAITVTVASNIGLPISTTHCKVGSIVAVGRYRSNENVDWKIFRHICFAWFITLPVTGGVSALIM 1446
            E   LF  LQILTA FG FAHGGNDVSNAIGPLV LW+I     +  K A P+W+LLYGG GI IGLW+WGRRVI+TMG +LT ITPSSG  IEL SA TV +ASNIGLPISTTHCKVGS+V+VG  R+ + VDW++FR+I  AWF+T+P++G  SA IM
Sbjct:  489 EASLLFHFLQILTACFGSFAHGGNDVSNAIGPLVALWLIYTEGSVMQKAATPVWLLLYGGLGICIGLWVWGRRVIQTMGKDLTPITPSSGFSIELASAFTVVIASNIGLPISTTHCKVGSVVSVGWLRARKAVDWRLFRNIFMAWFVTVPISGLFSAAIM 648          

HSP 3 Score: 51.2174 bits (121), Expect = 4.764e-7
Identity = 53/166 (31.93%), Postives = 81/166 (48.80%), Query Frame = 1
Query: 1018 GFAHGGNDVSNAIGPLVGLWIIGLTQD--LSSKMAIPIWILLYGGFGITIGLWIWGRRVIKTMGDELTTITPSSGVCIELGSAITVTVASNIGLPISTTHCKVG-----SIVAVGRYRSNENVDWKIFRHICFAWFITLPVTGGVSALIMFCLKKWAV*YFLNTLD 1494
             F+ G NDV+N+ G  VG  ++ L Q   L+S       I+L    G TI   I    V   + +E   +  +  V   +GSA    +AS + LPIS THC VG     S+VA+G +    +V W     I  +WFI+ P+  G+ + ++F L ++   + LN  D
Sbjct:   21 AFSVGANDVANSFGTAVGSGVVTLKQACILASIFETLGSIMLGAKVGETIRKGI----VDVDLYNETAEVLMAGEVSAMVGSAAWQLIASFLKLPISGTHCIVGATIGFSLVAIGTH----SVQWFQLIKIVSSWFIS-PLLSGIMSALLFYLVRY---FILNKED 174          
BLAST of slc20a-1 vs. Ensembl Yeast
Match: PHO89 (Plasma membrane Na+/Pi cotransporter; active in early growth phase; similar to phosphate transporters of Neurospora crassa; transcription regulated by inorganic phosphate concentrations and Pho4p; mutations in related human transporter genes hPit1 and hPit2 are associated with hyperphosphatemia-induced calcification of vascular tissue and familial idiopathic basal ganglia calcification [Source:SGD;Acc:S000000500])

HSP 1 Score: 131.724 bits (330), Expect = 2.934e-33
Identity = 64/156 (41.03%), Postives = 99/156 (63.46%), Query Frame = 1
Query:  979 LFSGLQILTAVFGGFAHGGNDVSNAIGPLVGLWIIGLTQDLSSKMAIPIWILLYGGFGITIGLWIWGRRVIKTMGDELTTITPSSGVCIELGSAITVTVASNIGLPISTTHCKVGSIVAVGRYRSN-ENVDWKIFRHICFAWFITLPVTGGVSALI 1443
            ++S LQ +TA    FAHG NDV+NA GPL  +++I  T  + +K  +P+W+L YGG  + IG W +G  +IK +G+++   +PS G  IEL  AIT  +A+ +G+P STT   VG IVAVG    + ++V+W++       WF+TLP+ G ++ +I
Sbjct:  402 IYSVLQAITAATMSFAHGANDVANATGPLSAVYVIWKTNTIGAKSEVPVWVLAYGGVALVIGCWTYGYNIIKNLGNKMILQSPSRGFSIELAVAITTVMATQLGIPTSTTQIAVGGIVAVGLCNKDLKSVNWRMVAWCYSGWFLTLPIAGLIAGII 557          

HSP 2 Score: 101.679 bits (252), Expect = 2.921e-23
Identity = 91/281 (32.38%), Postives = 141/281 (50.18%), Query Frame = 1
Query:   82 WIIVVGFLIAFILAFGIGANDVANSFGTSVGSKVLTLKQACVLASIFEILGSILLGAKVSDTIRKGVILPEYYNTQNMTDGIRIMMMGQLSSLSGACVWMMIATFFKLPVSGSHSIVGAVVGFALIIHGVKGI--DWVKVGFIVASWFISPILSGSVSVLTFFIFDRFILKKSDPLEPGLTFLPFIYSITILINAFSIFI-----SGPPLLGFDKIPLYGTFIASFGLAIITILVVRFVAVPYLRKKIQSNCSTATAKMSFGNGSSYVEDNHNLNGHVETH 903
            +I  +  L AF+ AF IGANDVANSF +S+ S+ L   QA VLA + E LG++L GA+VS TI+  +I     ++   T+   ++M+   S+L G+  W+  AT   +PVS +HSIVG  +G  +   G  G+   W  V  I+ASWFI+PIL+G+++ + F I  RF + +   LE  +     +  + ++   FSI        G P L  D +    T ++      I  +V      P+ R+K+     T      F   S Y +   ++    E H
Sbjct:    8 YIFAIAMLFAFLDAFNIGANDVANSFASSISSRSLKYWQAMVLAGLCEFLGAVLAGARVSGTIKNNII-----DSSIFTNDPAVLMLTMTSALIGSSCWLTFATAIGMPVSTTHSIVGGTIGAGIAAGGANGVVWGWSGVSQIIASWFIAPILAGAIAAIVFSI-SRFSVLEVKSLERSIKNALLLVGV-LVFATFSILTMLIVWKGSPNLHLDDLSETETAVSIVLTGAIASIVYFIFFYPFYRRKVLDQDWTLKLIDIFRGPSFYFKSTDDIPPMPEGH 281          
BLAST of slc20a-1 vs. Ensembl Nematostella
Match: EDO34470 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SPA5])

HSP 1 Score: 218.394 bits (555), Expect = 7.463e-67
Identity = 118/210 (56.19%), Postives = 156/210 (74.29%), Query Frame = 1
Query:   58 MLFPDNQ--IWIIVVGFLIAFILAFGIGANDVANSFGTSVGSKVLTLKQACVLASIFEILGSILLGAKVSDTIRKGVILPEYYNTQNMTDGIRIMMMGQLSSLSGACVWMMIATFFKLPVSGSHSIVGAVVGFALIIHGVKGIDWVKVGFIVASWFISPILSGSVSVLTFFIFDRFILKKSDPLEPGLTFLPFIYSITILINAFSIFISG 681
            ML P +   +WI++VGF++AF+LAFGIGANDVANSFGTSVGSKVLTLKQAC +ASIFE+ G++L+GA+VSDT+RKG+I     N+ N T+     M+G LS+L+G  VW+++ATFF LPVSG+HS+VGA +GFAL+   + G+ W   G I  SW +SP+LSG +S L F +  R IL+K +P E GL FLP  Y+ TI +N FS+F  G
Sbjct:    1 MLEPQDSEYLWIVIVGFILAFVLAFGIGANDVANSFGTSVGSKVLTLKQACFIASIFEVAGAVLIGARVSDTVRKGII---DINSFNGTE--EYAMVGSLSALTGTSVWLLVATFFNLPVSGTHSVVGATMGFALVAQSLHGVQWKTFGKIAGSWVVSPLLSGLISSLLFMLVRRIILRKPEPFEAGLKFLPLFYAFTITVNFFSVFYKG 205          

HSP 2 Score: 129.028 bits (323), Expect = 1.511e-33
Identity = 60/85 (70.59%), Postives = 72/85 (84.71%), Query Frame = 1
Query:  976 ELFSGLQILTAVFGGFAHGGNDVSNAIGPLVGLWIIGLTQDLSSKMAIPIWILLYGGFGITIGLWIWGRRVIKTMGDELTTITPS 1230
             LF+ LQILTA FG FAHGGNDVSN IGPL+ LW I  T +++ K+AIP+WILLYGG GI+IGLW+WGRRVIKT+G++LT ITPS
Sbjct:  220 RLFAFLQILTASFGAFAHGGNDVSNCIGPLISLWTIYWTGEIAQKVAIPVWILLYGGVGISIGLWVWGRRVIKTVGEDLTPITPS 304          
BLAST of slc20a-1 vs. Ensembl Medaka
Match: slc20a1a (sodium-dependent phosphate transporter 1-A [Source:NCBI gene;Acc:101158859])

HSP 1 Score: 263.077 bits (671), Expect = 7.303e-80
Identity = 134/271 (49.45%), Postives = 187/271 (69.00%), Query Frame = 1
Query:   79 IWIIVVGFLIAFILAFGIGANDVANSFGTSVGSKVLTLKQACVLASIFEILGSILLGAKVSDTIRKGVILPEYYNTQNMTDGIRIMMMGQLSSLSGACVWMMIATFFKLPVSGSHSIVGAVVGFALIIHGVKGIDWVKVGFIVASWFISPILSGSVSVLTFFIFDRFILKKSDPLEPGLTFLPFIYSITILINAFSIFISGPPLLGFDKIPLYGTFIASFGLAIITILVVRFVAVPYLRKKI--QSNCSTATAKMSFGNGSSYVEDNHNLN 885
            +W+++VGF+IAFILAF +GANDVANSFGT+VGS V+TL+QAC+LA+IFE +GS+LLGAKVS TIR+G+I    YN         I+M G +S++ G+ VW + A+F KLP+SG+H IVGA +GF+++  G +G+ W+++  IVASWF+SP+LSG +S + F+   +FIL K +P   GL  LP  Y+ITI IN FSI  +G P+LGFD++P +GT   S G A++T LVV F   P L+KKI  Q+  S     +   N S  V +   + 
Sbjct:   27 LWLVIVGFIIAFILAFSVGANDVANSFGTAVGSGVVTLRQACILATIFETVGSVLLGAKVSKTIREGIIDVRMYNGSE-----HILMGGSISAMCGSAVWQLFASFLKLPISGTHCIVGATIGFSMVARGYQGVKWLELLRIVASWFLSPVLSGLMSGILFYFVRKFILNKPNPGSNGLKALPIFYAITIGINLFSIMYTGAPMLGFDRVPWWGTLCISLGCAVVTGLVVWFFVCPRLKKKIAGQTAASPCETPLMEKNSSKPVPEERPIR 292          

HSP 2 Score: 218.394 bits (555), Expect = 4.133e-63
Identity = 104/156 (66.67%), Postives = 127/156 (81.41%), Query Frame = 1
Query:  979 LFSGLQILTAVFGGFAHGGNDVSNAIGPLVGLWIIGLTQDLSSKMAIPIWILLYGGFGITIGLWIWGRRVIKTMGDELTTITPSSGVCIELGSAITVTVASNIGLPISTTHCKVGSIVAVGRYRSNENVDWKIFRHICFAWFITLPVTGGVSALIM 1446
            LF  LQILTA FG FAHGGNDVSNAIGPLV LW++  +  + S    PIW+LLYGG GI +GLW+WGRRVI+TMG +LT ITPSSG  IEL SA+TV VASN+GLP+STTHCKVGS+VAVG  RS ++VDW++FR+I  AWF+T+P++G +SA IM
Sbjct:  467 LFQFLQILTACFGSFAHGGNDVSNAIGPLVALWLLYDSGSVVSDAPTPIWLLLYGGVGICVGLWVWGRRVIQTMGKDLTPITPSSGFSIELASAVTVVVASNVGLPVSTTHCKVGSVVAVGWLRSRKSVDWRLFRNIFIAWFVTVPISGLISAAIM 622          
BLAST of slc20a-1 vs. Ensembl Medaka
Match: slc20a1b (sodium-dependent phosphate transporter 1-B [Source:NCBI gene;Acc:101173722])

HSP 1 Score: 259.225 bits (661), Expect = 6.361e-78
Identity = 126/255 (49.41%), Postives = 183/255 (71.76%), Query Frame = 1
Query:   76 QIWIIVVGFLIAFILAFGIGANDVANSFGTSVGSKVLTLKQACVLASIFEILGSILLGAKVSDTIRKGVILPEYYNTQNMTDGIRIMMMGQLSSLSGACVWMMIATFFKLPVSGSHSIVGAVVGFALIIHGVKGIDWVKVGFIVASWFISPILSGSVSVLTFFIFDRFILKKSDPLEPGLTFLPFIYSITILINAFSIFISGPPLLGFDKIPLYGTFIASFGLAIITILVVRFVAVPYLRKKIQSNCSTATAKMS 840
             +W++++GF+IAFILAF +GANDVANSFGT+VGS V+TL+QAC+LA++FE LGS+LLGAKVS+TIRKG+I    YN          +M G +S++ G+ VW + A+F KLP+SG+H IVGA +GF+LI  G +G+ W+++  IV SWF+SP+LSG +S + F+   +FIL K DP+  GL  LP  Y+IT+ IN FSI  +G P+LG DKIP +G  + S   A++  ++V FV  P+L++KI+ +  +++   S
Sbjct:   26 HMWLLILGFIIAFILAFSVGANDVANSFGTAVGSGVVTLRQACILATVFETLGSVLLGAKVSETIRKGIIDVSMYNGSEPE-----LMAGSVSAMVGSAVWQLAASFLKLPISGTHCIVGATIGFSLIAKGQQGVRWLELLRIVGSWFLSPLLSGMMSAIVFWFVSKFILNKKDPVPNGLKALPVFYAITMGINLFSIMFTGAPMLGLDKIPWWGILLISLTCALLVGVLVWFVVCPHLKRKIERDMKSSSPSES 275          

HSP 2 Score: 173.326 bits (438), Expect = 2.289e-46
Identity = 84/118 (71.19%), Postives = 94/118 (79.66%), Query Frame = 1
Query:  967 EQCELFSGLQILTAVFGGFAHGGNDVSNAIGPLVGLWIIGLTQDLSSKMAIPIWILLYGGFGITIGLWIWGRRVIKTMGDELTTITPSSGVCIELGSAITVTVASNIGLPISTTHCKV 1320
            E   LF  LQILTA FG FAHGGNDVSNAIGPLV LW++  T D+ S    PIW+LLYGG GI +GLW+WGRRVI+TMG +LT ITPSSG  IEL SA+TV VASNIGLP+STTHCKV
Sbjct:  532 EVSTLFQFLQILTACFGSFAHGGNDVSNAIGPLVALWLVYSTGDVMSTQPTPIWLLLYGGVGICVGLWVWGRRVIQTMGKDLTPITPSSGFSIELASALTVVVASNIGLPVSTTHCKV 649          
BLAST of slc20a-1 vs. Ensembl Medaka
Match: slc20a1b (sodium-dependent phosphate transporter 1-B [Source:NCBI gene;Acc:101173722])

HSP 1 Score: 259.225 bits (661), Expect = 6.361e-78
Identity = 126/255 (49.41%), Postives = 183/255 (71.76%), Query Frame = 1
Query:   76 QIWIIVVGFLIAFILAFGIGANDVANSFGTSVGSKVLTLKQACVLASIFEILGSILLGAKVSDTIRKGVILPEYYNTQNMTDGIRIMMMGQLSSLSGACVWMMIATFFKLPVSGSHSIVGAVVGFALIIHGVKGIDWVKVGFIVASWFISPILSGSVSVLTFFIFDRFILKKSDPLEPGLTFLPFIYSITILINAFSIFISGPPLLGFDKIPLYGTFIASFGLAIITILVVRFVAVPYLRKKIQSNCSTATAKMS 840
             +W++++GF+IAFILAF +GANDVANSFGT+VGS V+TL+QAC+LA++FE LGS+LLGAKVS+TIRKG+I    YN          +M G +S++ G+ VW + A+F KLP+SG+H IVGA +GF+LI  G +G+ W+++  IV SWF+SP+LSG +S + F+   +FIL K DP+  GL  LP  Y+IT+ IN FSI  +G P+LG DKIP +G  + S   A++  ++V FV  P+L++KI+ +  +++   S
Sbjct:   26 HMWLLILGFIIAFILAFSVGANDVANSFGTAVGSGVVTLRQACILATVFETLGSVLLGAKVSETIRKGIIDVSMYNGSEPE-----LMAGSVSAMVGSAVWQLAASFLKLPISGTHCIVGATIGFSLIAKGQQGVRWLELLRIVGSWFLSPLLSGMMSAIVFWFVSKFILNKKDPVPNGLKALPVFYAITMGINLFSIMFTGAPMLGLDKIPWWGILLISLTCALLVGVLVWFVVCPHLKRKIERDMKSSSPSES 275          

HSP 2 Score: 173.326 bits (438), Expect = 2.289e-46
Identity = 84/118 (71.19%), Postives = 94/118 (79.66%), Query Frame = 1
Query:  967 EQCELFSGLQILTAVFGGFAHGGNDVSNAIGPLVGLWIIGLTQDLSSKMAIPIWILLYGGFGITIGLWIWGRRVIKTMGDELTTITPSSGVCIELGSAITVTVASNIGLPISTTHCKV 1320
            E   LF  LQILTA FG FAHGGNDVSNAIGPLV LW++  T D+ S    PIW+LLYGG GI +GLW+WGRRVI+TMG +LT ITPSSG  IEL SA+TV VASNIGLP+STTHCKV
Sbjct:  532 EVSTLFQFLQILTACFGSFAHGGNDVSNAIGPLVALWLVYSTGDVMSTQPTPIWLLLYGGVGICVGLWVWGRRVIQTMGKDLTPITPSSGFSIELASALTVVVASNIGLPVSTTHCKV 649          
BLAST of slc20a-1 vs. Ensembl Medaka
Match: slc20a1b (sodium-dependent phosphate transporter 1-B [Source:NCBI gene;Acc:101173722])

HSP 1 Score: 259.225 bits (661), Expect = 9.017e-78
Identity = 126/255 (49.41%), Postives = 183/255 (71.76%), Query Frame = 1
Query:   76 QIWIIVVGFLIAFILAFGIGANDVANSFGTSVGSKVLTLKQACVLASIFEILGSILLGAKVSDTIRKGVILPEYYNTQNMTDGIRIMMMGQLSSLSGACVWMMIATFFKLPVSGSHSIVGAVVGFALIIHGVKGIDWVKVGFIVASWFISPILSGSVSVLTFFIFDRFILKKSDPLEPGLTFLPFIYSITILINAFSIFISGPPLLGFDKIPLYGTFIASFGLAIITILVVRFVAVPYLRKKIQSNCSTATAKMS 840
             +W++++GF+IAFILAF +GANDVANSFGT+VGS V+TL+QAC+LA++FE LGS+LLGAKVS+TIRKG+I    YN          +M G +S++ G+ VW + A+F KLP+SG+H IVGA +GF+LI  G +G+ W+++  IV SWF+SP+LSG +S + F+   +FIL K DP+  GL  LP  Y+IT+ IN FSI  +G P+LG DKIP +G  + S   A++  ++V FV  P+L++KI+ +  +++   S
Sbjct:   26 HMWLLILGFIIAFILAFSVGANDVANSFGTAVGSGVVTLRQACILATVFETLGSVLLGAKVSETIRKGIIDVSMYNGSEPE-----LMAGSVSAMVGSAVWQLAASFLKLPISGTHCIVGATIGFSLIAKGQQGVRWLELLRIVGSWFLSPLLSGMMSAIVFWFVSKFILNKKDPVPNGLKALPVFYAITMGINLFSIMFTGAPMLGLDKIPWWGILLISLTCALLVGVLVWFVVCPHLKRKIERDMKSSSPSES 275          

HSP 2 Score: 224.172 bits (570), Expect = 1.048e-64
Identity = 108/160 (67.50%), Postives = 128/160 (80.00%), Query Frame = 1
Query:  967 EQCELFSGLQILTAVFGGFAHGGNDVSNAIGPLVGLWIIGLTQDLSSKMAIPIWILLYGGFGITIGLWIWGRRVIKTMGDELTTITPSSGVCIELGSAITVTVASNIGLPISTTHCKVGSIVAVGRYRSNENVDWKIFRHICFAWFITLPVTGGVSALIM 1446
            E   LF  LQILTA FG FAHGGNDVSNAIGPLV LW++  T D+ S    PIW+LLYGG GI +GLW+WGRRVI+TMG +LT ITPSSG  IEL SA+TV VASNIGLP+STTHCKVGS+VAVG  RS + VDW++FR+I  AWF+T+P++G +SA IM
Sbjct:  532 EVSTLFQFLQILTACFGSFAHGGNDVSNAIGPLVALWLVYSTGDVMSTQPTPIWLLLYGGVGICVGLWVWGRRVIQTMGKDLTPITPSSGFSIELASALTVVVASNIGLPVSTTHCKVGSVVAVGWLRSKKAVDWRLFRNIFMAWFVTVPISGLISAAIM 691          
BLAST of slc20a-1 vs. Ensembl Medaka
Match: slc20a2 (solute carrier family 20 member 2 [Source:NCBI gene;Acc:101166389])

HSP 1 Score: 244.973 bits (624), Expect = 4.433e-73
Identity = 132/255 (51.76%), Postives = 184/255 (72.16%), Query Frame = 1
Query:   70 DNQIWIIVVGFLIAFILAFGIGANDVANSFGTSVGSKVLTLKQACVLASIFEILGSILLGAKVSDTIRKGVILPEYYNTQNMTDGIRIMMMGQLSSLSGACVWMMIATFFKLPVSGSHSIVGAVVGFALIIHGVKGIDWVKVGFIVASWFISPILSGSVSVLTFFIFDRFILKKSDPLEPGLTFLPFIYSITILINAFSIFISGPPLLGFDKIPLYGTFIASFGLAIITI-LVVRFVAVPYLRKKIQSNCSTATA 831
            ++ +W++++GF+IAFILAF +GANDVANSFGT+VGS V+TLKQAC+LASIFE LGSILLGAKV +TIRKG+I   +YN     D + I+M G++S++ G+ VW +IA+F KLP+SG+H IVGA +GF+++  G KG+ W+++  IVASWFISP+LSG +S L F +   FIL K D +  GL  LP  Y+ TI IN FSI  +G PLLG + +P++  F+ +   +++   LV +FV  P++RKKI S      A
Sbjct:    4 ESYLWLVILGFVIAFILAFSVGANDVANSFGTAVGSGVVTLKQACILASIFETLGSILLGAKVGETIRKGIIDVSFYN-----DTVPILMAGEVSAMVGSAVWQLIASFLKLPISGTHCIVGATIGFSMVAIGTKGVQWMQLVKIVASWFISPLLSGLMSGLLFLLIRYFILSKEDSVPNGLRALPVFYASTIGINTFSIMYTGAPLLGLEMLPVWAIFLITLAGSLVCAGLVWKFVC-PWMRKKIASRLKKEQA 252          

HSP 2 Score: 160.614 bits (405), Expect = 3.663e-42
Identity = 78/113 (69.03%), Postives = 88/113 (77.88%), Query Frame = 1
Query:  979 LFSGLQILTAVFGGFAHGGNDVSNAIGPLVGLWIIGLTQDLSSKMAIPIWILLYGGFGITIGLWIWGRRVIKTMGDELTTITPSSGVCIELGSAITVTVASNIGLPISTTHCK 1317
            LF  LQILTA FG FAHGGNDVSNAIGPLV LW+I     +    A PIW+L YGG GI  GLW+WGRRVI+TMG +LT ITPSSG  IEL SA+TV +ASNIG+P+STTHCK
Sbjct:  512 LFHFLQILTACFGSFAHGGNDVSNAIGPLVALWMIYEQGGVMQDAATPIWLLFYGGVGICAGLWVWGRRVIQTMGKDLTPITPSSGFTIELASALTVVLASNIGIPVSTTHCK 624          
BLAST of slc20a-1 vs. Planmine SMEST
Match: SMESG000012546.1 (SMESG000012546.1)

HSP 1 Score: 905.975 bits (2340), Expect = 0.000e+0
Identity = 471/471 (100.00%), Postives = 471/471 (100.00%), Query Frame = 1
Query:   58 MLFPDNQIWIIVVGFLIAFILAFGIGANDVANSFGTSVGSKVLTLKQACVLASIFEILGSILLGAKVSDTIRKGVILPEYYNTQNMTDGIRIMMMGQLSSLSGACVWMMIATFFKLPVSGSHSIVGAVVGFALIIHGVKGIDWVKVGFIVASWFISPILSGSVSVLTFFIFDRFILKKSDPLEPGLTFLPFIYSITILINAFSIFISGPPLLGFDKIPLYGTFIASFGLAIITILVVRFVAVPYLRKKIQSNCSTATAKMSFGNGSSYVEDNHNLNGHVETHLDNNIVHXXXXXXXXXXXXXXEQCELFSGLQILTAVFGGFAHGGNDVSNAIGPLVGLWIIGLTQDLSSKMAIPIWILLYGGFGITIGLWIWGRRVIKTMGDELTTITPSSGVCIELGSAITVTVASNIGLPISTTHCKVGSIVAVGRYRSNENVDWKIFRHICFAWFITLPVTGGVSALIMFCLKKWAV 1470
            MLFPDNQIWIIVVGFLIAFILAFGIGANDVANSFGTSVGSKVLTLKQACVLASIFEILGSILLGAKVSDTIRKGVILPEYYNTQNMTDGIRIMMMGQLSSLSGACVWMMIATFFKLPVSGSHSIVGAVVGFALIIHGVKGIDWVKVGFIVASWFISPILSGSVSVLTFFIFDRFILKKSDPLEPGLTFLPFIYSITILINAFSIFISGPPLLGFDKIPLYGTFIASFGLAIITILVVRFVAVPYLRKKIQSNCSTATAKMSFGNGSSYVEDNHNLNGHVETHLDNNIVHIITKPKHIPIKDKPEQCELFSGLQILTAVFGGFAHGGNDVSNAIGPLVGLWIIGLTQDLSSKMAIPIWILLYGGFGITIGLWIWGRRVIKTMGDELTTITPSSGVCIELGSAITVTVASNIGLPISTTHCKVGSIVAVGRYRSNENVDWKIFRHICFAWFITLPVTGGVSALIMFCLKKWAV
Sbjct:    1 MLFPDNQIWIIVVGFLIAFILAFGIGANDVANSFGTSVGSKVLTLKQACVLASIFEILGSILLGAKVSDTIRKGVILPEYYNTQNMTDGIRIMMMGQLSSLSGACVWMMIATFFKLPVSGSHSIVGAVVGFALIIHGVKGIDWVKVGFIVASWFISPILSGSVSVLTFFIFDRFILKKSDPLEPGLTFLPFIYSITILINAFSIFISGPPLLGFDKIPLYGTFIASFGLAIITILVVRFVAVPYLRKKIQSNCSTATAKMSFGNGSSYVEDNHNLNGHVETHLDNNIVHIITKPKHIPIKDKPEQCELFSGLQILTAVFGGFAHGGNDVSNAIGPLVGLWIIGLTQDLSSKMAIPIWILLYGGFGITIGLWIWGRRVIKTMGDELTTITPSSGVCIELGSAITVTVASNIGLPISTTHCKVGSIVAVGRYRSNENVDWKIFRHICFAWFITLPVTGGVSALIMFCLKKWAV 471          
BLAST of slc20a-1 vs. Planmine SMEST
Match: SMESG000029269.1 (SMESG000029269.1)

HSP 1 Score: 299.671 bits (766), Expect = 3.260e-95
Identity = 166/264 (62.88%), Postives = 203/264 (76.89%), Query Frame = 1
Query:   67 PDNQIWIIVVGFLIAFILAFGIGANDVANSFGTSVGSKVLTLKQACVLASIFEILGSILLGAKVSDTIRKGVILPEYYNTQNMTDGIRIMMMGQLSSLSGACVWMMIATFFKLPVSGSHSIVGAVVGFALIIHGVKGIDWVKVGFIVASWFISPILSGSVSVLTFFIFDRFILKKSDPLEPGLTFLPFIYSITILINAFSIFISGPPLLGFDKIPLYGTFIASFGLAIITILVVRFVAVPYLRKKIQSNCSTATAKMSFGNGSS 858
            P +QIWI+VVGFLIAFILAFGIGANDVANSFGTSVGSKV++L++AC+LASIF++LGSILLGAKVS+T+R+GVI P+    QN+T+  ++MM+G LSSLSG C+W+++ATF KLPVSGSHSIVGA+VGFALII G       ++G             G VS   FFIFD+FILKKS+  EP L FLPFIY+ITI IN FSIF++GP LL FDK+P+YG F  S GL++ITI+VVRF  VPYLRK I  N ST+       +GSS
Sbjct:    5 PPDQIWIVVVGFLIAFILAFGIGANDVANSFGTSVGSKVISLRKACILASIFDVLGSILLGAKVSNTVREGVISPDALAAQNLTNLPQVMMIGHLSSLSGGCLWLLVATFLKLPVSGSHSIVGAMVGFALIIQGPGWNCMEEIGND----------CGLVSAFIFFIFDKFILKKSESREPALNFLPFIYAITIFINFFSIFLTGPALLKFDKVPIYGNFAISIGLSVITIIVVRFALVPYLRKTILKNKSTSNNAHDVSSGSS 258          

HSP 2 Score: 266.544 bits (680), Expect = 2.008e-82
Identity = 123/164 (75.00%), Postives = 145/164 (88.41%), Query Frame = 1
Query:  967 EQCELFSGLQILTAVFGGFAHGGNDVSNAIGPLVGLWIIGLTQDLSSKMAIPIWILLYGGFGITIGLWIWGRRVIKTMGDELTTITPSSGVCIELGSAITVTVASNIGLPISTTHCKVGSIVAVGRYRSNENVDWKIFRHICFAWFITLPVTGGVSALIMFCLK 1458
            E   +FS +Q+LTA FG FAHGGNDVSNAIGPLVGLWII +TQD+ S  A+PIWIL YGG GIT+GLW+WGRRV+KT+GD+LTTITP+SGV IELG+A+TV VASNIG+PISTTHCKVGSIVAVGRYRSN+NVDW IFR+ICFAW +T+PV+ G+SAL MF L+
Sbjct:  352 ELVTIFSWVQVLTATFGSFAHGGNDVSNAIGPLVGLWIIAVTQDVYSTEAVPIWILFYGGLGITVGLWVWGRRVMKTIGDDLTTITPTSGVSIELGAAVTVLVASNIGIPISTTHCKVGSIVAVGRYRSNDNVDWSIFRNICFAWLVTVPVSAGISALTMFLLR 515          
The following BLAST results are available for this feature:
BLAST of slc20a-1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SLC20A11.558e-8149.07solute carrier family 20 member 1 [Source:HGNC Sym... [more]
SLC20A26.813e-7448.51solute carrier family 20 member 2 [Source:HGNC Sym... [more]
SLC20A26.813e-7448.51solute carrier family 20 member 2 [Source:HGNC Sym... [more]
SLC20A26.813e-7448.51solute carrier family 20 member 2 [Source:HGNC Sym... [more]
SLC20A26.347e-3257.58solute carrier family 20 member 2 [Source:HGNC Sym... [more]
back to top
BLAST of slc20a-1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pitr-11.362e-12944.85Phosphate transporter [Source:UniProtKB/TrEMBL;Ac... [more]
pitr-11.362e-12944.85Phosphate transporter [Source:UniProtKB/TrEMBL;Ac... [more]
pitr-31.302e-12543.64Phosphate transporter [Source:UniProtKB/TrEMBL;Ac... [more]
pitr-27.629e-11743.25Phosphate transporter [Source:UniProtKB/TrEMBL;Ac... [more]
pitr-55.494e-11240.71Phosphate transporter [Source:UniProtKB/TrEMBL;Ac... [more]
back to top
BLAST of slc20a-1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 2
Match NameE-valueIdentityDescription
NaPi-III6.362e-7951.42gene:FBgn0260795 transcript:FBtr0301438[more]
NaPi-III6.362e-7951.42gene:FBgn0260795 transcript:FBtr0332705[more]
back to top
BLAST of slc20a-1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slc20a1a7.834e-8449.09solute carrier family 20 member 1a [Source:NCBI ge... [more]
slc20a1a7.834e-8449.09solute carrier family 20 member 1a [Source:NCBI ge... [more]
slc20a1b9.004e-8351.97solute carrier family 20 member 1b [Source:NCBI ge... [more]
slc20a1b9.004e-8351.97solute carrier family 20 member 1b [Source:NCBI ge... [more]
slc20a22.839e-7250.00solute carrier family 20 member 2 [Source:ZFIN;Acc... [more]
back to top
BLAST of slc20a-1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slc20a11.499e-8052.38solute carrier family 20 member 1 [Source:NCBI gen... [more]
slc20a14.282e-8052.38solute carrier family 20 member 1 [Source:NCBI gen... [more]
slc20a14.607e-8052.38solute carrier family 20 member 1 [Source:NCBI gen... [more]
p3h27.372e-7853.06prolyl 3-hydroxylase 2 [Source:Xenbase;Acc:XB-GENE... [more]
slc20a12.743e-7650.78solute carrier family 20 member 1 [Source:NCBI gen... [more]
back to top
BLAST of slc20a-1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 3
Match NameE-valueIdentityDescription
Slc20a13.902e-8349.63solute carrier family 20, member 1 [Source:MGI Sym... [more]
Slc20a13.902e-8349.63solute carrier family 20, member 1 [Source:MGI Sym... [more]
Slc20a26.289e-7348.43solute carrier family 20, member 2 [Source:MGI Sym... [more]
back to top
BLAST of slc20a-1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9JJP0|S20A1_RAT7.539e-8450.18Sodium-dependent phosphate transporter 1 OS=Rattus... [more]
sp|Q6NV12|S20AA_DANRE7.298e-8349.09Sodium-dependent phosphate transporter 1-A OS=Dani... [more]
sp|O97596|S20A1_FELCA7.433e-8349.07Sodium-dependent phosphate transporter 1 OS=Felis ... [more]
sp|Q61609|S20A1_MOUSE2.729e-8249.63Sodium-dependent phosphate transporter 1 OS=Mus mu... [more]
sp|Q6PFM1|S20AB_DANRE3.212e-8151.56Sodium-dependent phosphate transporter 1-B OS=Dani... [more]
back to top
BLAST of slc20a-1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0H3YJ890.000e+0100.00Phosphate transporter OS=Schmidtea mediterranea OX... [more]
A0A1I8GFH20.000e+054.73Phosphate transporter OS=Macrostomum lignano OX=28... [more]
T1FS883.899e-17756.67Phosphate transporter OS=Helobdella robusta OX=641... [more]
A0A210QKP13.264e-17454.83Phosphate transporter OS=Mizuhopecten yessoensis O... [more]
A0A210QKB76.159e-17455.72Phosphate transporter OS=Mizuhopecten yessoensis O... [more]
back to top
BLAST of slc20a-1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slc20a1a3.123e-8045.86sodium-dependent phosphate transporter 1-A-like [S... [more]
slc20a1b6.729e-8049.61solute carrier family 20 member 1 [Source:NCBI gen... [more]
slc20a29.502e-7449.39solute carrier family 20 member 2 [Source:NCBI gen... [more]
slc20a29.502e-7449.39solute carrier family 20 member 2 [Source:NCBI gen... [more]
slc20a29.502e-7449.39solute carrier family 20 member 2 [Source:NCBI gen... [more]
back to top
BLAST of slc20a-1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ENSPMAT00000009357.16.043e-7349.19pep scaffold:Pmarinus_7.0:GL476813:1208:13102:-1 g... [more]
slc20a29.425e-7245.65solute carrier family 20 member 2 [Source:ZFIN;Acc... [more]
back to top
BLAST of slc20a-1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
PHO892.934e-3341.03Plasma membrane Na+/Pi cotransporter; active in ea... [more]
back to top
BLAST of slc20a-1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO344707.463e-6756.19Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of slc20a-1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slc20a1a7.303e-8049.45sodium-dependent phosphate transporter 1-A [Source... [more]
slc20a1b6.361e-7849.41sodium-dependent phosphate transporter 1-B [Source... [more]
slc20a1b6.361e-7849.41sodium-dependent phosphate transporter 1-B [Source... [more]
slc20a1b9.017e-7849.41sodium-dependent phosphate transporter 1-B [Source... [more]
slc20a24.433e-7351.76solute carrier family 20 member 2 [Source:NCBI gen... [more]
back to top
BLAST of slc20a-1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000012546.10.000e+0100.00SMESG000012546.1[more]
SMESG000029269.13.260e-9562.88SMESG000029269.1[more]
back to top
Cross References
External references for this transcript
DatabaseAccession
SmedGD GBrowseSMED30000014
GenBankAKN21544.1
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30000014 ID=SMED30000014|Name=slc20a-1|organism=Schmidtea mediterranea sexual|type=transcript|length=1622bp
CTTTTCAATTGCTTAGTTTAGAACTTAAACTTTACGTTTTCGTAAATATT
AATTTACATGCTGTTTCCAGATAATCAAATATGGATAATAGTAGTAGGTT
TTCTAATTGCCTTTATATTGGCTTTTGGTATTGGTGCAAATGATGTCGCC
AATTCATTTGGCACGAGTGTTGGGTCTAAAGTGTTGACGCTTAAGCAGGC
TTGTGTATTAGCATCTATATTTGAGATTTTGGGATCGATATTACTAGGAG
CCAAAGTTTCTGATACGATAAGGAAAGGAGTAATTCTACCAGAGTATTAC
AATACCCAAAATATGACTGATGGAATTAGAATAATGATGATGGGTCAATT
ATCATCATTATCTGGAGCATGTGTCTGGATGATGATAGCAACATTTTTCA
AGCTGCCGGTGTCTGGGTCCCACAGTATAGTAGGAGCTGTTGTTGGATTT
GCTCTCATTATTCATGGAGTGAAAGGAATAGATTGGGTTAAAGTTGGGTT
TATTGTTGCCTCGTGGTTTATTTCTCCGATATTAAGTGGATCTGTGTCGG
TTCTGACGTTTTTTATATTTGATCGCTTTATCTTGAAGAAGAGTGATCCT
TTGGAGCCTGGACTTACATTTCTACCGTTTATCTATTCAATAACGATCTT
AATAAATGCCTTCTCAATATTTATCAGTGGGCCACCATTGCTTGGTTTTG
ACAAAATACCTCTATATGGAACATTTATTGCCAGTTTTGGGTTAGCAATT
ATCACTATTCTAGTTGTTCGATTCGTGGCTGTTCCTTATTTAAGAAAGAA
AATTCAAAGTAACTGTTCTACTGCCACTGCTAAAATGAGTTTTGGTAACG
GGAGCAGCTATGTTGAAGATAATCATAATTTAAACGGACACGTTGAAACA
CATTTAGACAACAACATTGTTCATATTATTACAAAACCAAAACACATTCC
AATTAAAGACAAACCAGAACAGTGTGAATTGTTTTCAGGTCTTCAGATTT
TAACCGCGGTTTTCGGTGGGTTTGCTCATGGGGGTAACGATGTGAGTAAT
GCAATTGGTCCGTTAGTCGGATTGTGGATTATTGGTTTGACACAAGATCT
TTCTAGTAAGATGGCAATTCCTATTTGGATTTTACTTTATGGTGGATTTG
GTATTACAATCGGTTTGTGGATTTGGGGTAGAAGAGTCATTAAAACGATG
GGCGATGAATTAACAACAATCACCCCATCAAGCGGAGTATGCATCGAGCT
AGGGTCAGCCATAACTGTAACGGTTGCGTCTAACATTGGCTTACCAATAT
CTACAACTCATTGTAAAGTAGGCTCAATTGTCGCTGTTGGTAGATATCGC
TCTAATGAGAATGTTGATTGGAAAATATTTAGACACATTTGTTTTGCGTG
GTTCATTACTCTCCCTGTAACAGGGGGGGTTAGTGCACTTATCATGTTCT
GTCTCAAAAAGTGGGCGGTGTAATATTTTCTGAATACTTTAGATTAGTCG
TATTGTATTTTTATTCATTTTATGCAGGATTTTTGTACCGATTACAAAAA
TCAAGGAAGATTTTGTCGATTTAATGTTAAATTCTAATCAATAAATCGAA
TTATGATTTTATTAAAAAAAAA
back to top

protein sequence of SMED30000014-orf-1

>SMED30000014-orf-1 ID=SMED30000014-orf-1|Name=SMED30000014-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=472bp
MLFPDNQIWIIVVGFLIAFILAFGIGANDVANSFGTSVGSKVLTLKQACV
LASIFEILGSILLGAKVSDTIRKGVILPEYYNTQNMTDGIRIMMMGQLSS
LSGACVWMMIATFFKLPVSGSHSIVGAVVGFALIIHGVKGIDWVKVGFIV
ASWFISPILSGSVSVLTFFIFDRFILKKSDPLEPGLTFLPFIYSITILIN
AFSIFISGPPLLGFDKIPLYGTFIASFGLAIITILVVRFVAVPYLRKKIQ
SNCSTATAKMSFGNGSSYVEDNHNLNGHVETHLDNNIVHIITKPKHIPIK
DKPEQCELFSGLQILTAVFGGFAHGGNDVSNAIGPLVGLWIIGLTQDLSS
KMAIPIWILLYGGFGITIGLWIWGRRVIKTMGDELTTITPSSGVCIELGS
AITVTVASNIGLPISTTHCKVGSIVAVGRYRSNENVDWKIFRHICFAWFI
TLPVTGGVSALIMFCLKKWAV*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000020protonephridia
PLANA:0000034epidermis
PLANA:0000087proximal tubule
PLANA:0000099neuron
PLANA:0000101muscle cell
PLANA:0000418head
PLANA:0003117parapharyngeal cell
Vocabulary: biological process
TermDefinition
GO:0006810transport
GO:0055085transmembrane transport
GO:0006817phosphate ion transport
Vocabulary: cellular component
TermDefinition
GO:0016021integral component of membrane
GO:0016020membrane
Vocabulary: molecular function
TermDefinition
GO:0005315inorganic phosphate transmembrane transporter activity
Vocabulary: INTERPRO
TermDefinition
IPR001204Phos_transporter
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001204Phosphate transporterPFAMPF01384PHO4coord: 25..459
e-value: 2.7E-121
score: 404.7
IPR001204Phosphate transporterPANTHERPTHR11101PHOSPHATE TRANSPORTERcoord: 300..467
coord: 6..262
NoneNo IPR availablePANTHERPTHR11101:SF46SODIUM-DEPENDENT PHOSPHATE TRANSPORTER 1coord: 300..467
coord: 6..262
NoneNo IPR availableTMHMMTMhelixcoord: 220..242
NoneNo IPR availableTMHMMTMhelixcoord: 148..170
NoneNo IPR availableTMHMMTMhelixcoord: 7..27
NoneNo IPR availableTMHMMTMhelixcoord: 92..114
NoneNo IPR availableTMHMMTMhelixcoord: 444..466
NoneNo IPR availableTMHMMTMhelixcoord: 124..141
NoneNo IPR availableTMHMMTMhelixcoord: 42..64
NoneNo IPR availableTMHMMTMhelixcoord: 185..207
NoneNo IPR availableTMHMMTMhelixcoord: 352..374