Thioredoxin

Overview
NameThioredoxin
Smed IDSMED30000004
Length (bp)594
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Thioredoxin (SMED30000004) t-SNE clustered cells

Violin plots show distribution of expression levels for Thioredoxin (SMED30000004) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Thioredoxin (SMED30000004) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Thioredoxin (SMED30000004) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30000004

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30000004SMESG000039109.1 SmedASXL_004540SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
neuronSMED30000004SMESG000039109.1 dd_Smed_v4_12784_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30000004SMESG000039109.1 dd_Smed_v6_12784_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
headSMED30000004SMESG000039109.1 OX_Smed_1.0.17033ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Thioredoxin vs. Ensembl Human
Match: TXN (thioredoxin [Source:HGNC Symbol;Acc:HGNC:12435])

HSP 1 Score: 108.227 bits (269), Expect = 3.418e-30
Identity = 48/99 (48.48%), Postives = 72/99 (72.73%), Query Frame = 1
Query:  109 MATSVESEEEFQDFIDGNGSKLVIVDFWAEWCGPCRLMSPAFDKFAKDSQFKDVIFLKVDVDELGELAEKYDISCMPTFIFFRNGEKIDEFSGANKDKL 405
            M   +ES+  FQ+ +D  G KLV+VDF A WCGPC+++ P F   ++  ++ +VIFL+VDVD+  ++A + ++ CMPTF FF+ G+K+ EFSGANK+KL
Sbjct:    1 MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSE--KYSNVIFLEVDVDDCQDVASECEVKCMPTFQFFKKGQKVGEFSGANKEKL 97          
BLAST of Thioredoxin vs. Ensembl Human
Match: TXN (thioredoxin [Source:HGNC Symbol;Acc:HGNC:12435])

HSP 1 Score: 84.3445 bits (207), Expect = 4.293e-21
Identity = 40/99 (40.40%), Postives = 57/99 (57.58%), Query Frame = 1
Query:  109 MATSVESEEEFQDFIDGNGSKLVIVDFWAEWCGPCRLMSPAFDKFAKDSQFKDVIFLKVDVDELGELAEKYDISCMPTFIFFRNGEKIDEFSGANKDKL 405
            M   +ES+  FQ+ +D  G KLV+VDF A WCGPC+++ P F                       ++A + ++ CMPTF FF+ G+K+ EFSGANK+KL
Sbjct:    1 MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFH----------------------DVASECEVKCMPTFQFFKKGQKVGEFSGANKEKL 77          
BLAST of Thioredoxin vs. Ensembl Human
Match: TXN2 (thioredoxin 2 [Source:HGNC Symbol;Acc:HGNC:17772])

HSP 1 Score: 81.6481 bits (200), Expect = 4.668e-19
Identity = 40/108 (37.04%), Postives = 65/108 (60.19%), Query Frame = 1
Query:   88 RISLRIFMATSVESEEEFQDFIDGNGSKLVIVDFWAEWCGPCRLMSPAFDKFAKDSQFKDVIFLKVDVDELGELAEKYDISCMPTFIFFRNGEKIDEFSGANKDKLLE 411
            RISL  F   +++   +FQD +  N    V+VDF A+WCGPC+++ P  +K     Q   V+  KVD+D+  +LA +Y++S +PT +  +NG+ +D+F G   +  LE
Sbjct:   56 RISLTTF---NIQDGPDFQDRV-VNSETPVVVDFHAQWCGPCKILGPRLEKMVA-KQHGKVVMAKVDIDDHTDLAIEYEVSAVPTVLAMKNGDVVDKFVGIKDEDQLE 158          
BLAST of Thioredoxin vs. Ensembl Human
Match: TXN2 (thioredoxin 2 [Source:HGNC Symbol;Acc:HGNC:17772])

HSP 1 Score: 81.6481 bits (200), Expect = 4.668e-19
Identity = 40/108 (37.04%), Postives = 65/108 (60.19%), Query Frame = 1
Query:   88 RISLRIFMATSVESEEEFQDFIDGNGSKLVIVDFWAEWCGPCRLMSPAFDKFAKDSQFKDVIFLKVDVDELGELAEKYDISCMPTFIFFRNGEKIDEFSGANKDKLLE 411
            RISL  F   +++   +FQD +  N    V+VDF A+WCGPC+++ P  +K     Q   V+  KVD+D+  +LA +Y++S +PT +  +NG+ +D+F G   +  LE
Sbjct:   56 RISLTTF---NIQDGPDFQDRV-VNSETPVVVDFHAQWCGPCKILGPRLEKMVA-KQHGKVVMAKVDIDDHTDLAIEYEVSAVPTVLAMKNGDVVDKFVGIKDEDQLE 158          
BLAST of Thioredoxin vs. Ensembl Human
Match: TXNL1 (thioredoxin like 1 [Source:HGNC Symbol;Acc:HGNC:12436])

HSP 1 Score: 83.9593 bits (206), Expect = 4.787e-19
Identity = 40/102 (39.22%), Postives = 61/102 (59.80%), Query Frame = 1
Query:  121 VESEEEFQDFIDGNGSKLVIVDFWAEWCGPCRLMSPAFDKFAKDSQFKDVIFLKVDVDELGELAEKYDISCMPTFIFFRNGEKIDEFSGANKDKLLEMLKSH 426
            V S+ +FQ  + G GS+L +V F    CGPC  ++PAF   +  +++   +FL+VDV +    A   +IS  PTF+FFRN  +ID++ GA+   L E +K H
Sbjct:    3 VGSDPDFQPELSGAGSRLAVVKFTMRGCGPCLRIAPAFSSMS--NKYPQAVFLEVDVHQCQGTAATNNISATPTFLFFRNKVRIDQYQGADAVGLEEKIKQH 102          
BLAST of Thioredoxin vs. Ensembl Celegans
Match: trx-1 (Thioredoxin-1 [Source:UniProtKB/Swiss-Prot;Acc:Q09433])

HSP 1 Score: 91.6633 bits (226), Expect = 4.793e-24
Identity = 40/97 (41.24%), Postives = 63/97 (64.95%), Query Frame = 1
Query:  136 EFQDFIDGNGSKLVIVDFWAEWCGPCRLMSPAFDKFAKDSQFKDVIFLKVDVDELGELAEKYDISCMPTFIFFRNGEKIDEFSGANKDKLLEMLKSH 426
            +F+  I  +  K++I+DF+A WCGPC+ ++P + + A  +  K +IF KVDVDE  +L  KYD+  MPTFIF +NG+ I+   G  +D+L + +  H
Sbjct:   16 DFEQLIRQHPEKIIILDFYATWCGPCKAIAPLYKELA--TTHKGIIFCKVDVDEAEDLCSKYDVKMMPTFIFTKNGDAIEALEGCVEDELRQKVLEH 110          
BLAST of Thioredoxin vs. Ensembl Celegans
Match: trx-1 (Thioredoxin-1 [Source:UniProtKB/Swiss-Prot;Acc:Q09433])

HSP 1 Score: 91.6633 bits (226), Expect = 5.727e-24
Identity = 40/99 (40.40%), Postives = 64/99 (64.65%), Query Frame = 1
Query:  130 EEEFQDFIDGNGSKLVIVDFWAEWCGPCRLMSPAFDKFAKDSQFKDVIFLKVDVDELGELAEKYDISCMPTFIFFRNGEKIDEFSGANKDKLLEMLKSH 426
            + +F+  I  +  K++I+DF+A WCGPC+ ++P + + A  +  K +IF KVDVDE  +L  KYD+  MPTFIF +NG+ I+   G  +D+L + +  H
Sbjct:   15 QSDFEQLIRQHPEKIIILDFYATWCGPCKAIAPLYKELA--TTHKGIIFCKVDVDEAEDLCSKYDVKMMPTFIFTKNGDAIEALEGCVEDELRQKVLEH 111          
BLAST of Thioredoxin vs. Ensembl Celegans
Match: png-1 (Peptide-N(4)-(N-acetyl-beta-glucosaminyl)asparagine amidase [Source:UniProtKB/Swiss-Prot;Acc:Q9TW67])

HSP 1 Score: 96.6709 bits (239), Expect = 3.473e-23
Identity = 40/105 (38.10%), Postives = 72/105 (68.57%), Query Frame = 1
Query:  115 TSVESEEEFQDFID-GNGSKLVIVDFWAEWCGPCRLMSPAFDKFAKDSQFKDVIFLKVDVDELGELAEKYDISCMPTFIFFRNGEKIDEFSGANKDKLLEMLKSH 426
            T V S  E  + ++  + ++L+I+DF+A WCGPCR++SP F++F+  +++ +  FLKV+ D   ++ ++Y+IS MPTFIF +N +++D   GAN+  + E ++ H
Sbjct:    4 TEVGSLPELNNILERSDANRLIIIDFFANWCGPCRMISPIFEQFS--AEYGNATFLKVNCDVARDIVQRYNISAMPTFIFLKNRQQVDMVRGANQQAIAEKIRQH 106          
BLAST of Thioredoxin vs. Ensembl Celegans
Match: trx-4 (Thioredoxin [Source:UniProtKB/TrEMBL;Acc:Q9TXY8])

HSP 1 Score: 82.4185 bits (202), Expect = 1.599e-20
Identity = 41/106 (38.68%), Postives = 69/106 (65.09%), Query Frame = 1
Query:  109 MATSVESEEEFQDFIDGNGSKLVIVDFWAEWCGPCRLMSPAFDKFAKDSQFKDVI-FLKVDVDELGELAEKYDISCMPTFIFFRNGEKIDEFSGANKDKLLEMLKS 423
            M+ +++ ++EF+       ++ VI+ F A WCGPC+++ P  ++ A  ++ KD +  LK+DVDE   + E+Y+I+ MPTF+   +G K D+FSGAN  K  EM+K+
Sbjct:    1 MSIAIKDDDEFKTIFAEKKTQPVILFFTASWCGPCQMIKPRVEELA--AEHKDRLSILKIDVDECDGVGEEYEINSMPTFLLIVDGIKKDQFSGANNTKFEEMVKA 104          
BLAST of Thioredoxin vs. Ensembl Celegans
Match: Y55F3AR.2 (pep chromosome:WBcel235:IV:1094545:1096723:1 gene:WBGene00021933.1 transcript:Y55F3AR.2.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:Y55F3AR.2)

HSP 1 Score: 85.8853 bits (211), Expect = 2.223e-20
Identity = 45/105 (42.86%), Postives = 61/105 (58.10%), Query Frame = 1
Query:  121 VESEEEF-QDFIDGNGSKLVIVDFWAEWCGPCRLMSPAFDKFAKDSQFKDVIFLKVDVDELGELAEKYDISCMPTFIFFRNGEKIDEFSGANKDKLLEMLKSHCK 432
            V  + +F + F  GNG K V VDF A WCGPC+ ++P F   A  +Q+K  +FLKVDVDE    A  Y ++ MPTFI F NG+K     GA++  L  M+  +  
Sbjct:    6 VNGDSDFDRKFSAGNG-KAVFVDFTASWCGPCQYIAPIFSDLA--NQYKGSVFLKVDVDECRGTAATYGVNAMPTFIAFVNGQKKATIQGADESGLRSMVAKYAS 107          
BLAST of Thioredoxin vs. Ensembl Fly
Match: Trx-2 (gene:FBgn0040070 transcript:FBtr0079840)

HSP 1 Score: 97.4413 bits (241), Expect = 3.325e-26
Identity = 45/107 (42.06%), Postives = 74/107 (69.16%), Query Frame = 1
Query:  109 MATSVESEEEFQDFIDGNGSKLVIVDFWAEWCGPCRLMSPAFDKFAKDSQFKD-VIFLKVDVDELGELAEKYDISCMPTFIFFRNGEKIDEFSGANKDKLLEMLKSH 426
            M   V+ + +    +     KLV++DF+A WCGPC+++SP   + +  +QF D V+ LKVDVDE  ++A +Y+IS MPTF+F +NG K++EF+GAN  +L +++K++
Sbjct:    1 MVYQVKDKADLDGQLTKASGKLVVLDFFATWCGPCKMISPKLVELS--TQFADNVVVLKVDVDECEDIAMEYNISSMPTFVFLKNGVKVEEFAGANAKRLEDVIKAN 105          
BLAST of Thioredoxin vs. Ensembl Fly
Match: Trx-2 (gene:FBgn0040070 transcript:FBtr0079839)

HSP 1 Score: 97.4413 bits (241), Expect = 3.325e-26
Identity = 45/107 (42.06%), Postives = 74/107 (69.16%), Query Frame = 1
Query:  109 MATSVESEEEFQDFIDGNGSKLVIVDFWAEWCGPCRLMSPAFDKFAKDSQFKD-VIFLKVDVDELGELAEKYDISCMPTFIFFRNGEKIDEFSGANKDKLLEMLKSH 426
            M   V+ + +    +     KLV++DF+A WCGPC+++SP   + +  +QF D V+ LKVDVDE  ++A +Y+IS MPTF+F +NG K++EF+GAN  +L +++K++
Sbjct:    1 MVYQVKDKADLDGQLTKASGKLVVLDFFATWCGPCKMISPKLVELS--TQFADNVVVLKVDVDECEDIAMEYNISSMPTFVFLKNGVKVEEFAGANAKRLEDVIKAN 105          
BLAST of Thioredoxin vs. Ensembl Fly
Match: dhd (gene:FBgn0011761 transcript:FBtr0070749)

HSP 1 Score: 90.5077 bits (223), Expect = 1.438e-23
Identity = 38/100 (38.00%), Postives = 60/100 (60.00%), Query Frame = 1
Query:  118 SVESEEEFQDFIDGNGSKLVIVDFWAEWCGPCRLMSPAFDKFAKDSQFKDVIFLKVDVDELGELAEKYDISCMPTFIFFRNGEKIDEFSGANKDKLLEML 417
            SV +  ++   I+    KL+++DF+A WCGPC+ M       A+    K V+ LK+DVD+  EL E+Y +  MPTF+F R   ++  F+GA++ KL  M+
Sbjct:    3 SVRTMNDYHKRIEAADDKLIVLDFYATWCGPCKEMESTVKSLARKYSSKAVV-LKIDVDKFEELTERYKVRSMPTFVFLRQNRRLASFAGADEHKLTNMM 101          
BLAST of Thioredoxin vs. Ensembl Fly
Match: dhd (gene:FBgn0011761 transcript:FBtr0345745)

HSP 1 Score: 90.5077 bits (223), Expect = 1.438e-23
Identity = 38/100 (38.00%), Postives = 60/100 (60.00%), Query Frame = 1
Query:  118 SVESEEEFQDFIDGNGSKLVIVDFWAEWCGPCRLMSPAFDKFAKDSQFKDVIFLKVDVDELGELAEKYDISCMPTFIFFRNGEKIDEFSGANKDKLLEML 417
            SV +  ++   I+    KL+++DF+A WCGPC+ M       A+    K V+ LK+DVD+  EL E+Y +  MPTF+F R   ++  F+GA++ KL  M+
Sbjct:    3 SVRTMNDYHKRIEAADDKLIVLDFYATWCGPCKEMESTVKSLARKYSSKAVV-LKIDVDKFEELTERYKVRSMPTFVFLRQNRRLASFAGADEHKLTNMM 101          
BLAST of Thioredoxin vs. Ensembl Fly
Match: TrxT (gene:FBgn0029752 transcript:FBtr0070755)

HSP 1 Score: 90.8929 bits (224), Expect = 4.586e-23
Identity = 37/87 (42.53%), Postives = 64/87 (73.56%), Query Frame = 1
Query:  169 KLVIVDFWAEWCGPCRLMSPAFDKFAKDSQFKD-VIFLKVDVDELGELAEKYDISCMPTFIFFRNGEKIDEFSGANKDKLLEMLKSH 426
            KLV++DF+A+WCGPC++++P  D+ A+  Q+ D V+ LKV+VDE  ++  +Y+++ MPTF+F + G  ++ F G N DKL ++++ H
Sbjct:   21 KLVVIDFYADWCGPCKIIAPKLDELAQ--QYSDRVVVLKVNVDENEDITVEYNVNSMPTFVFIKGGNVLELFVGCNSDKLAKLMEKH 105          
BLAST of Thioredoxin vs. Ensembl Zebrafish
Match: TXN (zgc:56493 [Source:ZFIN;Acc:ZDB-GENE-030131-8581])

HSP 1 Score: 114.005 bits (284), Expect = 1.659e-32
Identity = 48/106 (45.28%), Postives = 76/106 (71.70%), Query Frame = 1
Query:  109 MATSVESEEEFQDFIDGNGSKLVIVDFWAEWCGPCRLMSPAFDKFAKDSQFKDVIFLKVDVDELGELAEKYDISCMPTFIFFRNGEKIDEFSGANKDKLLEMLKSH 426
            M   +E ++ F   + G G KLV+VDF A WCGPC+ ++P +   +++  + +V+FLKVDVD+  ++A+  +I CMPTF F++NG+K+D+FSG+N+ KL EM+K H
Sbjct:    1 MIVVIEDQDGFDKALAGAGDKLVVVDFTATWCGPCQSIAPFYKGLSENPDYSNVVFLKVDVDDAQDVAQSCEIKCMPTFHFYKNGKKLDDFSGSNQTKLEEMVKQH 106          
BLAST of Thioredoxin vs. Ensembl Zebrafish
Match: txn (thioredoxin [Source:ZFIN;Acc:ZDB-GENE-040718-162])

HSP 1 Score: 111.309 bits (277), Expect = 1.788e-31
Identity = 50/106 (47.17%), Postives = 72/106 (67.92%), Query Frame = 1
Query:  109 MATSVESEEEFQDFIDGNGSKLVIVDFWAEWCGPCRLMSPAFDKFAKDSQFKDVIFLKVDVDELGELAEKYDISCMPTFIFFRNGEKIDEFSGANKDKLLEMLKSH 426
            M   +E +  F + +   G KLV+VDF A WCGPC+ + P F   ++  + K+V+FLKVDVD+  ++A    ISCMPTF F++NG+K+DEFSG+N+ KL E + SH
Sbjct:    1 MVLEIEDKAAFDNALKNAGDKLVVVDFTATWCGPCQTIGPYFKLLSEKPENKNVVFLKVDVDDAQDVAALCGISCMPTFHFYKNGKKVDEFSGSNQSKLEEKINSH 106          
BLAST of Thioredoxin vs. Ensembl Zebrafish
Match: txn (thioredoxin [Source:ZFIN;Acc:ZDB-GENE-040718-162])

HSP 1 Score: 108.227 bits (269), Expect = 2.476e-30
Identity = 48/99 (48.48%), Postives = 69/99 (69.70%), Query Frame = 1
Query:  130 EEEFQDFIDGNGSKLVIVDFWAEWCGPCRLMSPAFDKFAKDSQFKDVIFLKVDVDELGELAEKYDISCMPTFIFFRNGEKIDEFSGANKDKLLEMLKSH 426
            +  F + +   G KLV+VDF A WCGPC+ + P F   ++  + K+V+FLKVDVD+  ++A    ISCMPTF F++NG+K+DEFSG+N+ KL E + SH
Sbjct:    6 QAAFDNALKNAGDKLVVVDFTATWCGPCQTIGPYFKLLSEKPENKNVVFLKVDVDDAQDVAALCGISCMPTFHFYKNGKKVDEFSGSNQSKLEEKINSH 104          
BLAST of Thioredoxin vs. Ensembl Zebrafish
Match: txnl1 (thioredoxin-like 1 [Source:ZFIN;Acc:ZDB-GENE-040426-701])

HSP 1 Score: 80.1073 bits (196), Expect = 9.168e-18
Identity = 37/102 (36.27%), Postives = 61/102 (59.80%), Query Frame = 1
Query:  121 VESEEEFQDFIDGNGSKLVIVDFWAEWCGPCRLMSPAFDKFAKDSQFKDVIFLKVDVDELGELAEKYDISCMPTFIFFRNGEKIDEFSGANKDKLLEMLKSH 426
            + ++ +FQ  + G GS+L +V F    C PC  ++PAF+  +  +++  V+FL+VDV      A   +IS  PTF+FFRN  ++D++ GA+   L E +K H
Sbjct:    7 IGNDSDFQAELSGAGSRLTVVKFTMSGCRPCVRIAPAFNMLS--NKYPQVVFLEVDVHVCQATAAANNISATPTFLFFRNKVRVDQYQGADASGLEEKIKQH 106          
BLAST of Thioredoxin vs. Ensembl Zebrafish
Match: txnl1 (thioredoxin-like 1 [Source:ZFIN;Acc:ZDB-GENE-040426-701])

HSP 1 Score: 80.1073 bits (196), Expect = 9.390e-18
Identity = 37/102 (36.27%), Postives = 61/102 (59.80%), Query Frame = 1
Query:  121 VESEEEFQDFIDGNGSKLVIVDFWAEWCGPCRLMSPAFDKFAKDSQFKDVIFLKVDVDELGELAEKYDISCMPTFIFFRNGEKIDEFSGANKDKLLEMLKSH 426
            + ++ +FQ  + G GS+L +V F    C PC  ++PAF+  +  +++  V+FL+VDV      A   +IS  PTF+FFRN  ++D++ GA+   L E +K H
Sbjct:    7 IGNDSDFQAELSGAGSRLTVVKFTMSGCRPCVRIAPAFNMLS--NKYPQVVFLEVDVHVCQATAAANNISATPTFLFFRNKVRVDQYQGADASGLEEKIKQH 106          
BLAST of Thioredoxin vs. Ensembl Xenopus
Match: ENSXETT00000029198.1 (MGC80314 protein [Source:NCBI gene;Acc:100170420])

HSP 1 Score: 115.161 bits (287), Expect = 8.340e-33
Identity = 50/104 (48.08%), Postives = 76/104 (73.08%), Query Frame = 1
Query:  109 MATSVESEEEFQDFIDGNGSKLVIVDFWAEWCGPCRLMSPAFDKFAKDSQFKDVIFLKVDVDELGELAEKYDISCMPTFIFFRNGEKIDEFSGANKDKLLEMLK 420
            M   VES +EFQ+ +   G KLV+VDF A WCGPC+++SP F+K + ++   DV+F+KVDVD+  ++A   D+ CMPTF F++NG+K+ EFSGAN+  L++ ++
Sbjct:    1 MVRHVESLDEFQNILKEAGDKLVVVDFTATWCGPCKMISPVFEKLSVEN--PDVVFIKVDVDDAQDVAAHCDVKCMPTFHFYKNGQKVHEFSGANQASLIQKVQ 102          
BLAST of Thioredoxin vs. Ensembl Xenopus
Match: btg5.3 (B-cell translocation gene 5, gene 3 [Source:Xenbase;Acc:XB-GENE-5805799])

HSP 1 Score: 100.908 bits (250), Expect = 2.444e-27
Identity = 46/103 (44.66%), Postives = 73/103 (70.87%), Query Frame = 1
Query:  121 VESEEEFQDFIDGNGSKLVIVDFWAEWCGPCRLMSPAFDKFAKDSQFKDVIFLKVDVDELGELAEKYDISCMPTFIFFRNGEKIDEFSGANKDKLLEMLKSHC 429
            V  +EE+Q  +   G KLV++DF A+WCGPC+ ++P F+K +  ++F D++  KVDVD+  ++A+   IS MPTFIFF++G++++ FSGA+  KL E +K  C
Sbjct:    3 VSLQEEYQCALKDAGEKLVVIDFTAKWCGPCQRIAPDFEKLS--TEFPDIVLYKVDVDDASDVAQVCGISSMPTFIFFKSGKQVERFSGADIKKLKETIKRLC 103          
BLAST of Thioredoxin vs. Ensembl Xenopus
Match: btg5.3 (B-cell translocation gene 5, gene 3 [Source:Xenbase;Acc:XB-GENE-5805799])

HSP 1 Score: 85.5001 bits (210), Expect = 3.703e-21
Identity = 38/88 (43.18%), Postives = 62/88 (70.45%), Query Frame = 1
Query:  109 MATSVESEEEFQDFIDGNGSKLVIVDFWAEWCGPCRLMSPAFDKFAKDSQFKDVIFLKVDVDELGELAEKYDISCMPTFIFFRNGEKI 372
            M   + S EE+Q  +   G KLV++DF A+WCGPC+ ++P F+K +  ++F D++  KVDVD+  ++A+   IS MPTFIFF++G+++
Sbjct:    1 MVKYLASVEEYQCALKDAGEKLVVIDFTAKWCGPCQRIAPDFEKLS--TEFPDIVLYKVDVDDASDVAQVCGISSMPTFIFFKSGKQV 86          
BLAST of Thioredoxin vs. Ensembl Xenopus
Match: tnfsf13b (TNF superfamily member 13b [Source:Xenbase;Acc:XB-GENE-482353])

HSP 1 Score: 83.5741 bits (205), Expect = 7.918e-20
Identity = 47/145 (32.41%), Postives = 83/145 (57.24%), Query Frame = 1
Query:   13 PLFNCSL*NKIRSR-FNRYFSTELFQRISLRIFMATS-------VESEEEFQDFIDGNGSKLVIVDFWAEWCGPCRLMSPAFDKFAKDSQFKDVIFLKVDVDELGELAEKYDISCMPTFIFFRNGEKIDEFSG-ANKDKLLEMLK 420
            P  +  L N IRS       S+ L    +LR    ++       V+  ++FQ+ + G+ +  V+VDF A+WCGPC++++P  +K     Q K V+  KVD+D+  +LA ++++S +PT +  +NG+ +D+F G  ++D+L   LK
Sbjct:   23 PSLSTCLSNGIRSHGLKTLTSSRLHPHCNLRPISTSTPCRVTFNVQDADDFQERVVGSETP-VVVDFHAQWCGPCKILAPRLEKVVAKQQGK-VVMAKVDIDDHTDLALEFEVSAVPTVLAIKNGDVVDKFVGLKDEDQLDAFLK 165          
BLAST of Thioredoxin vs. Ensembl Xenopus
Match: glrx3 (glutaredoxin 3 [Source:NCBI gene;Acc:549963])

HSP 1 Score: 79.7221 bits (195), Expect = 2.284e-17
Identity = 36/109 (33.03%), Postives = 64/109 (58.72%), Query Frame = 1
Query:  109 MATSVE--SEEEFQDFIDGNGSKLVIVDFWAEWCGPCRLMSPAFDKFAKDSQFKDVIFLKVDVDELGELAEKYDISCMPTFIFFRNGEKIDEFSGANKDKLLEMLKSHC 429
            MA  +E  S  +F+  I  +   L +V FWA W   C  M+    + AK+     V+F+K++ + + E++EKY+++ +PTF+FF+N +KID   GA+  +L + ++ H 
Sbjct:    1 MAAVLEAGSAGQFEQLIQNSAKSLTVVHFWAPWAPQCTQMNEVMAELAKEQ--PQVMFVKLEAEAVPEVSEKYEVTSVPTFLFFKNSQKIDRLDGAHAPELTKRVQRHA 107          
BLAST of Thioredoxin vs. Ensembl Mouse
Match: Txn1 (thioredoxin 1 [Source:MGI Symbol;Acc:MGI:98874])

HSP 1 Score: 103.605 bits (257), Expect = 1.667e-28
Identity = 46/99 (46.46%), Postives = 69/99 (69.70%), Query Frame = 1
Query:  109 MATSVESEEEFQDFIDGNGSKLVIVDFWAEWCGPCRLMSPAFDKFAKDSQFKDVIFLKVDVDELGELAEKYDISCMPTFIFFRNGEKIDEFSGANKDKL 405
            M   +ES+E FQ+ +   G KLV+VDF A WCGPC+++ P F       ++ +V+FL+VDVD+  ++A   ++ CMPTF F++ G+K+ EFSGANK+KL
Sbjct:    1 MVKLIESKEAFQEALAAAGDKLVVVDFSATWCGPCKMIKPFFHSLC--DKYSNVVFLEVDVDDCQDVAADCEVKCMPTFQFYKKGQKVGEFSGANKEKL 97          
BLAST of Thioredoxin vs. Ensembl Mouse
Match: Txndc2 (thioredoxin domain containing 2 (spermatozoa) [Source:MGI Symbol;Acc:MGI:2389312])

HSP 1 Score: 87.4261 bits (215), Expect = 9.501e-20
Identity = 41/90 (45.56%), Postives = 61/90 (67.78%), Query Frame = 1
Query:  121 VESEEEFQDFIDGNGSKLVIVDFWAEWCGPCRLMSPAFDKFAKDSQFKDVIFLKVDVDELGELAEKYDISCMPTFIFFRNGEKIDEFSGA 390
            ++ +EEF++ +   G KLV VDF A WCGPCR+M P F   +   + +DVIFL+VD ++  +L +  +I  +PTF F++N EK+ EFSGA
Sbjct:  450 IKDKEEFEEVLKDAGEKLVAVDFSAAWCGPCRMMKPLFHSLS--LKHEDVIFLEVDTEDCEQLVQDCEIFHLPTFQFYKNEEKVGEFSGA 537          
BLAST of Thioredoxin vs. Ensembl Mouse
Match: Txndc2 (thioredoxin domain containing 2 (spermatozoa) [Source:MGI Symbol;Acc:MGI:2389312])

HSP 1 Score: 87.0409 bits (214), Expect = 9.802e-20
Identity = 41/90 (45.56%), Postives = 61/90 (67.78%), Query Frame = 1
Query:  121 VESEEEFQDFIDGNGSKLVIVDFWAEWCGPCRLMSPAFDKFAKDSQFKDVIFLKVDVDELGELAEKYDISCMPTFIFFRNGEKIDEFSGA 390
            ++ +EEF++ +   G KLV VDF A WCGPCR+M P F   +   + +DVIFL+VD ++  +L +  +I  +PTF F++N EK+ EFSGA
Sbjct:  443 IKDKEEFEEVLKDAGEKLVAVDFSAAWCGPCRMMKPLFHSLS--LKHEDVIFLEVDTEDCEQLVQDCEIFHLPTFQFYKNEEKVGEFSGA 530          
BLAST of Thioredoxin vs. Ensembl Mouse
Match: Txndc8 (thioredoxin domain containing 8 [Source:MGI Symbol;Acc:MGI:1914652])

HSP 1 Score: 81.6481 bits (200), Expect = 2.145e-19
Identity = 37/97 (38.14%), Postives = 60/97 (61.86%), Query Frame = 1
Query:   94 SLRIFMATSVESEEEFQDFIDGNGSKLVIVDFWAEWCGPCRLMSPAFDKFAKDSQFKDVIFLKVDVDELGELAEKYDISCMPTFIFFRNGEKIDEFS 384
            S  + M   +++  E ++     G+KLV+V+F A+WCGPC+ ++P F   A   ++++V F +VDVD   ELAE  DI+ +PTF  F+  +K+  FS
Sbjct:   22 SQMLIMVKRIKNMSELKELFSDAGNKLVVVEFSAKWCGPCKTIAPVFQ--AMSLKYQNVTFAQVDVDSSKELAEHCDITMLPTFQMFKYTQKVTPFS 116          
BLAST of Thioredoxin vs. Ensembl Mouse
Match: Txnl1 (thioredoxin-like 1 [Source:MGI Symbol;Acc:MGI:1860078])

HSP 1 Score: 83.9593 bits (206), Expect = 3.508e-19
Identity = 40/102 (39.22%), Postives = 61/102 (59.80%), Query Frame = 1
Query:  121 VESEEEFQDFIDGNGSKLVIVDFWAEWCGPCRLMSPAFDKFAKDSQFKDVIFLKVDVDELGELAEKYDISCMPTFIFFRNGEKIDEFSGANKDKLLEMLKSH 426
            V S+ +FQ  + G GS+L +V F    CGPC  ++PAF   +  +++   +FL+VDV +    A   +IS  PTF+FFRN  +ID++ GA+   L E +K H
Sbjct:    7 VGSDPDFQPELSGAGSRLAVVKFTMRGCGPCLRIAPAFSSMS--NKYPQAVFLEVDVHQCQGTAATNNISATPTFLFFRNKVRIDQYQGADAVGLEEKIKQH 106          
BLAST of Thioredoxin vs. UniProt/SwissProt
Match: sp|Q9DGI3|THIO_ICTPU (Thioredoxin OS=Ictalurus punctatus OX=7998 GN=txn PE=3 SV=1)

HSP 1 Score: 113.235 bits (282), Expect = 2.209e-31
Identity = 48/106 (45.28%), Postives = 70/106 (66.04%), Query Frame = 1
Query:  109 MATSVESEEEFQDFIDGNGSKLVIVDFWAEWCGPCRLMSPAFDKFAKDSQFKDVIFLKVDVDELGELAEKYDISCMPTFIFFRNGEKIDEFSGANKDKLLEMLKSH 426
            M   +E+   F   +   G KLV+VDF A WCGPC+ + P F+  +K   +++V+FLKVDVD+  +++   DI CMPTF F++NG+KIDEFSGAN+  L + +  H
Sbjct:    1 MVVHIENLNAFSAALKNAGDKLVVVDFTATWCGPCQKIGPIFETLSKSEDYQNVVFLKVDVDDAADVSSHCDIKCMPTFHFYKNGQKIDEFSGANEQTLKQKINDH 106          
BLAST of Thioredoxin vs. UniProt/SwissProt
Match: sp|O97508|THIO_HORSE (Thioredoxin OS=Equus caballus OX=9796 GN=TXN PE=3 SV=3)

HSP 1 Score: 109.768 bits (273), Expect = 4.332e-30
Identity = 48/104 (46.15%), Postives = 75/104 (72.12%), Query Frame = 1
Query:  109 MATSVESEEEFQDFIDGNGSKLVIVDFWAEWCGPCRLMSPAFDKFAKDSQFKDVIFLKVDVDELGELAEKYDISCMPTFIFFRNGEKIDEFSGANKDKLLEMLK 420
            M   +ES+  FQ+ ++  G KLV+VDF A WCGPC+++ P F   ++  ++ +V+FL+VDVD+  ++A + ++ CMPTF FF+ G+K+DEFSGANK+KL   +K
Sbjct:    1 MVKQIESKSAFQEALNSAGEKLVVVDFSATWCGPCKMIKPFFHSLSE--KYSNVVFLEVDVDDCQDVAAECEVKCMPTFQFFKKGQKVDEFSGANKEKLEATIK 102          
BLAST of Thioredoxin vs. UniProt/SwissProt
Match: sp|P10599|THIO_HUMAN (Thioredoxin OS=Homo sapiens OX=9606 GN=TXN PE=1 SV=3)

HSP 1 Score: 108.227 bits (269), Expect = 1.642e-29
Identity = 48/99 (48.48%), Postives = 72/99 (72.73%), Query Frame = 1
Query:  109 MATSVESEEEFQDFIDGNGSKLVIVDFWAEWCGPCRLMSPAFDKFAKDSQFKDVIFLKVDVDELGELAEKYDISCMPTFIFFRNGEKIDEFSGANKDKL 405
            M   +ES+  FQ+ +D  G KLV+VDF A WCGPC+++ P F   ++  ++ +VIFL+VDVD+  ++A + ++ CMPTF FF+ G+K+ EFSGANK+KL
Sbjct:    1 MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSE--KYSNVIFLEVDVDDCQDVASECEVKCMPTFQFFKKGQKVGEFSGANKEKL 97          
BLAST of Thioredoxin vs. UniProt/SwissProt
Match: sp|P08628|THIO_RABIT (Thioredoxin OS=Oryctolagus cuniculus OX=9986 GN=TXN PE=1 SV=2)

HSP 1 Score: 107.842 bits (268), Expect = 2.946e-29
Identity = 47/99 (47.47%), Postives = 72/99 (72.73%), Query Frame = 1
Query:  109 MATSVESEEEFQDFIDGNGSKLVIVDFWAEWCGPCRLMSPAFDKFAKDSQFKDVIFLKVDVDELGELAEKYDISCMPTFIFFRNGEKIDEFSGANKDKL 405
            M   +ES+  FQ+ +D  G KLV+VDF A WCGPC+++ P F   ++  +F +V+F++VDVD+  ++A + ++ CMPTF FF+ G+K+ EFSGANK+KL
Sbjct:    1 MVKQIESKSAFQEVLDSAGDKLVVVDFSATWCGPCKMIKPFFHALSE--KFNNVVFIEVDVDDCKDIAAECEVKCMPTFQFFKKGQKVGEFSGANKEKL 97          
BLAST of Thioredoxin vs. UniProt/SwissProt
Match: sp|P29451|THIO_MACMU (Thioredoxin OS=Macaca mulatta OX=9544 GN=TXN PE=3 SV=2)

HSP 1 Score: 106.686 bits (265), Expect = 8.790e-29
Identity = 47/99 (47.47%), Postives = 72/99 (72.73%), Query Frame = 1
Query:  109 MATSVESEEEFQDFIDGNGSKLVIVDFWAEWCGPCRLMSPAFDKFAKDSQFKDVIFLKVDVDELGELAEKYDISCMPTFIFFRNGEKIDEFSGANKDKL 405
            M   +ES+  FQ+ +D  G KLV+VDF A WCGPC+++ P F   ++  ++ +V+FL+VDVD+  ++A + ++ CMPTF FF+ G+K+ EFSGANK+KL
Sbjct:    1 MVKQIESKAAFQEALDDAGDKLVVVDFSATWCGPCKMIKPFFHSLSE--KYSNVVFLEVDVDDCQDVASECEVKCMPTFQFFKKGQKVGEFSGANKEKL 97          
BLAST of Thioredoxin vs. TrEMBL
Match: R7T9C0 (Thioredoxin OS=Capitella teleta OX=283909 GN=CAPTEDRAFT_206416 PE=3 SV=1)

HSP 1 Score: 139.043 bits (349), Expect = 5.199e-39
Identity = 60/102 (58.82%), Postives = 85/102 (83.33%), Query Frame = 1
Query:  121 VESEEEFQDFIDGNGSKLVIVDFWAEWCGPCRLMSPAFDKFAKDSQFKDVIFLKVDVDELGELAEKYDISCMPTFIFFRNGEKIDEFSGANKDKLLEMLKSH 426
            VE  ++F D  D +G KLV+ DFWA WCGPCRL+ P F+K A ++++KDVIF+KVDVDE GELAE+Y+I  MPTF+FF++GEKIDE +G+NK+KL+E+++++
Sbjct:    7 VECADDFYDIRDCSGGKLVVADFWAAWCGPCRLIGPTFEKMANEAEYKDVIFVKVDVDENGELAEEYEIQVMPTFLFFKDGEKIDEMAGSNKEKLVELVQTY 108          
BLAST of Thioredoxin vs. TrEMBL
Match: A0A3B3XC82 (Thioredoxin OS=Poecilia mexicana OX=48701 PE=3 SV=1)

HSP 1 Score: 126.716 bits (317), Expect = 3.063e-34
Identity = 58/105 (55.24%), Postives = 78/105 (74.29%), Query Frame = 1
Query:  109 MATSVESEEEFQDFIDGNGSKLVIVDFWAEWCGPCRLMSPAFDKFAKDSQFKDVIFLKVDVDELGELAEKYDISCMPTFIFFRNGEKIDEFSGANKDKLLEMLKS 423
            M   VE+ EEF + +   G+KLV+VDF A WCGPCR++ P F+K A+DS  KDVIFLKVDVDE  ++++K  I CMPTF F++NGEK+DEF+G N+ KL E ++ 
Sbjct:    1 MVKFVENLEEFDNILSQAGNKLVVVDFTASWCGPCRMIGPVFEKLAEDSANKDVIFLKVDVDEASDVSQKCGIRCMPTFQFYKNGEKVDEFTGPNEKKLTEKIEQ 105          
BLAST of Thioredoxin vs. TrEMBL
Match: A0A074ZG27 (Thioredoxin OS=Opisthorchis viverrini OX=6198 GN=T265_07758 PE=3 SV=1)

HSP 1 Score: 121.709 bits (304), Expect = 3.568e-32
Identity = 54/106 (50.94%), Postives = 76/106 (71.70%), Query Frame = 1
Query:  109 MATSVESEEEFQDFIDGNGSKLVIVDFWAEWCGPCRLMSPAFDKFAKDSQFKDVIFLKVDVDELGELAEKYDISCMPTFIFFRNGEKIDEFSGANKDKLLEMLKSH 426
            M   + ++ E    + GN  KLV++DF+AEWCGPCR ++P     A+  +FKDV+FLKV+VD   EL++ Y I+CMPTF+F + GEK+D FSGA++ KLLEM+K H
Sbjct:    1 MVKQICTKAELNKEVSGNSGKLVVIDFYAEWCGPCRAIAPKVASMAE--EFKDVVFLKVNVDVGEELSKAYCITCMPTFVFLKGGEKVDSFSGADEKKLLEMVKKH 104          
BLAST of Thioredoxin vs. TrEMBL
Match: A0A087XNX9 (Thioredoxin OS=Poecilia formosa OX=48698 PE=3 SV=2)

HSP 1 Score: 120.939 bits (302), Expect = 6.568e-32
Identity = 55/105 (52.38%), Postives = 77/105 (73.33%), Query Frame = 1
Query:  109 MATSVESEEEFQDFIDGNGSKLVIVDFWAEWCGPCRLMSPAFDKFAKDSQFKDVIFLKVDVDELGELAEKYDISCMPTFIFFRNGEKIDEFSGANKDKLLEMLKS 423
            M   V++ EEF D +   G+KLV+VDF A WCGPCR++ P F+K A+D   K VIFLKVDVDE  ++++K +I  MPTF F++NG+K+DEF+GAN+  L+E +K 
Sbjct:    1 MVKFVKTLEEFNDILSTAGNKLVVVDFTATWCGPCRMIGPVFEKQAEDPANKHVIFLKVDVDEASDVSQKCEIRSMPTFHFYKNGKKVDEFTGANEKLLMEKIKQ 105          
BLAST of Thioredoxin vs. TrEMBL
Match: A0A3Q2Y6G0 (Thioredoxin OS=Hippocampus comes OX=109280 PE=3 SV=1)

HSP 1 Score: 119.013 bits (297), Expect = 4.135e-31
Identity = 50/104 (48.08%), Postives = 74/104 (71.15%), Query Frame = 1
Query:  106 FMATSVESEEEFQDFIDGNGSKLVIVDFWAEWCGPCRLMSPAFDKFAKDSQFKDVIFLKVDVDELGELAEKYDISCMPTFIFFRNGEKIDEFSGANKDKLLEML 417
             +  S+ES EEF  ++  +G KL++VDF A WCGPC+ M+P F++ + ++ + DVIFLKVDVD+  E++ K  + CMPTF F+RNG ++D FSGAN+  L + L
Sbjct:    1 MVVVSIESTEEFDGYLKNSGDKLIVVDFTAVWCGPCKTMAPIFEELSNNAAYADVIFLKVDVDKCEEVSTKSGVQCMPTFHFYRNGSRVDYFSGANQATLKKKL 104          
BLAST of Thioredoxin vs. Ensembl Cavefish
Match: txn (thioredoxin-like [Source:NCBI gene;Acc:103039731])

HSP 1 Score: 117.857 bits (294), Expect = 4.140e-34
Identity = 50/102 (49.02%), Postives = 75/102 (73.53%), Query Frame = 1
Query:  121 VESEEEFQDFIDGNGSKLVIVDFWAEWCGPCRLMSPAFDKFAKDSQFKDVIFLKVDVDELGELAEKYDISCMPTFIFFRNGEKIDEFSGANKDKLLEMLKSH 426
            +E ++ F   +   GSKLV+VDF A WCGPC++++P + + + + Q  +V+FLKVDVD+  ++A   +I CMPTF F++NG+KIDEFSG N+DKL+E+L  H
Sbjct:    6 IEDKDSFDKALRDAGSKLVVVDFTATWCGPCKMIAPYYKELSDNPQNSNVVFLKVDVDDAQDVAAHCEIKCMPTFHFYKNGKKIDEFSGGNRDKLVEILNKH 107          
BLAST of Thioredoxin vs. Ensembl Cavefish
Match: zgc:56493 (thioredoxin-like [Source:NCBI gene;Acc:103040975])

HSP 1 Score: 103.99 bits (258), Expect = 9.599e-29
Identity = 46/106 (43.40%), Postives = 73/106 (68.87%), Query Frame = 1
Query:  109 MATSVESEEEFQDFIDGNGSKLVIVDFWAEWCGPCRLMSPAFDKFAKDSQFKDVIFLKVDVDELGELAEKYDISCMPTFIFFRNGEKIDEFSGANKDKLLEMLKSH 426
            M   +E +E F   +   G KLV+VDF A WCGPC+ ++P +   ++     +V+FLKVDVD+  ++A+  +I CMPTF F++NG+K+DEFSG+N+ KL E++ ++
Sbjct:    1 MIIVIEDQEGFDKALAEAGDKLVVVDFTATWCGPCQSIAPFYKGLSEKPDNGNVVFLKVDVDDAQDVAQSCEIKCMPTFHFYKNGKKVDEFSGSNQAKLEELVNTN 106          
BLAST of Thioredoxin vs. Ensembl Cavefish
Match: txnl1 (thioredoxin like 1 [Source:NCBI gene;Acc:103021638])

HSP 1 Score: 78.1814 bits (191), Expect = 4.351e-17
Identity = 37/102 (36.27%), Postives = 60/102 (58.82%), Query Frame = 1
Query:  121 VESEEEFQDFIDGNGSKLVIVDFWAEWCGPCRLMSPAFDKFAKDSQFKDVIFLKVDVDELGELAEKYDISCMPTFIFFRNGEKIDEFSGANKDKLLEMLKSH 426
            + ++ EFQ  +   GS+L +V F    C PC  ++PAF+  +  S++  V+FL+VDV      A   +IS  PTF+FFRN  ++D++ GA+   L + +K H
Sbjct:    7 IANDAEFQPELASAGSRLAVVKFTMAGCRPCLRIAPAFNMLS--SKYPQVVFLEVDVHVCQGTAAANNISATPTFLFFRNKVRVDQYQGADASGLEDKIKQH 106          
BLAST of Thioredoxin vs. Ensembl Cavefish
Match: txnl1 (thioredoxin like 1 [Source:NCBI gene;Acc:103021638])

HSP 1 Score: 77.7962 bits (190), Expect = 4.832e-17
Identity = 37/102 (36.27%), Postives = 60/102 (58.82%), Query Frame = 1
Query:  121 VESEEEFQDFIDGNGSKLVIVDFWAEWCGPCRLMSPAFDKFAKDSQFKDVIFLKVDVDELGELAEKYDISCMPTFIFFRNGEKIDEFSGANKDKLLEMLKSH 426
            + ++ EFQ  +   GS+L +V F    C PC  ++PAF+  +  S++  V+FL+VDV      A   +IS  PTF+FFRN  ++D++ GA+   L + +K H
Sbjct:    7 IANDAEFQPELASAGSRLAVVKFTMAGCRPCLRIAPAFNMLS--SKYPQVVFLEVDVHVCQGTAAANNISATPTFLFFRNKVRVDQYQGADASGLEDKIKQH 106          
BLAST of Thioredoxin vs. Ensembl Cavefish
Match: txn2 (thioredoxin 2 [Source:NCBI gene;Acc:103028978])

HSP 1 Score: 72.4034 bits (176), Expect = 7.449e-16
Identity = 35/90 (38.89%), Postives = 56/90 (62.22%), Query Frame = 1
Query:  118 SVESEEEFQDFIDGNGSKLVIVDFWAEWCGPCRLMSPAFDKFAKDSQFKDVIFLKVDVDELGELAEKYDISCMPTFIFFRNGEKIDEFSG 387
            +V+ +++F + +  N    V++DF A+WCGPC+++ P  +K A   Q   V   KVD+DE  +LA +Y +S +PT I  R G+ ID+F G
Sbjct:   62 NVQDQDDFTERVI-NSDLPVVIDFHAQWCGPCKILGPRLEK-AIAKQKGRVTMAKVDIDEHTDLAIEYGVSAVPTVIAMRGGDVIDQFVG 149          
BLAST of Thioredoxin vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009652.1 (pep scaffold:Pmarinus_7.0:GL478563:4231:10899:-1 gene:ENSPMAG00000008707.1 transcript:ENSPMAT00000009652.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 88.9669 bits (219), Expect = 1.399e-23
Identity = 47/97 (48.45%), Postives = 69/97 (71.13%), Query Frame = 1
Query:  130 EEEFQDFIDGNGSKLVIVDFWAEWCGPCRLMSPAFDKFAKDSQFKDVIFLKVDVDELGELAEKYDISCMPTFIFFRNGEKIDEFSGANKDKLLEMLK 420
            +EE++  ++ N  KLV++DF A WCGPC+++SP F  FA  +++ +V+F  VDVD+  ++AE  +I  MPTFIFF+N EK+ E  GANKD L + LK
Sbjct:    8 QEEYKQVLEQNKHKLVVIDFSATWCGPCKIISPIFHAFA--NEYHNVVFCVVDVDDAPDIAELCNIKAMPTFIFFKNNEKVGEVMGANKDHLEKTLK 102          
BLAST of Thioredoxin vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007779.1 (pep scaffold:Pmarinus_7.0:GL477155:15795:22678:-1 gene:ENSPMAG00000007027.1 transcript:ENSPMAT00000007779.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 76.6406 bits (187), Expect = 7.923e-19
Identity = 32/100 (32.00%), Postives = 64/100 (64.00%), Query Frame = 1
Query:  127 SEEEFQDFIDGNGSKLVIVDFWAEWCGPCRLMSPAFDKFAKDSQFKDVIFLKVDVDELGELAEKYDISCMPTFIFFRNGEKIDEFSGANKDKLLEMLKSH 426
            S+ +F +     GS+L+I+ F A+WCGPC+ +   +   A+  ++ + +F +VDVDE  +L   + I+CMPTF+FF++G ++++  G ++  L + ++ +
Sbjct:    7 SQSDFDEIKGCAGSRLIILFFTAKWCGPCQQIKEPYHTMAEKEEY-NAVFCEVDVDEAADLLSSFGINCMPTFVFFKDGIQLEKLEGGSQGNLRKRIEKY 105          
BLAST of Thioredoxin vs. Ensembl Sea Lamprey
Match: txn2 (thioredoxin 2 [Source:ZFIN;Acc:ZDB-GENE-040426-1795])

HSP 1 Score: 77.7962 bits (190), Expect = 1.920e-18
Identity = 40/123 (32.52%), Postives = 65/123 (52.85%), Query Frame = 1
Query:   52 RFNRYFSTELFQRISLRIFMATSVESEEEFQDFIDG--NGSKLVIVDFWAEWCGPCRLMSPAFDKFAKDSQFKDVIFLKVDVDELGELAEKYDISCMPTFIFFRNGEKIDEFSGANKDKLLEM 414
            R  R F++   + IS  +         ++  DF +   N    V+VDF A+WCGPC+++ P  +K       K V+  KVD+D+  +LA +Y +S +PT +  RNG  +D+F G   +  LE+
Sbjct:   55 RSARGFTSTATRAISFHV---------QDVDDFTERVVNSDTPVVVDFHAQWCGPCKILGPRLEKLVAKQSGK-VLMAKVDIDDHTDLAVEYGVSAVPTVLAMRNGSVVDKFVGVRDEDQLEV 167          
BLAST of Thioredoxin vs. Ensembl Sea Lamprey
Match: glrx3 (glutaredoxin 3 [Source:NCBI gene;Acc:449777])

HSP 1 Score: 59.6918 bits (143), Expect = 3.366e-11
Identity = 25/81 (30.86%), Postives = 50/81 (61.73%), Query Frame = 1
Query:  178 IVDFWAEWCGPCRLMSPAFDKFAKDSQFKDVIFLKVDVDELGELAEKYDISCMPTFIFFRNGEKIDEFSGANKDKLLEMLK 420
            +V FWA W   C  M+   ++ A  ++   V F+K++ + + ELA K+++  +PTFIFF+ G+ ++   GA+  +L++ ++
Sbjct:   11 LVHFWATWAPQCAQMNDVMEELA--TEHPAVSFVKLEAEAVPELALKHNVKAVPTFIFFKAGQPVERLDGAHAPELVKKVQ 89          
BLAST of Thioredoxin vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006474.1 (pep scaffold:Pmarinus_7.0:GL478000:14574:47610:1 gene:ENSPMAG00000005827.1 transcript:ENSPMAT00000006474.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 58.9214 bits (141), Expect = 9.479e-11
Identity = 35/103 (33.98%), Postives = 59/103 (57.28%), Query Frame = 1
Query:  127 SEEEFQDFIDGNGSKLVIVDFWAEWCGPCRLMSPAFDKFAK----DSQFKDVIFLKVDVDELGELAEKYDISCMPTFIFFRNGEKIDEFSG-ANKDKLLEMLK 420
            ++E+FQDF+D + + LV+  F+A WCG C+ + P +D+ AK    + +    +   VD      LAE++ I   PT  FF++GE+    S   +KDK+L  ++
Sbjct:  284 TDEDFQDFVDKHPNVLVM--FYAPWCGHCKKLKPDYDEAAKILNNEEENSPGVLAAVDATIHRALAERFAIKGFPTMKFFQDGEEKYTVSDLRSKDKILSWIR 384          

HSP 2 Score: 44.669 bits (104), Expect = 5.157e-6
Identity = 28/105 (26.67%), Postives = 53/105 (50.48%), Query Frame = 1
Query:  118 SVESEEEFQDFIDGNGSKLVIVDFWAEWCGPCRLMSPAFDKFAKDSQFKDVIF-LKVDVDELGELAEKYDISCMPTFIFFRNGEKIDEFS--GANKDKLLEMLKS 423
             V S++EF+  +     + +++ F+A WCG C+ M P F + A  ++   V+  + V   E   +   Y+++  PTF +F  G+    +   GA    ++E LK+
Sbjct:  157 HVHSDKEFRLLLKKE-ERPILMMFYAPWCGVCKRMKPVFQEAATMAKKTYVLAGMNVHPAEFDGIKSDYNVTGYPTFCYFEKGKFRFNYQSYGAQAKDIVEWLKN 260          
BLAST of Thioredoxin vs. Ensembl Yeast
Match: TRX2 (Cytoplasmic thioredoxin isoenzyme; part of thioredoxin system which protects cells against oxidative and reductive stress; forms LMA1 complex with Pbi2p; acts as a cofactor for Tsa1p; required for ER-Golgi transport and vacuole inheritance; with Trx1p, facilitates mitochondrial import of small Tims Tim9p, Tim10p, Tim13p by maintaining them in reduced form; abundance increases under DNA replication stress; TRX2 has a paralog, TRX1, that arose from the whole genome duplication [Source:SGD;Acc:S000003441])

HSP 1 Score: 98.5969 bits (244), Expect = 1.559e-27
Identity = 42/106 (39.62%), Postives = 72/106 (67.92%), Query Frame = 1
Query:  109 MATSVESEEEFQDFIDGNGSKLVIVDFWAEWCGPCRLMSPAFDKFAKDSQFKDVIFLKVDVDELGELAEKYDISCMPTFIFFRNGEKIDEFSGANKDKLLEMLKSH 426
            M T ++S  E+   +  +G KLV+VDF+A WCGPC++++P  +KFA+  Q+ D  F K+DVDE+ ++A+K ++S MPT IF++ G+++    GAN   + + + S+
Sbjct:    1 MVTQLKSASEYDSAL-ASGDKLVVVDFFATWCGPCKMIAPMIEKFAE--QYSDAAFYKLDVDEVSDVAQKAEVSSMPTLIFYKGGKEVTRVVGANPAAIKQAIASN 103          
BLAST of Thioredoxin vs. Ensembl Yeast
Match: TRX1 (Cytoplasmic thioredoxin isoenzyme; part of thioredoxin system which protects cells against oxidative and reductive stress; forms LMA1 complex with Pbi2p; acts as a cofactor for Tsa1p; required for ER-Golgi transport and vacuole inheritance; with Trx2p, facilitates mitochondrial import of small Tims Tim9p, Tim10p, Tim13p by maintaining them in reduced form; abundance increases iunder DNA replication stress; TRX1 has a paralog, TRX2, that arose from the whole genome duplication [Source:SGD;Acc:S000004033])

HSP 1 Score: 92.8189 bits (229), Expect = 2.827e-25
Identity = 41/107 (38.32%), Postives = 71/107 (66.36%), Query Frame = 1
Query:  109 MATSVESEEEFQDFIDGNGSKLVIVDFWAEWCGPCRLMSPAFDKFAKDSQFKDVIFLKVDVDELGELAEKYDISCMPTFIFFRNGEKIDEFSGANKDKLLEMLKSHC 429
            M T  ++  EF   I  +  KLV+VDF+A WCGPC++++P  +KF++  Q+    F K+DVDELG++A+K ++S MPT + F+NG+++ +  GAN   + + + ++ 
Sbjct:    1 MVTQFKTASEFDSAIAQD--KLVVVDFYATWCGPCKMIAPMIEKFSE--QYPQADFYKLDVDELGDVAQKNEVSAMPTLLLFKNGKEVAKVVGANPAAIKQAIAANA 103          
BLAST of Thioredoxin vs. Ensembl Yeast
Match: TRX3 (Mitochondrial thioredoxin; highly conserved oxidoreductase required to maintain the redox homeostasis of the cell, forms the mitochondrial thioredoxin system with Trr2p, redox state is maintained by both Trr2p and Glr1p [Source:SGD;Acc:S000000679])

HSP 1 Score: 78.1814 bits (191), Expect = 2.180e-19
Identity = 39/97 (40.21%), Postives = 61/97 (62.89%), Query Frame = 1
Query:  115 TSVESEEEFQDFIDGNGSKLVIVDFWAEWCGPCRLMSPAFDKFAKDSQFKDVIFLKVDVDELGELAEKYDISCMPTFIFFRNGEKIDEFSGANKDKL 405
            T + +  EF++ I  N  KLVI DF+A WCGPC++M P   K  +   + DV F+K DVDE  ++A++ +++ MPTF+  ++G+ I +  GAN   L
Sbjct:   28 TKLTNLTEFRNLIKQN-DKLVI-DFYATWCGPCKMMQPHLTKLIQ--AYPDVRFVKCDVDESPDIAKECEVTAMPTFVLGKDGQLIGKIIGANPTAL 120          
BLAST of Thioredoxin vs. Ensembl Yeast
Match: GRX4 (Glutathione-dependent oxidoreductase; hydroperoxide and superoxide-radical responsive; monothiol glutaredoxin subfamily member along with Grx3p and Grx5p; protects cells from oxidative damage; with Grx3p, binds to Aft1p in iron-replete conditions, promoting its dissociation from promoters; mutant has increased aneuploidy tolerance; transcription regulated by Yap5p; GRX4 has a paralog, GRX3, that arose from the whole genome duplication [Source:SGD;Acc:S000000976])

HSP 1 Score: 69.3218 bits (168), Expect = 5.294e-15
Identity = 30/101 (29.70%), Postives = 62/101 (61.39%), Query Frame = 1
Query:  121 VESEEEFQDFIDGNGS-KLVIVDFWAEWCGPCRLMSPAFDKFAKDSQFKDVIFLKVDVDELGELAEKYDISCMPTFIFFRNGEKIDEFSGANKDKLLEMLK 420
            ++S+++F      N + KL+++ F A+W  PC+ MS   +  ++  + +DV FL +D DE  E+++ ++I+ +P F+F +NG  + E S A+  + ++ L+
Sbjct:    6 IKSQDQFTQLTTTNAANKLIVLYFKAQWADPCKTMSQVLEAVSEKVRQEDVRFLSIDADEHPEISDLFEIAAVPYFVFIQNGTIVKEISAADPKEFVKSLE 106          
BLAST of Thioredoxin vs. Ensembl Yeast
Match: GRX3 (Glutathione-dependent oxidoreductase; hydroperoxide and superoxide-radical responsive; monothiol glutaredoxin subfamily member along with Grx4p and Grx5p; protects cells from oxidative damage; with Grx4p, binds to Aft1p in iron-replete conditions, promoting its dissociation from promoters; evidence exists indicating that the translation start site is not Met1 as currently annotated, but rather Met36; GRX3 has a paralog, GRX4, that arose from the whole genome duplication [Source:SGD;Acc:S000002505])

HSP 1 Score: 64.6994 bits (156), Expect = 2.626e-13
Identity = 29/91 (31.87%), Postives = 50/91 (54.95%), Query Frame = 1
Query:  163 GSKLVIVDFWAEWCGPCRLMSPAFDKFAKDSQFKDVIFLKVDVDELGELAEKYDISCMPTFIFFRNGEKIDEFSGANKDKLLEMLKSHCKK 435
            G KL+++ F   W  PC+ +   F+  + +    +V FL +D DE  E++E ++IS +P FI    G  + E SGA+  + + +L+  CK 
Sbjct:   21 GDKLIVLYFHTSWAEPCKALKQVFEAISNEPSNSNVSFLSIDADENSEISELFEISAVPYFIIIHKGTILKELSGADPKEYVSLLED-CKN 110          
BLAST of Thioredoxin vs. Ensembl Nematostella
Match: EDO45413 (Thioredoxin [Source:UniProtKB/TrEMBL;Acc:A7RT76])

HSP 1 Score: 98.5969 bits (244), Expect = 5.587e-27
Identity = 50/99 (50.51%), Postives = 71/99 (71.72%), Query Frame = 1
Query:  121 VESEEEFQDFIDGNGSKLVIVDFWAEWCGPCRLMSPAFDKFAKDSQFKDVIFLKVDVDELGELAEKYDISCMPTFIFFRNGEKIDEFSGANKDKLLEML 417
            +E   EF   I+    KLV++DF+AEWCGPCR + P F K A + +FKDV F K+DVDEL EL+E   I+ MPTF+F++NG+K+++  GAN+ KL E++
Sbjct:   15 IEERAEFNSVINNTKDKLVVIDFYAEWCGPCRQIKPKFKKMALE-EFKDVFFAKIDVDELEELSEDEQITAMPTFVFYKNGQKLEKLVGANEVKLRELI 112          
BLAST of Thioredoxin vs. Ensembl Nematostella
Match: EDO46139 (Thioredoxin [Source:UniProtKB/TrEMBL;Acc:A7RQN2])

HSP 1 Score: 89.7373 bits (221), Expect = 1.378e-23
Identity = 46/105 (43.81%), Postives = 65/105 (61.90%), Query Frame = 1
Query:  118 SVESEEEFQDFIDGNGSKLVIVDFWAEWCGPCRLMSPAFDKFAKDSQFKDVIFLKVDVDELGELAEKYDISCMPTFIFFRNGEKIDEFSGANKDKLLEMLKSHCK 432
             + ++ EF  F+  N  ++  +DF A WCGPCR++ P F++ AK  +FK V   KVDVD   E AE   I+ MPTF F++NGE +DE  GA++ KL E+   H K
Sbjct:    3 QLNTKGEFDKFLKDN--EVAAIDFTATWCGPCRMIGPKFEEMAK--EFKGVKCAKVDVDVNSETAESEGITAMPTFRFYKNGEMVDEVVGASESKLKELFAKHNK 103          
BLAST of Thioredoxin vs. Ensembl Nematostella
Match: EDO33372 (Thioredoxin [Source:UniProtKB/TrEMBL;Acc:A7SSF5])

HSP 1 Score: 87.0409 bits (214), Expect = 1.353e-22
Identity = 44/95 (46.32%), Postives = 58/95 (61.05%), Query Frame = 1
Query:  121 VESEEEFQDFIDGNGSKLVIVDFWAEWCGPCRLMSPAFDKFAKDSQFKDVIFLKVDVDELGELAEKYDISCMPTFIFFRNGEKIDEFSGANKDKL 405
            VE +  F   I+  GS+LV++DF A WCGPC+ ++P F   +   +F DV+FLKVDVD+    AE   I  MPTF F+ N  KIDE  GA+   L
Sbjct:   10 VEDDSFFSVEIERAGSRLVVIDFTATWCGPCKSIAPVFTNLSM--KFMDVVFLKVDVDQCQLTAESCGIRAMPTFHFYHNKAKIDELRGADPGAL 102          
BLAST of Thioredoxin vs. Ensembl Nematostella
Match: EDO41852 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S3A4])

HSP 1 Score: 87.8113 bits (216), Expect = 3.670e-21
Identity = 40/100 (40.00%), Postives = 63/100 (63.00%), Query Frame = 1
Query:  121 VESEEEFQDFIDGNGSKLVIVDFWAEWCGPCRLMSPAFDKFAKDSQFKDVIFLKVDVDELGELAEKYDISCMPTFIFFRNGEKIDEFSGANKDKLLEMLK 420
            +E + +F   +   G+KLV+ DF A WCGPC+ ++P +   ++  ++K  +FLK+DVD   ELA K  ++ MPTF FF+N  K+DE  GA+   L + +K
Sbjct:   12 LELDSQFTAELTNAGTKLVVADFTASWCGPCKSIAPVYSGLSE--KYKQAVFLKIDVDVCQELAAKQGVTAMPTFQFFKNKVKVDEVRGADPKALEDAIK 109          
BLAST of Thioredoxin vs. Ensembl Nematostella
Match: EDO49987 (Thioredoxin [Source:UniProtKB/TrEMBL;Acc:A7REX0])

HSP 1 Score: 65.0846 bits (157), Expect = 4.455e-14
Identity = 31/89 (34.83%), Postives = 52/89 (58.43%), Query Frame = 1
Query:  121 VESEEEFQDFIDGNGSKLVIVDFWAEWCGPCRLMSPAFDKFAKDSQFKDVIFLKVDVDELGELAEKYDISCMPTFIFFRNGEKIDEFSG 387
            ++ EE+F   +    +K  +VDF A WC PC++++P  D    +   K V   KVD+D +GELA  + ++ +PT I  + G+ I++F G
Sbjct:    3 IKDEEDFNKRV-LQATKPTVVDFHANWCNPCKVLTPRLDAIIAEQDGK-VDLAKVDIDVMGELAFNFGVNAVPTVIGMKGGKVINKFEG 89          
BLAST of Thioredoxin vs. Ensembl Medaka
Match: ENSORLT00000009496.2 (thioredoxin [Source:NCBI gene;Acc:101173415])

HSP 1 Score: 98.9821 bits (245), Expect = 8.298e-27
Identity = 48/105 (45.71%), Postives = 70/105 (66.67%), Query Frame = 1
Query:  109 MATSVESEEEFQDFIDGNGSKLVIVDFWAEWCGPCRLMSPAFDKFAKDSQFKDVIFLKVDVDELGELAEKYDISCMPTFIFFRNGEKIDEFSGANKDKLLEMLKS 423
            M   V    EF+  ++  G KLV+VDF A WCGPC+ ++P + + ++    K+V+FLKVDVDE  +++   +I CMPTF F++ G+K+DEFSGAN   L E LK+
Sbjct:    1 MVREVADLAEFKKILEDAGDKLVVVDFTASWCGPCKQIAPLYKQMSESDDNKNVVFLKVDVDE-ADVSVFCEIKCMPTFHFYKGGKKVDEFSGANVATLEEKLKA 104          
BLAST of Thioredoxin vs. Ensembl Medaka
Match: txnl1 (thioredoxin like 1 [Source:NCBI gene;Acc:101158293])

HSP 1 Score: 80.4925 bits (197), Expect = 3.462e-18
Identity = 39/102 (38.24%), Postives = 61/102 (59.80%), Query Frame = 1
Query:  121 VESEEEFQDFIDGNGSKLVIVDFWAEWCGPCRLMSPAFDKFAKDSQFKDVIFLKVDVDELGELAEKYDISCMPTFIFFRNGEKIDEFSGANKDKLLEMLKSH 426
            + S+ +FQ  +   GS+LV+V F    C PC  +SPAF+  +  +++  V+FL+VDV      A   +IS  PTF+FFRN  ++D++ GA+   L E +K H
Sbjct:    7 IGSDPDFQPELAAAGSRLVVVKFTMAGCRPCVRISPAFNALS--NKYPHVVFLEVDVHVCQATAAANNISATPTFLFFRNRVRVDQYQGADAAGLEEKIKQH 106          
BLAST of Thioredoxin vs. Ensembl Medaka
Match: txnl1 (thioredoxin like 1 [Source:NCBI gene;Acc:101158293])

HSP 1 Score: 80.4925 bits (197), Expect = 5.140e-18
Identity = 39/102 (38.24%), Postives = 61/102 (59.80%), Query Frame = 1
Query:  121 VESEEEFQDFIDGNGSKLVIVDFWAEWCGPCRLMSPAFDKFAKDSQFKDVIFLKVDVDELGELAEKYDISCMPTFIFFRNGEKIDEFSGANKDKLLEMLKSH 426
            + S+ +FQ  +   GS+LV+V F    C PC  +SPAF+  +  +++  V+FL+VDV      A   +IS  PTF+FFRN  ++D++ GA+   L E +K H
Sbjct:    7 IGSDPDFQPELAAAGSRLVVVKFTMAGCRPCVRISPAFNALS--NKYPHVVFLEVDVHVCQATAAANNISATPTFLFFRNRVRVDQYQGADAAGLEEKIKQH 106          
BLAST of Thioredoxin vs. Ensembl Medaka
Match: txn2 (thioredoxin 2 [Source:NCBI gene;Acc:101164313])

HSP 1 Score: 74.3294 bits (181), Expect = 1.604e-16
Identity = 37/94 (39.36%), Postives = 55/94 (58.51%), Query Frame = 1
Query:  118 SVESEEEFQDFIDGNGSKLVIVDFWAEWCGPCRLMSPAFDKFAKDSQFKDVIFLKVDVDELGELAEKYDISCMPTFIFFRNGEKIDEFSGANKD 399
            +V+  E+F + +  N    V+VDF A+WCGPC+++ P  +K A   Q   V   KVD+DE  +LA +Y +S +PT I  R G+ +D F G   D
Sbjct:   68 NVQDTEDFTERV-VNSQLPVLVDFHAQWCGPCKILGPRLEK-AVAKQKGRVAMAKVDIDEHTDLAIEYGVSAVPTVIAMRGGDVVDHFVGIKDD 159          
BLAST of Thioredoxin vs. Ensembl Medaka
Match: txn2 (thioredoxin 2 [Source:NCBI gene;Acc:101164313])

HSP 1 Score: 73.9442 bits (180), Expect = 1.915e-16
Identity = 37/94 (39.36%), Postives = 55/94 (58.51%), Query Frame = 1
Query:  118 SVESEEEFQDFIDGNGSKLVIVDFWAEWCGPCRLMSPAFDKFAKDSQFKDVIFLKVDVDELGELAEKYDISCMPTFIFFRNGEKIDEFSGANKD 399
            +V+  E+F + +  N    V+VDF A+WCGPC+++ P  +K A   Q   V   KVD+DE  +LA +Y +S +PT I  R G+ +D F G   D
Sbjct:   72 NVQDTEDFTERV-VNSQLPVLVDFHAQWCGPCKILGPRLEK-AVAKQKGRVAMAKVDIDEHTDLAIEYGVSAVPTVIAMRGGDVVDHFVGIKDD 163          
BLAST of Thioredoxin vs. Planmine SMEST
Match: SMESG000039109.1 (SMESG000039109.1)

HSP 1 Score: 222.631 bits (566), Expect = 1.907e-75
Identity = 109/109 (100.00%), Postives = 109/109 (100.00%), Query Frame = 1
Query:  109 MATSVESEEEFQDFIDGNGSKLVIVDFWAEWCGPCRLMSPAFDKFAKDSQFKDVIFLKVDVDELGELAEKYDISCMPTFIFFRNGEKIDEFSGANKDKLLEMLKSHCKK 435
            MATSVESEEEFQDFIDGNGSKLVIVDFWAEWCGPCRLMSPAFDKFAKDSQFKDVIFLKVDVDELGELAEKYDISCMPTFIFFRNGEKIDEFSGANKDKLLEMLKSHCKK
Sbjct:    1 MATSVESEEEFQDFIDGNGSKLVIVDFWAEWCGPCRLMSPAFDKFAKDSQFKDVIFLKVDVDELGELAEKYDISCMPTFIFFRNGEKIDEFSGANKDKLLEMLKSHCKK 109          
BLAST of Thioredoxin vs. Planmine SMEST
Match: SMESG000033877.1 (SMESG000033877.1)

HSP 1 Score: 90.5077 bits (223), Expect = 9.014e-22
Identity = 42/106 (39.62%), Postives = 68/106 (64.15%), Query Frame = 1
Query:  115 TSVESEEEFQDFI-DGNGSKLVIVDFWAEWCGPCRLMSPAFDKFAKDSQFKDVIFLKVDVDELGELAEKYDISCMPTFIFFRNGEKIDEFSGANKDKLLEMLKSHC 429
            + V+ E+E Q+     + +KLV++DF+A WCGPC+ ++P   + +   +F +V FLKVDV++   +AE+Y+++ MPTFIF +N  K+DE  GAN   L   +  H 
Sbjct:    9 SEVQFEQEIQETSKQASVNKLVVIDFYATWCGPCKNIAPFVHRLS--VKFPNVTFLKVDVEKFPVIAERYNVNAMPTFIFLKNKIKMDELKGANASVLEAKVTEHA 112          
BLAST of Thioredoxin vs. Planmine SMEST
Match: SMESG000033877.1 (SMESG000033877.1)

HSP 1 Score: 89.7373 bits (221), Expect = 1.331e-21
Identity = 42/105 (40.00%), Postives = 68/105 (64.76%), Query Frame = 1
Query:  115 TSVESEEEFQDFI-DGNGSKLVIVDFWAEWCGPCRLMSPAFDKFAKDSQFKDVIFLKVDVDELGELAEKYDISCMPTFIFFRNGEKIDEFSGANKDKLLEMLKSH 426
            + V+ E+E Q+     + +KLV++DF+A WCGPC+ ++P   + +   +F +V FLKVDV++   +AE+Y+++ MPTFIF +N  K+DE  GAN   L   +  H
Sbjct:    9 SEVQFEQEIQETSKQASVNKLVVIDFYATWCGPCKNIAPFVHRLS--VKFPNVTFLKVDVEKFPVIAERYNVNAMPTFIFLKNKIKMDELKGANASVLEAKVTEH 111          
BLAST of Thioredoxin vs. Planmine SMEST
Match: SMESG000023196.1 (SMESG000023196.1)

HSP 1 Score: 76.6406 bits (187), Expect = 4.660e-18
Identity = 35/95 (36.84%), Postives = 58/95 (61.05%), Query Frame = 1
Query:  121 VESEEEFQDFIDGNGSKLVIVDFWAEWCGPCRLMSPAFDKFAKDSQFKDVIFLKVDVDELGELAEKYDISCMPTFIFFRNGEKIDEFSGANKDKL 405
            + S  +F   ID NG   +I DF A WCGPC  ++P ++  ++   +  + FLK+DVD   ++A  Y+I+ +PTF+FF +G +I    GA+ ++L
Sbjct:    6 ISSMNDFVRRIDQNGK--IIADFSASWCGPCNNIAPIYEDLSE--TYDKISFLKIDVDSQSDIATLYNITSLPTFVFFNHGAQIHMIIGADVNQL 96          
BLAST of Thioredoxin vs. Planmine SMEST
Match: SMESG000023196.1 (SMESG000023196.1)

HSP 1 Score: 76.2554 bits (186), Expect = 4.849e-18
Identity = 35/95 (36.84%), Postives = 58/95 (61.05%), Query Frame = 1
Query:  121 VESEEEFQDFIDGNGSKLVIVDFWAEWCGPCRLMSPAFDKFAKDSQFKDVIFLKVDVDELGELAEKYDISCMPTFIFFRNGEKIDEFSGANKDKL 405
            + S  +F   ID NG   +I DF A WCGPC  ++P ++  ++   +  + FLK+DVD   ++A  Y+I+ +PTF+FF +G +I    GA+ ++L
Sbjct:    6 ISSMNDFVRRIDQNGK--IIADFSASWCGPCNNIAPIYEDLSE--TYDKISFLKIDVDSQSDIATLYNITSLPTFVFFNHGAQIHMIIGADVNQL 96          
The following BLAST results are available for this feature:
BLAST of Thioredoxin vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
TXN3.418e-3048.48thioredoxin [Source:HGNC Symbol;Acc:HGNC:12435][more]
TXN4.293e-2140.40thioredoxin [Source:HGNC Symbol;Acc:HGNC:12435][more]
TXN24.668e-1937.04thioredoxin 2 [Source:HGNC Symbol;Acc:HGNC:17772][more]
TXN24.668e-1937.04thioredoxin 2 [Source:HGNC Symbol;Acc:HGNC:17772][more]
TXNL14.787e-1939.22thioredoxin like 1 [Source:HGNC Symbol;Acc:HGNC:12... [more]
back to top
BLAST of Thioredoxin vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
trx-14.793e-2441.24Thioredoxin-1 [Source:UniProtKB/Swiss-Prot;Acc:Q0... [more]
trx-15.727e-2440.40Thioredoxin-1 [Source:UniProtKB/Swiss-Prot;Acc:Q0... [more]
png-13.473e-2338.10Peptide-N(4)-(N-acetyl-beta-glucosaminyl)asparagin... [more]
trx-41.599e-2038.68Thioredoxin [Source:UniProtKB/TrEMBL;Acc:Q9TXY8][more]
Y55F3AR.22.223e-2042.86pep chromosome:WBcel235:IV:1094545:1096723:1 gene:... [more]
back to top
BLAST of Thioredoxin vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Trx-23.325e-2642.06gene:FBgn0040070 transcript:FBtr0079840[more]
Trx-23.325e-2642.06gene:FBgn0040070 transcript:FBtr0079839[more]
dhd1.438e-2338.00gene:FBgn0011761 transcript:FBtr0070749[more]
dhd1.438e-2338.00gene:FBgn0011761 transcript:FBtr0345745[more]
TrxT4.586e-2342.53gene:FBgn0029752 transcript:FBtr0070755[more]
back to top
BLAST of Thioredoxin vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
TXN1.659e-3245.28zgc:56493 [Source:ZFIN;Acc:ZDB-GENE-030131-8581][more]
txn1.788e-3147.17thioredoxin [Source:ZFIN;Acc:ZDB-GENE-040718-162][more]
txn2.476e-3048.48thioredoxin [Source:ZFIN;Acc:ZDB-GENE-040718-162][more]
txnl19.168e-1836.27thioredoxin-like 1 [Source:ZFIN;Acc:ZDB-GENE-04042... [more]
txnl19.390e-1836.27thioredoxin-like 1 [Source:ZFIN;Acc:ZDB-GENE-04042... [more]
back to top
BLAST of Thioredoxin vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSXETT00000029198.18.340e-3348.08MGC80314 protein [Source:NCBI gene;Acc:100170420][more]
btg5.32.444e-2744.66B-cell translocation gene 5, gene 3 [Source:Xenbas... [more]
btg5.33.703e-2143.18B-cell translocation gene 5, gene 3 [Source:Xenbas... [more]
tnfsf13b7.918e-2032.41TNF superfamily member 13b [Source:Xenbase;Acc:XB-... [more]
glrx32.284e-1733.03glutaredoxin 3 [Source:NCBI gene;Acc:549963][more]
back to top
BLAST of Thioredoxin vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Txn11.667e-2846.46thioredoxin 1 [Source:MGI Symbol;Acc:MGI:98874][more]
Txndc29.501e-2045.56thioredoxin domain containing 2 (spermatozoa) [Sou... [more]
Txndc29.802e-2045.56thioredoxin domain containing 2 (spermatozoa) [Sou... [more]
Txndc82.145e-1938.14thioredoxin domain containing 8 [Source:MGI Symbol... [more]
Txnl13.508e-1939.22thioredoxin-like 1 [Source:MGI Symbol;Acc:MGI:1860... [more]
back to top
BLAST of Thioredoxin vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9DGI3|THIO_ICTPU2.209e-3145.28Thioredoxin OS=Ictalurus punctatus OX=7998 GN=txn ... [more]
sp|O97508|THIO_HORSE4.332e-3046.15Thioredoxin OS=Equus caballus OX=9796 GN=TXN PE=3 ... [more]
sp|P10599|THIO_HUMAN1.642e-2948.48Thioredoxin OS=Homo sapiens OX=9606 GN=TXN PE=1 SV... [more]
sp|P08628|THIO_RABIT2.946e-2947.47Thioredoxin OS=Oryctolagus cuniculus OX=9986 GN=TX... [more]
sp|P29451|THIO_MACMU8.790e-2947.47Thioredoxin OS=Macaca mulatta OX=9544 GN=TXN PE=3 ... [more]
back to top
BLAST of Thioredoxin vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
R7T9C05.199e-3958.82Thioredoxin OS=Capitella teleta OX=283909 GN=CAPTE... [more]
A0A3B3XC823.063e-3455.24Thioredoxin OS=Poecilia mexicana OX=48701 PE=3 SV=... [more]
A0A074ZG273.568e-3250.94Thioredoxin OS=Opisthorchis viverrini OX=6198 GN=T... [more]
A0A087XNX96.568e-3252.38Thioredoxin OS=Poecilia formosa OX=48698 PE=3 SV=2[more]
A0A3Q2Y6G04.135e-3148.08Thioredoxin OS=Hippocampus comes OX=109280 PE=3 SV... [more]
back to top
BLAST of Thioredoxin vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
txn4.140e-3449.02thioredoxin-like [Source:NCBI gene;Acc:103039731][more]
zgc:564939.599e-2943.40thioredoxin-like [Source:NCBI gene;Acc:103040975][more]
txnl14.351e-1736.27thioredoxin like 1 [Source:NCBI gene;Acc:103021638... [more]
txnl14.832e-1736.27thioredoxin like 1 [Source:NCBI gene;Acc:103021638... [more]
txn27.449e-1638.89thioredoxin 2 [Source:NCBI gene;Acc:103028978][more]
back to top
BLAST of Thioredoxin vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000009652.11.399e-2348.45pep scaffold:Pmarinus_7.0:GL478563:4231:10899:-1 g... [more]
ENSPMAT00000007779.17.923e-1932.00pep scaffold:Pmarinus_7.0:GL477155:15795:22678:-1 ... [more]
txn21.920e-1832.52thioredoxin 2 [Source:ZFIN;Acc:ZDB-GENE-040426-179... [more]
glrx33.366e-1130.86glutaredoxin 3 [Source:NCBI gene;Acc:449777][more]
ENSPMAT00000006474.19.479e-1133.98pep scaffold:Pmarinus_7.0:GL478000:14574:47610:1 g... [more]
back to top
BLAST of Thioredoxin vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
TRX21.559e-2739.62Cytoplasmic thioredoxin isoenzyme; part of thiored... [more]
TRX12.827e-2538.32Cytoplasmic thioredoxin isoenzyme; part of thiored... [more]
TRX32.180e-1940.21Mitochondrial thioredoxin; highly conserved oxidor... [more]
GRX45.294e-1529.70Glutathione-dependent oxidoreductase; hydroperoxid... [more]
GRX32.626e-1331.87Glutathione-dependent oxidoreductase; hydroperoxid... [more]
back to top
BLAST of Thioredoxin vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO454135.587e-2750.51Thioredoxin [Source:UniProtKB/TrEMBL;Acc:A7RT76][more]
EDO461391.378e-2343.81Thioredoxin [Source:UniProtKB/TrEMBL;Acc:A7RQN2][more]
EDO333721.353e-2246.32Thioredoxin [Source:UniProtKB/TrEMBL;Acc:A7SSF5][more]
EDO418523.670e-2140.00Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO499874.455e-1434.83Thioredoxin [Source:UniProtKB/TrEMBL;Acc:A7REX0][more]
back to top
BLAST of Thioredoxin vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000009496.28.298e-2745.71thioredoxin [Source:NCBI gene;Acc:101173415][more]
txnl13.462e-1838.24thioredoxin like 1 [Source:NCBI gene;Acc:101158293... [more]
txnl15.140e-1838.24thioredoxin like 1 [Source:NCBI gene;Acc:101158293... [more]
txn21.604e-1639.36thioredoxin 2 [Source:NCBI gene;Acc:101164313][more]
txn21.915e-1639.36thioredoxin 2 [Source:NCBI gene;Acc:101164313][more]
back to top
BLAST of Thioredoxin vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000039109.11.907e-75100.00SMESG000039109.1[more]
SMESG000033877.19.014e-2239.62SMESG000033877.1[more]
SMESG000033877.11.331e-2140.00SMESG000033877.1[more]
SMESG000023196.14.660e-1836.84SMESG000023196.1[more]
SMESG000023196.14.849e-1836.84SMESG000023196.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30000004 ID=SMED30000004|Name=Thioredoxin|organism=Schmidtea mediterranea sexual|type=transcript|length=594bp
GCAAAGAAAATTCCCCTTTTTAATTGCAGCCTATAAAATAAAATTAGATC
GCGATTTAATAGATATTTTTCCACAGAACTCTTTCAAAGAATTTCTCTCA
GAATATTCATGGCTACAAGTGTTGAAAGTGAAGAAGAATTTCAAGATTTT
ATTGATGGAAATGGCTCTAAATTAGTTATAGTGGACTTTTGGGCTGAATG
GTGTGGCCCGTGTCGACTGATGTCACCTGCATTTGATAAATTTGCTAAAG
ACAGTCAATTTAAAGATGTTATTTTCTTAAAAGTAGATGTCGACGAGTTA
GGAGAATTGGCAGAAAAATACGACATAAGCTGCATGCCGACATTCATTTT
CTTTCGCAATGGAGAAAAAATTGATGAATTTTCCGGAGCAAACAAAGATA
AACTTTTGGAAATGTTGAAATCTCATTGTAAAAAATAACAAGCAAAAGGA
AGAATTTACCAGAAATGTCAGTTGACAGCATAGCTTTAGAACATTACATA
TCTTTTATTTTTGCTTGTAGTAAAATGCTATTTTGAAATAATTATATAGT
TTATTATACCTTTATGTTATAATTTATGCTCTGTGATCAGTTAT
back to top

protein sequence of SMED30000004-orf-1

>SMED30000004-orf-1 ID=SMED30000004-orf-1|Name=SMED30000004-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=110bp
MATSVESEEEFQDFIDGNGSKLVIVDFWAEWCGPCRLMSPAFDKFAKDSQ
FKDVIFLKVDVDELGELAEKYDISCMPTFIFFRNGEKIDEFSGANKDKLL
EMLKSHCKK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000499cell
PLANA:0000099neuron
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR036249Thioredoxin-like_sf
IPR005746Thioredoxin
IPR017937Thioredoxin_CS
IPR012336Thioredoxin-like_fold
IPR013766Thioredoxin_domain
Vocabulary: biological process
TermDefinition
GO:0006662glycerol ether metabolic process
GO:0055114oxidation-reduction process
GO:0045454cell redox homeostasis
Vocabulary: molecular function
TermDefinition
GO:0015035protein disulfide oxidoreductase activity
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availablePRINTSPR00421THIOREDOXINcoord: 72..83
score: 35.37
coord: 31..40
score: 57.5
coord: 23..31
score: 57.28
NoneNo IPR availablePANTHERPTHR46115FAMILY NOT NAMEDcoord: 2..107
NoneNo IPR availablePANTHERPTHR46115:SF1THIOREDOXIN-LIKE PROTEIN 1coord: 2..107
NoneNo IPR availableCDDcd02947TRX_familycoord: 9..104
e-value: 1.61423E-38
score: 122.282
IPR013766Thioredoxin domainPFAMPF00085Thioredoxincoord: 5..104
e-value: 1.9E-29
score: 101.7
IPR013766Thioredoxin domainPROSITEPS51352THIOREDOXIN_2coord: 1..108
score: 14.898
IPR036249Thioredoxin-like superfamilyGENE3DG3DSA:3.40.30.10coord: 1..109
e-value: 1.0E-37
score: 130.7
IPR036249Thioredoxin-like superfamilySUPERFAMILYSSF52833Thioredoxin-likecoord: 5..108
IPR005746ThioredoxinPIRSFPIRSF000077Thioredoxincoord: 1..107
e-value: 1.8E-30
score: 102.7
IPR005746ThioredoxinTIGRFAMTIGR01068TIGR01068coord: 8..105
e-value: 3.2E-30
score: 102.3
IPR017937Thioredoxin, conserved sitePROSITEPS00194THIOREDOXIN_1coord: 24..42