non-gastric H ,K -ATPase alpha subunit

Overview
Namenon-gastric H ,K -ATPase alpha subunit (AGF90974.1)
Smed IDSMED30024527
Length (bp)3362
Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of non-gastric H ,K -ATPase alpha subunit (SMED30024527) t-SNE clustered cells

Violin plots show distribution of expression levels for non-gastric H ,K -ATPase alpha subunit (SMED30024527) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of non-gastric H ,K -ATPase alpha subunit (SMED30024527) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for non-gastric H ,K -ATPase alpha subunit (SMED30024527) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Anatomical Expression

PAGE et. al., 2020




SMED30024527

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 20

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
lateral region of the whole animalSMED30024527SMESG000041938.1 SMESG000041937.1 JX174182smed_ncbi_20200123PMID:23250205
Beane et al., 2013
whole organism asexual adult colorimetric in situ hybridization evidence
pharynxSMED30024527SMESG000041938.1 SMESG000041937.1 SMESG000051989.1 dd_Smed_v4_1179_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30024527SMESG000041938.1 SMESG000041937.1 SMESG000051989.1 dd_Smed_v4_1179_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30024527SMESG000041938.1 SMESG000041937.1 SMESG000051989.1 dd_Smed_v4_1179_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30024527SMESG000041938.1 SMESG000041937.1 SMESG000051989.1 dd_Smed_v4_1179_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30024527SMESG000041938.1 SMESG000041937.1 SMESG000051989.1 dd_Smed_v4_1179_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30024527SMESG000041938.1 SMESG000041937.1 SMESG000051989.1 dd_Smed_v4_1179_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30024527SMESG000041938.1 SMESG000041937.1 SMESG000051989.1 dd_Smed_v4_1179_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30024527SMESG000041938.1 SMESG000041937.1 SMESG000051989.1 dd_Smed_v4_1179_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30024527SMESG000041938.1 SMESG000041937.1 SMESG000051989.1 dd_Smed_v4_1179_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30024527SMESG000041938.1 SMESG000041937.1 SMESG000051989.1 dd_Smed_v4_1179_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30024527SMESG000041938.1 SMESG000041937.1 Contig39475uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30024527SMESG000041938.1 SMESG000041937.1 Contig39475newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30024527SMESG000041938.1 SMESG000041937.1 Contig33764uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30024527SMESG000041938.1 SMESG000041937.1 Contig33764newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30024527SMESG000041938.1 SMESG000041937.1 Contig46106uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30024527SMESG000041938.1 SMESG000041937.1 Contig46106newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
pigment cellSMED30024527SMESG000041938.1 SMESG000041937.1 SMESG000051989.1 dd_Smed_v6_1179_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30024527SMESG000041938.1 SMESG000041937.1 SMESG000051989.1 dd_Smed_v6_1179_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30024527SMESG000041938.1 SMESG000041937.1 SMESG000051989.1 dd_Smed_v4_1179_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of non-gastric H ,K -ATPase alpha subunit vs. Ensembl Human
Match: ATP1A2 (ATPase Na+/K+ transporting subunit alpha 2 [Source:HGNC Symbol;Acc:HGNC:800])

HSP 1 Score: 1483.39 bits (3839), Expect = 0.000e+0
Identity = 731/986 (74.14%), Postives = 844/986 (85.60%), Query Frame = 1
Query:  181 ELDIDSHKISIKDLYIRLQTDPEKGLSIEEAKIRLARDGPNALTPPKTTPEWVKFCRQLFGGFSLLLWIGAALCFLAYAILSGAYEDPPKDNLYLGIVLTAVVVITGCFSYYQEAKSSKIMESFGKMVPQKANVIRDGKILEIAAENLVTGDIIDVKFGDRVPADIRVIQASSFKVDNSALTGESEAQVRSSEFTNDNPLETKNIAFFSTNAVEGTCKGVVISTGDNTVMGRIANLASGLEMGMTPIAKEINHFIHIITGVAVFLGVSFFVIAFILGYFWLDAVIFLIGIIVANVPEGXXXXXXXXXXXXXKKMAKKNCLVKNLEAVETLGSTSTICSDKTGTLTQNRMTVAHMWFDNKIQESDTSENQITSSTKQESETWKMLARVAMLCNRAQFKSGEEEKPVLKRECTGDASESALLKCVELSIGGVTKYRGENKKIVEIPFNSTNKYQVSIHETSDGNQGYLLAMKGAPERILERCSTILIDGKEMEMDDHWRQEFNNAYLELGGMGERVLGFCDYRLDENNFPRGFDFNPDEVNFPLDGLRFVGLMSMIXXXXXXXXXXXXKCRSAGIKVIMVTGDHPITAKAIAKGVGIISEGNKTVDDIAAERGISPSEVNPRDARACVIHGSDLRDMSSEQLDEVLKHHDEIVFARTSPQQKLIIVEGCQRQGAIVAVTGDGVNDSPALKKADIGVAMGIAGSDVSKQAADMILLDDNFASIVTGVEEGRIIFDNLKKSIAYTLTSNIPEITPFLVFILADVPLPLGTITILCIDLGTDMVPAISLAYEEAESDIMKRKPRDPKHDKLVNERLISMAYGQIGMIQASGGFFVYFVIMAEQGFWPSRLLGLRKEWDSAAVNDLADSYGQEWTFDQRKKLEYTCHTAFFVSIVIVQWTDLMICKTRRNSIFQQGMWNHQMTFGLFFETTLAAFLTYCPGLDVALKMQPLRFTWWLPAIPFSASIFIYDEIRKFLLRKWKNGSWLENETYY 3138
            E+ +D HK+S+ +L  + Q D  KGL+ + A+  LARDGPNALTPP TTPEWVKFCRQLFGGFS+LLWIGA LCFLAY I +   ++P  DNLYLG+VL AVV++TGCFSYYQEAKSSKIM+SF  MVPQ+A VIR+G+ ++I AE +V GD+++VK GDRVPAD+R+I +   KVDNS+LTGESE Q RS EFT++NPLET+NI FFSTN VEGT +G+VI+TGD TVMGRIA LASGLE+G TPIA EI HFI +ITGVAVFLGVSFFV++ ILGY WL+AVIFLIGIIVANVPEGLLATVTVCLTLTAK+MA+KNCLVKNLEAVETLGSTSTICSDKTGTLTQNRMTVAHMWFDN+I E+DT+E+Q  ++  + S TW  L+R+A LCNRA FK+G+E   V KR+  GDASESALLKC+ELS G V K R  N K+ EIPFNSTNKYQ+SIHE  D  Q ++L MKGAPERIL+RCSTIL+ GKE+ +D   +  F NAY+ELGG+GERVLGFC   L    FPRGF F+ DE+NFP + L FVGLMSMIDPPRAAVPDAV KCRSAGIKVIMVTGDHPITAKAIAKGVGIISEGN+TV+DIAA   I  S+VNPR+A+ACV+HGSDL+DM+SEQLDE+LK+H EIVFARTSPQQKLIIVEGCQRQGAIVAVTGDGVNDSPALKKADIG+AMGI+GSDVSKQAADMILLDDNFASIVTGVEEGR+IFDNLKKSIAYTLTSNIPEITPFL+FI+A++PLPLGT+TILCIDLGTDMVPAISLAYE AESDIMKR+PR+ + DKLVNERLISMAYGQIGMIQA GGFF YFVI+AE GF PSRLLG+R +WD   +NDL DSYGQEWT++QRK +E+TCHTAFF SIV+VQW DL+ICKTRRNS+FQQGM N  + FGL  ET LAAFL+YCPG+ VAL+M PL+ TWW  A P+S  IFIYDE+RK +LR++  G W+E ETYY
Sbjct:   36 EVAMDDHKLSLDELGRKYQVDLSKGLTNQRAQDVLARDGPNALTPPPTTPEWVKFCRQLFGGFSILLWIGAILCFLAYGIQAAMEDEPSNDNLYLGVVLAAVVIVTGCFSYYQEAKSSKIMDSFKNMVPQQALVIREGEKMQINAEEVVVGDLVEVKGGDRVPADLRIISSHGCKVDNSSLTGESEPQTRSPEFTHENPLETRNICFFSTNCVEGTARGIVIATGDRTVMGRIATLASGLEVGRTPIAMEIEHFIQLITGVAVFLGVSFFVLSLILGYSWLEAVIFLIGIIVANVPEGLLATVTVCLTLTAKRMARKNCLVKNLEAVETLGSTSTICSDKTGTLTQNRMTVAHMWFDNQIHEADTTEDQSGATFDKRSPTWTALSRIAGLCNRAVFKAGQENISVSKRDTAGDASESALLKCIELSCGSVRKMRDRNPKVAEIPFNSTNKYQLSIHEREDSPQSHVLVMKGAPERILDRCSTILVQGKEIPLDKEMQDAFQNAYMELGGLGERVLGFCQLNLPSGKFPRGFKFDTDELNFPTEKLCFVGLMSMIDPPRAAVPDAVGKCRSAGIKVIMVTGDHPITAKAIAKGVGIISEGNETVEDIAARLNIPMSQVNPREAKACVVHGSDLKDMTSEQLDEILKNHTEIVFARTSPQQKLIIVEGCQRQGAIVAVTGDGVNDSPALKKADIGIAMGISGSDVSKQAADMILLDDNFASIVTGVEEGRLIFDNLKKSIAYTLTSNIPEITPFLLFIIANIPLPLGTVTILCIDLGTDMVPAISLAYEAAESDIMKRQPRNSQTDKLVNERLISMAYGQIGMIQALGGFFTYFVILAENGFLPSRLLGIRLDWDDRTMNDLEDSYGQEWTYEQRKVVEFTCHTAFFASIVVVQWADLIICKTRRNSVFQQGMKNKILIFGLLEETALAAFLSYCPGMGVALRMYPLKVTWWFCAFPYSLLIFIYDEVRKLILRRYPGG-WVEKETYY 1020          
BLAST of non-gastric H ,K -ATPase alpha subunit vs. Ensembl Human
Match: ATP1A3 (ATPase Na+/K+ transporting subunit alpha 3 [Source:HGNC Symbol;Acc:HGNC:801])

HSP 1 Score: 1481.85 bits (3835), Expect = 0.000e+0
Identity = 737/987 (74.67%), Postives = 846/987 (85.71%), Query Frame = 1
Query:  181 ELDIDSHKISIKDLYIRLQTDPEKGLSIEEAKIRLARDGPNALTPPKTTPEWVKFCRQLFGGFSLLLWIGAALCFLAYAILSGAYEDPPKDNLYLGIVLTAVVVITGCFSYYQEAKSSKIMESFGKMVPQKANVIRDGKILEIAAENLVTGDIIDVKFGDRVPADIRVIQASSFKVDNSALTGESEAQVRSSEFTNDNPLETKNIAFFSTNAVEGTCKGVVISTGDNTVMGRIANLASGLEMGMTPIAKEINHFIHIITGVAVFLGVSFFVIAFILGYFWLDAVIFLIGIIVANVPEGXXXXXXXXXXXXXKKMAKKNCLVKNLEAVETLGSTSTICSDKTGTLTQNRMTVAHMWFDNKIQESDTSENQITSSTKQESETWKMLARVAMLCNRAQFKSGEEEKPVLKRECTGDASESALLKCVELSIGGVTKYRGENKKIVEIPFNSTNKYQVSIHETSDGNQG-YLLAMKGAPERILERCSTILIDGKEMEMDDHWRQEFNNAYLELGGMGERVLGFCDYRLDENNFPRGFDFNPDEVNFPLDGLRFVGLMSMIXXXXXXXXXXXXKCRSAGIKVIMVTGDHPITAKAIAKGVGIISEGNKTVDDIAAERGISPSEVNPRDARACVIHGSDLRDMSSEQLDEVLKHHDEIVFARTSPQQKLIIVEGCQRQGAIVAVTGDGVNDSPALKKADIGVAMGIAGSDVSKQAADMILLDDNFASIVTGVEEGRIIFDNLKKSIAYTLTSNIPEITPFLVFILADVPLPLGTITILCIDLGTDMVPAISLAYEEAESDIMKRKPRDPKHDKLVNERLISMAYGQIGMIQASGGFFVYFVIMAEQGFWPSRLLGLRKEWDSAAVNDLADSYGQEWTFDQRKKLEYTCHTAFFVSIVIVQWTDLMICKTRRNSIFQQGMWNHQMTFGLFFETTLAAFLTYCPGLDVALKMQPLRFTWWLPAIPFSASIFIYDEIRKFLLRKWKNGSWLENETYY 3138
            E+ +  HK+S++++  +  TD  +GL+  +A+  LARDGPNALTPP TTPEWVKFCRQLFGGFS+LLWIGA LCFLAY I +G  +DP  DNLYLGIVL AVV+ITGCFSYYQEAKSSKIMESF  MVPQ+A VIR+G+ +++ AE +V GD++++K GDRVPAD+R+I A   KVDNS+LTGESE Q RS + T+DNPLET+NI FFSTN VEGT +GVV++TGD TVMGRIA LASGLE+G TPIA EI HFI +ITGVAVFLGVSFF+++ ILGY WL+AVIFLIGIIVANVPEGLLATVTVCLTLTAK+MA+KNCLVKNLEAVETLGSTSTICSDKTGTLTQNRMTVAHMWFDN+I E+DT+E+Q  +S  + S TW  L+ +A LCNRA FK G++  PVLKR+  GDASESALLKC+ELS G V   R  NKK+ EIPFNSTNKYQ+SIHET D N   YLL MKGAPERIL+RCSTIL+ GKE  +D+  ++ F NAYLELGG+GERVLGFC Y L E  FP+GF F+ D+VNF  D L FVGLMSMIDPPRAAVPDAV KCRSAGIKVIMVTGDHPITAKAIAKGVGIISEGN+TV+DIAA   I  S+VNPRDA+ACVIHG+DL+D +SEQ+DE+L++H EIVFARTSPQQKLIIVEGCQRQGAIVAVTGDGVNDSPALKKADIGVAMGIAGSDVSKQAADMILLDDNFASIVTGVEEGR+IFDNLKKSIAYTLTSNIPEITPFL+FI+A++PLPLGTITILCIDLGTDMVPAISLAYE AESDIMKR+PR+P+ DKLVNERLISMAYGQIGMIQA GGFF YFVI+AE GF P  L+G+R  WD   VNDL DSYGQ+WT++QRK +E+TCHTAFFVSIV+VQW DL+ICKTRRNS+FQQGM N  + FGLF ET LAAFL+YCPG+DVAL+M PL+ +WW  A P+S  IF+YDEIRK +LR+   G W+E ETYY
Sbjct:   41 EVAMTEHKMSVEEVCRKYNTDCVQGLTHSKAQEILARDGPNALTPPPTTPEWVKFCRQLFGGFSILLWIGAILCFLAYGIQAGTEDDPSGDNLYLGIVLAAVVIITGCFSYYQEAKSSKIMESFKNMVPQQALVIREGEKMQVNAEEVVVGDLVEIKGGDRVPADLRIISAHGCKVDNSSLTGESEPQTRSPDCTHDNPLETRNITFFSTNCVEGTARGVVVATGDRTVMGRIATLASGLEVGKTPIAIEIEHFIQLITGVAVFLGVSFFILSLILGYTWLEAVIFLIGIIVANVPEGLLATVTVCLTLTAKRMARKNCLVKNLEAVETLGSTSTICSDKTGTLTQNRMTVAHMWFDNQIHEADTTEDQSGTSFDKSSHTWVALSHIAGLCNRAVFKGGQDNIPVLKRDVAGDASESALLKCIELSSGSVKLMRERNKKVAEIPFNSTNKYQLSIHETEDPNDNRYLLVMKGAPERILDRCSTILLQGKEQPLDEEMKEAFQNAYLELGGLGERVLGFCHYYLPEEQFPKGFAFDCDDVNFTTDNLCFVGLMSMIDPPRAAVPDAVGKCRSAGIKVIMVTGDHPITAKAIAKGVGIISEGNETVEDIAARLNIPVSQVNPRDAKACVIHGTDLKDFTSEQIDEILQNHTEIVFARTSPQQKLIIVEGCQRQGAIVAVTGDGVNDSPALKKADIGVAMGIAGSDVSKQAADMILLDDNFASIVTGVEEGRLIFDNLKKSIAYTLTSNIPEITPFLLFIMANIPLPLGTITILCIDLGTDMVPAISLAYEAAESDIMKRQPRNPRTDKLVNERLISMAYGQIGMIQALGGFFSYFVILAENGFLPGNLVGIRLNWDDRTVNDLEDSYGQQWTYEQRKVVEFTCHTAFFVSIVVVQWADLIICKTRRNSVFQQGMKNKILIFGLFEETALAAFLSYCPGMDVALRMYPLKPSWWFCAFPYSFLIFVYDEIRKLILRR-NPGGWVEKETYY 1026          
BLAST of non-gastric H ,K -ATPase alpha subunit vs. Ensembl Human
Match: ATP1A3 (ATPase Na+/K+ transporting subunit alpha 3 [Source:HGNC Symbol;Acc:HGNC:801])

HSP 1 Score: 1480.69 bits (3832), Expect = 0.000e+0
Identity = 736/981 (75.03%), Postives = 843/981 (85.93%), Query Frame = 1
Query:  199 HKISIKDLYIRLQTDPEKGLSIEEAKIRLARDGPNALTPPKTTPEWVKFCRQLFGGFSLLLWIGAALCFLAYAILSGAYEDPPKDNLYLGIVLTAVVVITGCFSYYQEAKSSKIMESFGKMVPQKANVIRDGKILEIAAENLVTGDIIDVKFGDRVPADIRVIQASSFKVDNSALTGESEAQVRSSEFTNDNPLETKNIAFFSTNAVEGTCKGVVISTGDNTVMGRIANLASGLEMGMTPIAKEINHFIHIITGVAVFLGVSFFVIAFILGYFWLDAVIFLIGIIVANVPEGXXXXXXXXXXXXXKKMAKKNCLVKNLEAVETLGSTSTICSDKTGTLTQNRMTVAHMWFDNKIQESDTSENQITSSTKQESETWKMLARVAMLCNRAQFKSGEEEKPVLKRECTGDASESALLKCVELSIGGVTKYRGENKKIVEIPFNSTNKYQVSIHETSDGNQG-YLLAMKGAPERILERCSTILIDGKEMEMDDHWRQEFNNAYLELGGMGERVLGFCDYRLDENNFPRGFDFNPDEVNFPLDGLRFVGLMSMIXXXXXXXXXXXXKCRSAGIKVIMVTGDHPITAKAIAKGVGIISEGNKTVDDIAAERGISPSEVNPRDARACVIHGSDLRDMSSEQLDEVLKHHDEIVFARTSPQQKLIIVEGCQRQGAIVAVTGDGVNDSPALKKADIGVAMGIAGSDVSKQAADMILLDDNFASIVTGVEEGRIIFDNLKKSIAYTLTSNIPEITPFLVFILADVPLPLGTITILCIDLGTDMVPAISLAYEEAESDIMKRKPRDPKHDKLVNERLISMAYGQIGMIQASGGFFVYFVIMAEQGFWPSRLLGLRKEWDSAAVNDLADSYGQEWTFDQRKKLEYTCHTAFFVSIVIVQWTDLMICKTRRNSIFQQGMWNHQMTFGLFFETTLAAFLTYCPGLDVALKMQPLRFTWWLPAIPFSASIFIYDEIRKFLLRKWKNGSWLENETYY 3138
            HK+S++++  +  TD  +GL+  +A+  LARDGPNALTPP TTPEWVKFCRQLFGGFS+LLWIGA LCFLAY I +G  +DP  DNLYLGIVL AVV+ITGCFSYYQEAKSSKIMESF  MVPQ+A VIR+G+ +++ AE +V GD++++K GDRVPAD+R+I A   KVDNS+LTGESE Q RS + T+DNPLET+NI FFSTN VEGT +GVV++TGD TVMGRIA LASGLE+G TPIA EI HFI +ITGVAVFLGVSFF+++ ILGY WL+AVIFLIGIIVANVPEGLLATVTVCLTLTAK+MA+KNCLVKNLEAVETLGSTSTICSDKTGTLTQNRMTVAHMWFDN+I E+DT+E+Q  +S  + S TW  L+ +A LCNRA FK G++  PVLKR+  GDASESALLKC+ELS G V   R  NKK+ EIPFNSTNKYQ+SIHET D N   YLL MKGAPERIL+RCSTIL+ GKE  +D+  ++ F NAYLELGG+GERVLGFC Y L E  FP+GF F+ D+VNF  D L FVGLMSMIDPPRAAVPDAV KCRSAGIKVIMVTGDHPITAKAIAKGVGIISEGN+TV+DIAA   I  S+VNPRDA+ACVIHG+DL+D +SEQ+DE+L++H EIVFARTSPQQKLIIVEGCQRQGAIVAVTGDGVNDSPALKKADIGVAMGIAGSDVSKQAADMILLDDNFASIVTGVEEGR+IFDNLKKSIAYTLTSNIPEITPFL+FI+A++PLPLGTITILCIDLGTDMVPAISLAYE AESDIMKR+PR+P+ DKLVNERLISMAYGQIGMIQA GGFF YFVI+AE GF P  L+G+R  WD   VNDL DSYGQ+WT++QRK +E+TCHTAFFVSIV+VQW DL+ICKTRRNS+FQQGM N  + FGLF ET LAAFL+YCPG+DVAL+M PL+ +WW  A P+S  IF+YDEIRK +LR+   G W+E ETYY
Sbjct:    4 HKMSVEEVCRKYNTDCVQGLTHSKAQEILARDGPNALTPPPTTPEWVKFCRQLFGGFSILLWIGAILCFLAYGIQAGTEDDPSGDNLYLGIVLAAVVIITGCFSYYQEAKSSKIMESFKNMVPQQALVIREGEKMQVNAEEVVVGDLVEIKGGDRVPADLRIISAHGCKVDNSSLTGESEPQTRSPDCTHDNPLETRNITFFSTNCVEGTARGVVVATGDRTVMGRIATLASGLEVGKTPIAIEIEHFIQLITGVAVFLGVSFFILSLILGYTWLEAVIFLIGIIVANVPEGLLATVTVCLTLTAKRMARKNCLVKNLEAVETLGSTSTICSDKTGTLTQNRMTVAHMWFDNQIHEADTTEDQSGTSFDKSSHTWVALSHIAGLCNRAVFKGGQDNIPVLKRDVAGDASESALLKCIELSSGSVKLMRERNKKVAEIPFNSTNKYQLSIHETEDPNDNRYLLVMKGAPERILDRCSTILLQGKEQPLDEEMKEAFQNAYLELGGLGERVLGFCHYYLPEEQFPKGFAFDCDDVNFTTDNLCFVGLMSMIDPPRAAVPDAVGKCRSAGIKVIMVTGDHPITAKAIAKGVGIISEGNETVEDIAARLNIPVSQVNPRDAKACVIHGTDLKDFTSEQIDEILQNHTEIVFARTSPQQKLIIVEGCQRQGAIVAVTGDGVNDSPALKKADIGVAMGIAGSDVSKQAADMILLDDNFASIVTGVEEGRLIFDNLKKSIAYTLTSNIPEITPFLLFIMANIPLPLGTITILCIDLGTDMVPAISLAYEAAESDIMKRQPRNPRTDKLVNERLISMAYGQIGMIQALGGFFSYFVILAENGFLPGNLVGIRLNWDDRTVNDLEDSYGQQWTYEQRKVVEFTCHTAFFVSIVVVQWADLIICKTRRNSVFQQGMKNKILIFGLFEETALAAFLSYCPGMDVALRMYPLKPSWWFCAFPYSFLIFVYDEIRKLILRR-NPGGWVEKETYY 983          
BLAST of non-gastric H ,K -ATPase alpha subunit vs. Ensembl Human
Match: ATP1A3 (ATPase Na+/K+ transporting subunit alpha 3 [Source:HGNC Symbol;Acc:HGNC:801])

HSP 1 Score: 1480.69 bits (3832), Expect = 0.000e+0
Identity = 737/987 (74.67%), Postives = 846/987 (85.71%), Query Frame = 1
Query:  181 ELDIDSHKISIKDLYIRLQTDPEKGLSIEEAKIRLARDGPNALTPPKTTPEWVKFCRQLFGGFSLLLWIGAALCFLAYAILSGAYEDPPKDNLYLGIVLTAVVVITGCFSYYQEAKSSKIMESFGKMVPQKANVIRDGKILEIAAENLVTGDIIDVKFGDRVPADIRVIQASSFKVDNSALTGESEAQVRSSEFTNDNPLETKNIAFFSTNAVEGTCKGVVISTGDNTVMGRIANLASGLEMGMTPIAKEINHFIHIITGVAVFLGVSFFVIAFILGYFWLDAVIFLIGIIVANVPEGXXXXXXXXXXXXXKKMAKKNCLVKNLEAVETLGSTSTICSDKTGTLTQNRMTVAHMWFDNKIQESDTSENQITSSTKQESETWKMLARVAMLCNRAQFKSGEEEKPVLKRECTGDASESALLKCVELSIGGVTKYRGENKKIVEIPFNSTNKYQVSIHETSDGNQG-YLLAMKGAPERILERCSTILIDGKEMEMDDHWRQEFNNAYLELGGMGERVLGFCDYRLDENNFPRGFDFNPDEVNFPLDGLRFVGLMSMIXXXXXXXXXXXXKCRSAGIKVIMVTGDHPITAKAIAKGVGIISEGNKTVDDIAAERGISPSEVNPRDARACVIHGSDLRDMSSEQLDEVLKHHDEIVFARTSPQQKLIIVEGCQRQGAIVAVTGDGVNDSPALKKADIGVAMGIAGSDVSKQAADMILLDDNFASIVTGVEEGRIIFDNLKKSIAYTLTSNIPEITPFLVFILADVPLPLGTITILCIDLGTDMVPAISLAYEEAESDIMKRKPRDPKHDKLVNERLISMAYGQIGMIQASGGFFVYFVIMAEQGFWPSRLLGLRKEWDSAAVNDLADSYGQEWTFDQRKKLEYTCHTAFFVSIVIVQWTDLMICKTRRNSIFQQGMWNHQMTFGLFFETTLAAFLTYCPGLDVALKMQPLRFTWWLPAIPFSASIFIYDEIRKFLLRKWKNGSWLENETYY 3138
            E+ +  HK+S++++  +  TD  +GL+  +A+  LARDGPNALTPP TTPEWVKFCRQLFGGFS+LLWIGA LCFLAY I +G  +DP  DNLYLGIVL AVV+ITGCFSYYQEAKSSKIMESF  MVPQ+A VIR+G+ +++ AE +V GD++++K GDRVPAD+R+I A   KVDNS+LTGESE Q RS + T+DNPLET+NI FFSTN VEGT +GVV++TGD TVMGRIA LASGLE+G TPIA EI HFI +ITGVAVFLGVSFF+++ ILGY WL+AVIFLIGIIVANVPEGLLATVTVCLTLTAK+MA+KNCLVKNLEAVETLGSTSTICSDKTGTLTQNRMTVAHMWFDN+I E+DT+E+Q  +S  + S TW  L+ +A LCNRA FK G++  PVLKR+  GDASESALLKC+ELS G V   R  NKK+ EIPFNSTNKYQ+SIHET D N   YLL MKGAPERIL+RCSTIL+ GKE  +D+  ++ F NAYLELGG+GERVLGFC Y L E  FP+GF F+ D+VNF  D L FVGLMSMIDPPRAAVPDAV KCRSAGIKVIMVTGDHPITAKAIAKGVGIISEGN+TV+DIAA   I  S+VNPRDA+ACVIHG+DL+D +SEQ+DE+L++H EIVFARTSPQQKLIIVEGCQRQGAIVAVTGDGVNDSPALKKADIGVAMGIAGSDVSKQAADMILLDDNFASIVTGVEEGR+IFDNLKKSIAYTLTSNIPEITPFL+FI+A++PLPLGTITILCIDLGTDMVPAISLAYE AESDIMKR+PR+P+ DKLVNERLISMAYGQIGMIQA GGFF YFVI+AE GF P  L+G+R  WD   VNDL DSYGQ+WT++QRK +E+TCHTAFFVSIV+VQW DL+ICKTRRNS+FQQGM N  + FGLF ET LAAFL+YCPG+DVAL+M PL+ +WW  A P+S  IF+YDEIRK +LR+   G W+E ETYY
Sbjct:   28 EVAMTEHKMSVEEVCRKYNTDCVQGLTHSKAQEILARDGPNALTPPPTTPEWVKFCRQLFGGFSILLWIGAILCFLAYGIQAGTEDDPSGDNLYLGIVLAAVVIITGCFSYYQEAKSSKIMESFKNMVPQQALVIREGEKMQVNAEEVVVGDLVEIKGGDRVPADLRIISAHGCKVDNSSLTGESEPQTRSPDCTHDNPLETRNITFFSTNCVEGTARGVVVATGDRTVMGRIATLASGLEVGKTPIAIEIEHFIQLITGVAVFLGVSFFILSLILGYTWLEAVIFLIGIIVANVPEGLLATVTVCLTLTAKRMARKNCLVKNLEAVETLGSTSTICSDKTGTLTQNRMTVAHMWFDNQIHEADTTEDQSGTSFDKSSHTWVALSHIAGLCNRAVFKGGQDNIPVLKRDVAGDASESALLKCIELSSGSVKLMRERNKKVAEIPFNSTNKYQLSIHETEDPNDNRYLLVMKGAPERILDRCSTILLQGKEQPLDEEMKEAFQNAYLELGGLGERVLGFCHYYLPEEQFPKGFAFDCDDVNFTTDNLCFVGLMSMIDPPRAAVPDAVGKCRSAGIKVIMVTGDHPITAKAIAKGVGIISEGNETVEDIAARLNIPVSQVNPRDAKACVIHGTDLKDFTSEQIDEILQNHTEIVFARTSPQQKLIIVEGCQRQGAIVAVTGDGVNDSPALKKADIGVAMGIAGSDVSKQAADMILLDDNFASIVTGVEEGRLIFDNLKKSIAYTLTSNIPEITPFLLFIMANIPLPLGTITILCIDLGTDMVPAISLAYEAAESDIMKRQPRNPRTDKLVNERLISMAYGQIGMIQALGGFFSYFVILAENGFLPGNLVGIRLNWDDRTVNDLEDSYGQQWTYEQRKVVEFTCHTAFFVSIVVVQWADLIICKTRRNSVFQQGMKNKILIFGLFEETALAAFLSYCPGMDVALRMYPLKPSWWFCAFPYSFLIFVYDEIRKLILRR-NPGGWVEKETYY 1013          
BLAST of non-gastric H ,K -ATPase alpha subunit vs. Ensembl Human
Match: ATP1A3 (ATPase Na+/K+ transporting subunit alpha 3 [Source:HGNC Symbol;Acc:HGNC:801])

HSP 1 Score: 1479.54 bits (3829), Expect = 0.000e+0
Identity = 737/987 (74.67%), Postives = 846/987 (85.71%), Query Frame = 1
Query:  181 ELDIDSHKISIKDLYIRLQTDPEKGLSIEEAKIRLARDGPNALTPPKTTPEWVKFCRQLFGGFSLLLWIGAALCFLAYAILSGAYEDPPKDNLYLGIVLTAVVVITGCFSYYQEAKSSKIMESFGKMVPQKANVIRDGKILEIAAENLVTGDIIDVKFGDRVPADIRVIQASSFKVDNSALTGESEAQVRSSEFTNDNPLETKNIAFFSTNAVEGTCKGVVISTGDNTVMGRIANLASGLEMGMTPIAKEINHFIHIITGVAVFLGVSFFVIAFILGYFWLDAVIFLIGIIVANVPEGXXXXXXXXXXXXXKKMAKKNCLVKNLEAVETLGSTSTICSDKTGTLTQNRMTVAHMWFDNKIQESDTSENQITSSTKQESETWKMLARVAMLCNRAQFKSGEEEKPVLKRECTGDASESALLKCVELSIGGVTKYRGENKKIVEIPFNSTNKYQVSIHETSDGNQG-YLLAMKGAPERILERCSTILIDGKEMEMDDHWRQEFNNAYLELGGMGERVLGFCDYRLDENNFPRGFDFNPDEVNFPLDGLRFVGLMSMIXXXXXXXXXXXXKCRSAGIKVIMVTGDHPITAKAIAKGVGIISEGNKTVDDIAAERGISPSEVNPRDARACVIHGSDLRDMSSEQLDEVLKHHDEIVFARTSPQQKLIIVEGCQRQGAIVAVTGDGVNDSPALKKADIGVAMGIAGSDVSKQAADMILLDDNFASIVTGVEEGRIIFDNLKKSIAYTLTSNIPEITPFLVFILADVPLPLGTITILCIDLGTDMVPAISLAYEEAESDIMKRKPRDPKHDKLVNERLISMAYGQIGMIQASGGFFVYFVIMAEQGFWPSRLLGLRKEWDSAAVNDLADSYGQEWTFDQRKKLEYTCHTAFFVSIVIVQWTDLMICKTRRNSIFQQGMWNHQMTFGLFFETTLAAFLTYCPGLDVALKMQPLRFTWWLPAIPFSASIFIYDEIRKFLLRKWKNGSWLENETYY 3138
            E+ +  HK+S++++  +  TD  +GL+  +A+  LARDGPNALTPP TTPEWVKFCRQLFGGFS+LLWIGA LCFLAY I +G  +DP  DNLYLGIVL AVV+ITGCFSYYQEAKSSKIMESF  MVPQ+A VIR+G+ +++ AE +V GD++++K GDRVPAD+R+I A   KVDNS+LTGESE Q RS + T+DNPLET+NI FFSTN VEGT +GVV++TGD TVMGRIA LASGLE+G TPIA EI HFI +ITGVAVFLGVSFF+++ ILGY WL+AVIFLIGIIVANVPEGLLATVTVCLTLTAK+MA+KNCLVKNLEAVETLGSTSTICSDKTGTLTQNRMTVAHMWFDN+I E+DT+E+Q  +S  + S TW  L+ +A LCNRA FK G++  PVLKR+  GDASESALLKC+ELS G V   R  NKK+ EIPFNSTNKYQ+SIHET D N   YLL MKGAPERIL+RCSTIL+ GKE  +D+  ++ F NAYLELGG+GERVLGFC Y L E  FP+GF F+ D+VNF  D L FVGLMSMIDPPRAAVPDAV KCRSAGIKVIMVTGDHPITAKAIAKGVGIISEGN+TV+DIAA   I  S+VNPRDA+ACVIHG+DL+D +SEQ+DE+L++H EIVFARTSPQQKLIIVEGCQRQGAIVAVTGDGVNDSPALKKADIGVAMGIAGSDVSKQAADMILLDDNFASIVTGVEEGR+IFDNLKKSIAYTLTSNIPEITPFL+FI+A++PLPLGTITILCIDLGTDMVPAISLAYE AESDIMKR+PR+P+ DKLVNERLISMAYGQIGMIQA GGFF YFVI+AE GF P  L+G+R  WD   VNDL DSYGQ+WT++QRK +E+TCHTAFFVSIV+VQW DL+ICKTRRNS+FQQGM N  + FGLF ET LAAFL+YCPG+DVAL+M PL+ +WW  A P+S  IF+YDEIRK +LR+   G W+E ETYY
Sbjct:   39 EVAMTEHKMSVEEVCRKYNTDCVQGLTHSKAQEILARDGPNALTPPPTTPEWVKFCRQLFGGFSILLWIGAILCFLAYGIQAGTEDDPSGDNLYLGIVLAAVVIITGCFSYYQEAKSSKIMESFKNMVPQQALVIREGEKMQVNAEEVVVGDLVEIKGGDRVPADLRIISAHGCKVDNSSLTGESEPQTRSPDCTHDNPLETRNITFFSTNCVEGTARGVVVATGDRTVMGRIATLASGLEVGKTPIAIEIEHFIQLITGVAVFLGVSFFILSLILGYTWLEAVIFLIGIIVANVPEGLLATVTVCLTLTAKRMARKNCLVKNLEAVETLGSTSTICSDKTGTLTQNRMTVAHMWFDNQIHEADTTEDQSGTSFDKSSHTWVALSHIAGLCNRAVFKGGQDNIPVLKRDVAGDASESALLKCIELSSGSVKLMRERNKKVAEIPFNSTNKYQLSIHETEDPNDNRYLLVMKGAPERILDRCSTILLQGKEQPLDEEMKEAFQNAYLELGGLGERVLGFCHYYLPEEQFPKGFAFDCDDVNFTTDNLCFVGLMSMIDPPRAAVPDAVGKCRSAGIKVIMVTGDHPITAKAIAKGVGIISEGNETVEDIAARLNIPVSQVNPRDAKACVIHGTDLKDFTSEQIDEILQNHTEIVFARTSPQQKLIIVEGCQRQGAIVAVTGDGVNDSPALKKADIGVAMGIAGSDVSKQAADMILLDDNFASIVTGVEEGRLIFDNLKKSIAYTLTSNIPEITPFLLFIMANIPLPLGTITILCIDLGTDMVPAISLAYEAAESDIMKRQPRNPRTDKLVNERLISMAYGQIGMIQALGGFFSYFVILAENGFLPGNLVGIRLNWDDRTVNDLEDSYGQQWTYEQRKVVEFTCHTAFFVSIVVVQWADLIICKTRRNSVFQQGMKNKILIFGLFEETALAAFLSYCPGMDVALRMYPLKPSWWFCAFPYSFLIFVYDEIRKLILRR-NPGGWVEKETYY 1024          
BLAST of non-gastric H ,K -ATPase alpha subunit vs. Ensembl Celegans
Match: eat-6 (Sodium/potassium-transporting ATPase subunit alpha [Source:UniProtKB/TrEMBL;Acc:P90735])

HSP 1 Score: 1422.53 bits (3681), Expect = 0.000e+0
Identity = 713/986 (72.31%), Postives = 828/986 (83.98%), Query Frame = 1
Query:  181 ELDIDSHKISIKDLYIRLQTDPEKGLSIEEAKIRLARDGPNALTPPKTTPEWVKFCRQLFGGFSLLLWIGAALCFLAYAILSGAYEDPPKDNLYLGIVLTAVVVITGCFSYYQEAKSSKIMESFGKMVPQKANVIRDGKILEIAAENLVTGDIIDVKFGDRVPADIRVIQASSFKVDNSALTGESEAQVRSSEFTNDNPLETKNIAFFSTNAVEGTCKGVVISTGDNTVMGRIANLASGLEMGMTPIAKEINHFIHIITGVAVFLGVSFFVIAFILGYFWLDAVIFLIGIIVANVPEGXXXXXXXXXXXXXKKMAKKNCLVKNLEAVETLGSTSTICSDKTGTLTQNRMTVAHMWFDNKIQESDTSENQITSSTKQESETWKMLARVAMLCNRAQFKSGEEEKPVLKRECTGDASESALLKCVELSIGGVTKYRGENKKIVEIPFNSTNKYQVSIHETSDGNQGYLLAMKGAPERILERCSTILIDGKEMEMDDHWRQEFNNAYLELGGMGERVLGFCDYRLDENNFPRGFDFNPDEVNFPLDGLRFVGLMSMIXXXXXXXXXXXXKCRSAGIKVIMVTGDHPITAKAIAKGVGIISEGNKTVDDIAAERGISPSEVNPRDARACVIHGSDLRDMSSEQLDEVLKHHDEIVFARTSPQQKLIIVEGCQRQGAIVAVTGDGVNDSPALKKADIGVAMGIAGSDVSKQAADMILLDDNFASIVTGVEEGRIIFDNLKKSIAYTLTSNIPEITPFLVFILADVPLPLGTITILCIDLGTDMVPAISLAYEEAESDIMKRKPRDPKHDKLVNERLISMAYGQIGMIQASGGFFVYFVIMAEQGFWPSRLLGLRKEWDSAAVNDLADSYGQEWTFDQRKKLEYTCHTAFFVSIVIVQWTDLMICKTRRNSIFQQGMWNHQMTFGLFFETTLAAFLTYCPGLDVALKMQPLRFTWWLPAIPFSASIFIYDEIRKFLLRKWKNGSWLENETYY 3138
            E+ +D H + I++L  RL T+ E GL+ ++A+  LA++GPNAL+PP+TTPEW+KFC+ LFGGF++LLW+GA LC++AY++     E P KDNLYLGIVL  VVVITG F YYQE+KSSKIM+SF  MVP  A V RDG+  ++  E LV GDI++VK GDRVPAD+RV+ A  FKVDNS+LTGESE Q RS + TN+NPLET+NIAFFSTNAVEGT KG+VI TGDNTVMGRIA+LASGL+ GMTPIA+EI HFIH+ITGVAVFLG+SFF+IAFILGY WL AV+FLIGIIVANVPEGL+ATVTVCLTLTAK+MA KNCLVKNLEAVETLGSTSTICSDKTGTLTQNRMTVAHMW+D  I E DT+E Q TS  K+   +++ L R+A LCNRA+FK+G+++ P+L+R+CTGDASE ALLK  EL+ G V   R +NKKI EIPFNSTNKYQVSIH+  D    YLL MKGAPERIL+ CSTI ++GKE E+ D  R++FN AYLELGGMGERVLGFCD+ L  + FP+GF F+ +EVNFPL  LRFVGLMSMIDPPRAAVPDAVAKCRSAGIKV+MVTGDHPITAKAIAK VGIIS+G +TV+DIA  RGI   EVNPR+A+A VIHGSDLR+MS +QL E++K+H EIVFARTSPQQKL+IVEG Q+QG IVAVTGDGVNDSPALKKADIGVAMGIAGSDVSKQAADMILLDDNFASIV GVEEGR+IFDNLKKSIAYTLTSNIPEI+PFL +IL  +PLPLGT+TILCIDLGTDMVPAISLAYEEAESDIMKR+PRDP  DKLVNERLIS+AYGQIGMIQAS GFF YF IMA+ GF P  L  LR +WDS A N++ DSYGQEWT+  RK LEYTC TA+FVSIV+VQW DL+I KTRRNS+ QQGM N  + FGL FET LA F+ YCPGLD  L+M  LRF+WW  A+PFS  IF+YDEIR+FL+R++  G W+E ETYY
Sbjct:   16 EVKMDEHIVPIEELVARLGTNLETGLTRQKAQEVLAKNGPNALSPPETTPEWIKFCKNLFGGFAMLLWVGAILCYIAYSVDYFTMEYPSKDNLYLGIVLMTVVVITGVFQYYQESKSSKIMDSFKNMVPTFALVHRDGQKQQVKTEELVVGDIVEVKGGDRVPADLRVVSAFGFKVDNSSLTGESEPQSRSPDCTNENPLETRNIAFFSTNAVEGTAKGIVIYTGDNTVMGRIAHLASGLDTGMTPIAREIEHFIHLITGVAVFLGISFFIIAFILGYHWLTAVVFLIGIIVANVPEGLIATVTVCLTLTAKRMASKNCLVKNLEAVETLGSTSTICSDKTGTLTQNRMTVAHMWYDETIHECDTTETQ-TSQEKRTGASFEALVRIASLCNRAEFKAGQQDTPILRRDCTGDASEIALLKFTELTQGNVIAVREKNKKIAEIPFNSTNKYQVSIHDNGDH---YLLVMKGAPERILDVCSTIFLNGKESELTDKLREDFNTAYLELGGMGERVLGFCDFVLPADKFPKGFKFDVEEVNFPLKNLRFVGLMSMIDPPRAAVPDAVAKCRSAGIKVVMVTGDHPITAKAIAKSVGIISDGTETVEDIAIRRGIPVEEVNPREAKAAVIHGSDLREMSEDQLAEIIKYHSEIVFARTSPQQKLMIVEGFQKQGQIVAVTGDGVNDSPALKKADIGVAMGIAGSDVSKQAADMILLDDNFASIVVGVEEGRLIFDNLKKSIAYTLTSNIPEISPFLTYILFGIPLPLGTVTILCIDLGTDMVPAISLAYEEAESDIMKRQPRDPIRDKLVNERLISLAYGQIGMIQASAGFFTYFWIMADNGFMPWDLYQLRAQWDSRAYNNVLDSYGQEWTYANRKILEYTCQTAYFVSIVVVQWADLIISKTRRNSLVQQGMSNWTLNFGLVFETALAWFMCYCPGLDNGLRMYGLRFSWWFCALPFSILIFVYDEIRRFLIRRYP-GGWVERETYY 996          
BLAST of non-gastric H ,K -ATPase alpha subunit vs. Ensembl Celegans
Match: eat-6 (Sodium/potassium-transporting ATPase subunit alpha [Source:UniProtKB/TrEMBL;Acc:P90735])

HSP 1 Score: 1422.53 bits (3681), Expect = 0.000e+0
Identity = 713/986 (72.31%), Postives = 828/986 (83.98%), Query Frame = 1
Query:  181 ELDIDSHKISIKDLYIRLQTDPEKGLSIEEAKIRLARDGPNALTPPKTTPEWVKFCRQLFGGFSLLLWIGAALCFLAYAILSGAYEDPPKDNLYLGIVLTAVVVITGCFSYYQEAKSSKIMESFGKMVPQKANVIRDGKILEIAAENLVTGDIIDVKFGDRVPADIRVIQASSFKVDNSALTGESEAQVRSSEFTNDNPLETKNIAFFSTNAVEGTCKGVVISTGDNTVMGRIANLASGLEMGMTPIAKEINHFIHIITGVAVFLGVSFFVIAFILGYFWLDAVIFLIGIIVANVPEGXXXXXXXXXXXXXKKMAKKNCLVKNLEAVETLGSTSTICSDKTGTLTQNRMTVAHMWFDNKIQESDTSENQITSSTKQESETWKMLARVAMLCNRAQFKSGEEEKPVLKRECTGDASESALLKCVELSIGGVTKYRGENKKIVEIPFNSTNKYQVSIHETSDGNQGYLLAMKGAPERILERCSTILIDGKEMEMDDHWRQEFNNAYLELGGMGERVLGFCDYRLDENNFPRGFDFNPDEVNFPLDGLRFVGLMSMIXXXXXXXXXXXXKCRSAGIKVIMVTGDHPITAKAIAKGVGIISEGNKTVDDIAAERGISPSEVNPRDARACVIHGSDLRDMSSEQLDEVLKHHDEIVFARTSPQQKLIIVEGCQRQGAIVAVTGDGVNDSPALKKADIGVAMGIAGSDVSKQAADMILLDDNFASIVTGVEEGRIIFDNLKKSIAYTLTSNIPEITPFLVFILADVPLPLGTITILCIDLGTDMVPAISLAYEEAESDIMKRKPRDPKHDKLVNERLISMAYGQIGMIQASGGFFVYFVIMAEQGFWPSRLLGLRKEWDSAAVNDLADSYGQEWTFDQRKKLEYTCHTAFFVSIVIVQWTDLMICKTRRNSIFQQGMWNHQMTFGLFFETTLAAFLTYCPGLDVALKMQPLRFTWWLPAIPFSASIFIYDEIRKFLLRKWKNGSWLENETYY 3138
            E+ +D H + I++L  RL T+ E GL+ ++A+  LA++GPNAL+PP+TTPEW+KFC+ LFGGF++LLW+GA LC++AY++     E P KDNLYLGIVL  VVVITG F YYQE+KSSKIM+SF  MVP  A V RDG+  ++  E LV GDI++VK GDRVPAD+RV+ A  FKVDNS+LTGESE Q RS + TN+NPLET+NIAFFSTNAVEGT KG+VI TGDNTVMGRIA+LASGL+ GMTPIA+EI HFIH+ITGVAVFLG+SFF+IAFILGY WL AV+FLIGIIVANVPEGL+ATVTVCLTLTAK+MA KNCLVKNLEAVETLGSTSTICSDKTGTLTQNRMTVAHMW+D  I E DT+E Q TS  K+   +++ L R+A LCNRA+FK+G+++ P+L+R+CTGDASE ALLK  EL+ G V   R +NKKI EIPFNSTNKYQVSIH+  D    YLL MKGAPERIL+ CSTI ++GKE E+ D  R++FN AYLELGGMGERVLGFCD+ L  + FP+GF F+ +EVNFPL  LRFVGLMSMIDPPRAAVPDAVAKCRSAGIKV+MVTGDHPITAKAIAK VGIIS+G +TV+DIA  RGI   EVNPR+A+A VIHGSDLR+MS +QL E++K+H EIVFARTSPQQKL+IVEG Q+QG IVAVTGDGVNDSPALKKADIGVAMGIAGSDVSKQAADMILLDDNFASIV GVEEGR+IFDNLKKSIAYTLTSNIPEI+PFL +IL  +PLPLGT+TILCIDLGTDMVPAISLAYEEAESDIMKR+PRDP  DKLVNERLIS+AYGQIGMIQAS GFF YF IMA+ GF P  L  LR +WDS A N++ DSYGQEWT+  RK LEYTC TA+FVSIV+VQW DL+I KTRRNS+ QQGM N  + FGL FET LA F+ YCPGLD  L+M  LRF+WW  A+PFS  IF+YDEIR+FL+R++  G W+E ETYY
Sbjct:   16 EVKMDEHIVPIEELVARLGTNLETGLTRQKAQEVLAKNGPNALSPPETTPEWIKFCKNLFGGFAMLLWVGAILCYIAYSVDYFTMEYPSKDNLYLGIVLMTVVVITGVFQYYQESKSSKIMDSFKNMVPTFALVHRDGQKQQVKTEELVVGDIVEVKGGDRVPADLRVVSAFGFKVDNSSLTGESEPQSRSPDCTNENPLETRNIAFFSTNAVEGTAKGIVIYTGDNTVMGRIAHLASGLDTGMTPIAREIEHFIHLITGVAVFLGISFFIIAFILGYHWLTAVVFLIGIIVANVPEGLIATVTVCLTLTAKRMASKNCLVKNLEAVETLGSTSTICSDKTGTLTQNRMTVAHMWYDETIHECDTTETQ-TSQEKRTGASFEALVRIASLCNRAEFKAGQQDTPILRRDCTGDASEIALLKFTELTQGNVIAVREKNKKIAEIPFNSTNKYQVSIHDNGDH---YLLVMKGAPERILDVCSTIFLNGKESELTDKLREDFNTAYLELGGMGERVLGFCDFVLPADKFPKGFKFDVEEVNFPLKNLRFVGLMSMIDPPRAAVPDAVAKCRSAGIKVVMVTGDHPITAKAIAKSVGIISDGTETVEDIAIRRGIPVEEVNPREAKAAVIHGSDLREMSEDQLAEIIKYHSEIVFARTSPQQKLMIVEGFQKQGQIVAVTGDGVNDSPALKKADIGVAMGIAGSDVSKQAADMILLDDNFASIVVGVEEGRLIFDNLKKSIAYTLTSNIPEISPFLTYILFGIPLPLGTVTILCIDLGTDMVPAISLAYEEAESDIMKRQPRDPIRDKLVNERLISLAYGQIGMIQASAGFFTYFWIMADNGFMPWDLYQLRAQWDSRAYNNVLDSYGQEWTYANRKILEYTCQTAYFVSIVVVQWADLIISKTRRNSLVQQGMSNWTLNFGLVFETALAWFMCYCPGLDNGLRMYGLRFSWWFCALPFSILIFVYDEIRRFLIRRYP-GGWVERETYY 996          
BLAST of non-gastric H ,K -ATPase alpha subunit vs. Ensembl Celegans
Match: catp-4 (Sodium/potassium-transporting ATPase subunit alpha [Source:UniProtKB/TrEMBL;Acc:G5EFV6])

HSP 1 Score: 996.882 bits (2576), Expect = 0.000e+0
Identity = 522/996 (52.41%), Postives = 684/996 (68.67%), Query Frame = 1
Query:  190 IDSHKISIKDLYIRLQTDPEKGLSIEEAKIRLARDGPNALTPPKTTPEWVKFCRQLFGGFSLLLWIGAALCFLAYAILSGAYEDP--PKDNLYLGIVLTAVVVITGCFSYYQEAKSSKIMESFGKMVPQKANVIRDGKILEIAAENLVTGDIIDVKFGDRVPADIRVIQASSFKVDNSALTGESEAQVRSSEFTNDNPLETKNIAFFSTNAVEGTCKGVVISTGDNTVMGRIANLASGLEMGMTPIAKEINHFIHIITGVAVFLGVSFFVIAFILGYFWLDAVIFLIGIIVANVPEGXXXXXXXXXXXXXKKMAKKNCLVKNLEAVETLGSTSTICSDKTGTLTQNRMTVAHMWFDNKIQESDT--SENQITSSTKQESE-TWKMLARVAMLCNRAQFKSGEEEKPVLKRECTGDASESALLKCVEL--SIGGVTKYRGENKKIVEIPFNSTNKYQVSIHETSDGNQGYLLAMKGAPERILERCSTILIDGKEMEMDDHWRQEFNNAYLELGGMGERVLGFCDYRLDENNFPRGFDFNPDEVNFPLDGLRFVGLMSMIXXXXXXXXXXXXKCRSAGIKVIMVTGDHPITAKAIAKGVGIISEGNKTVDDIAAERGISPS------EVNPRDARACVIHGSDLRDMSSEQLDEVLKHHDEIVFARTSPQQKLIIVEGCQRQGAIVAVTGDGVNDSPALKKADIGVAMGIAGSDVSKQAADMILLDDNFASIVTGVEEGRIIFDNLKKSIAYTLTSNIPEITPFLVFILADVPLPLGTITILCIDLGTDMVPAISLAYEEAESDIMKRKPRDPKHDKLVNERLISMAYGQIGMIQASGGFFVYFVIMAEQGFWPSRLLGLRKEWDSAAVNDLADSYGQEWTFDQRKKLEYTCHTAFFVSIVIVQWTDLMICKTRRNSIFQQGMWNHQMTFGLFFETTLAAFLTYCPGLDVALKMQPLRFTWWLPAIPFSASIFIYDEIRKFLLRKWKNGSWLENETYY 3138
            ID H+I +  L+ R  T  + G+S  EA  RL RDGPNALTPPK T +W+K    +FGGF+ LLW  A+   + Y +     +D   PKDN+Y+ I+L  VV +TG F +YQ  KS  +M+SF  M+P K  V+RDG   EI  ++LV GD++  + GDRVPAD+RV  A   KVDNS+LTGESE Q R+   T+ N LETKN+  FST+ +EG+ +G++I TGD T +GRIA L + ++ G TP+AKEINHFI II+ VA  +G++FF++A +  Y  L A++F +GI+VANVPEG++ TVTV LTLTA KM KK CLVK L+AVETLGSTSTICSDKTGTLTQNRMTV H+WFD KI++++     +      K E E +++ L R A LC+R+ F+  E + P+ KR   GDASE A+++  E+    G V ++R    KI EIPFNSTNKYQ+SIH  S      +L MKGAPE+IL+ CST   +G+   +   + +EF  AY  LG  GERVLGFCD  +    FP GF FN +E NFP+  LRF+GL+SMIDPPR  VP+AV  C++AGI+V+MVTGDHPITA+AIA  V II E  +  + + A+    P+      +   +   A VIHG  L  MS + L  V+ ++ +IVFARTSP QKL IVE  Q  G IV VTGDGVND+PAL+KADIG+AMGI G+DVSKQAADMILL+DNFASIVTGVEEGR+IFDNLKKSIAYTLTSNIPEITPF+ ++L  +PLP+  I IL IDLGTD+ PAIS AYE  ESDIM+R PR+P +DKLVN+RL+  +Y QIG IQA  GF  YFV+M   G++P  LL + ++WD+  ++DL DSYGQ+W+++ RK LE  C+  FF +IV+ QW+DL   KTR+NS+  QGM NH +   + F   LA F+   P ++  L +Q  R      A+PF+  I +YDE+R++ +R +  G ++  ETYY
Sbjct:   23 IDDHEIPLDALFKRYTTSEKNGISEAEATNRLNRDGPNALTPPKQTSKWIKLAGSIFGGFNFLLWCAASASAVGYGMDLSMSDDEEVPKDNMYMAIILATVVTVTGLFDFYQNRKSGNLMDSFANMIPPKTLVVRDGATREIEVKDLVVGDLVRFRGGDRVPADLRVTLARGLKVDNSSLTGESEPQTRNMNCTSKNALETKNLCMFSTSVLEGSGEGIIIGTGDRTFVGRIAALTTQVDPGPTPLAKEINHFIKIISIVAFTVGIAFFILALVYEYPPLKAIVFFMGIVVANVPEGIVPTVTVSLTLTAVKMRKKFCLVKKLQAVETLGSTSTICSDKTGTLTQNRMTVTHLWFDGKIKDTEILPPNDHFKGEKKYEKEDSYQKLLRCATLCSRSHFRVPEFDVPLAKRVVNGDASEVAIMRYCEMIRGDGQVDEFRKIMPKIGEIPFNSTNKYQLSIHPMSKKQN--ILVMKGAPEKILKLCSTYYQNGETKNVSKKFEKEFQQAYETLGSYGERVLGFCDLEMSTTKFPPGFKFNMEEPNFPIKNLRFLGLISMIDPPRPGVPEAVRVCQNAGIRVVMVTGDHPITARAIANQVHIIEENVQVTEIVNADPKCDPASDEIYGKGRLKPTGAVVIHGEQLTTMSPKTLKAVVTNYHQIVFARTSPAQKLQIVEAFQSVGNIVGVTGDGVNDAPALRKADIGIAMGITGTDVSKQAADMILLNDNFASIVTGVEEGRLIFDNLKKSIAYTLTSNIPEITPFMSYVLFGLPLPMSIIAILMIDLGTDLWPAISFAYEVPESDIMQRAPRNPLYDKLVNKRLVMFSYMQIGAIQACAGFTTYFVLMMSNGWFPQDLLNISEQWDNKYIDDLEDSYGQQWSYESRKALESCCYGTFFFTIVVTQWSDLFASKTRKNSLVMQGMENHVLNTSVIFTCFLAIFVLNTPFVNEVLGVQGFRLEIGFLALPFAFFIGLYDEVRRYFIRTYP-GGYIYKETYY 1015          
BLAST of non-gastric H ,K -ATPase alpha subunit vs. Ensembl Celegans
Match: catp-3 (Cation transporting ATPase [Source:UniProtKB/TrEMBL;Acc:O16331])

HSP 1 Score: 559.681 bits (1441), Expect = 0.000e+0
Identity = 368/996 (36.95%), Postives = 553/996 (55.52%), Query Frame = 1
Query:  250 KGLSIEEAKIRLARDGPNALTPPKTTPEWVKFCRQLFGGFSLLLWIGAALCFLAYAILSGAYEDPPKDNLYLGIVLTAVVVITGCFSYYQEAKSSKIMESFGKMVPQKANVIRDGKILEIAAENLVTGDIIDVKFGDRVPADIRVIQASSFKVDNSALTGESEAQVRSSEFTNDNP--LETKNIAFFSTNAVEGTCKGVVISTGDNTVMGRIANLASGLEMGMTPIAKEINHFIHIITGVAVFLGVSFFVIAFILGYFWLDAVIFLIG---IIVANVPEGXXXXXXXXXXXXXKKMAKKNCLVKNLEAVETLGSTSTICSDKTGTLTQNRMTVAHMWFDNKIQESDTSENQITSSTKQESET-----W-----KMLARVAMLCNRAQFKSG------------------EEEKPVLKRECTGDASESALLKCVELSIGGVTKYRGENKKIVEIPFNSTNKYQVSIHETS------------DGNQGYLLAMKGAPERILERCSTILIDGKEMEMDDHWRQEFNNAYLELGGMGERVLGFCDYRLDENNFPRGFDFNPDEVNFPLDGLRFVGLMSMIXXXXXXXXXXXXKCRSAGIKVIMVTGDHPITAKAIAKGVGIISEGNKTVDDIAAERGISPSEVNPRDARACVIHGSDLRDMSSEQLDEVLKHHDEIVFARTSPQQKLIIVEGCQRQGAIVAVTGDGVNDSPALKKADIGVAMGIAGSDVSKQAADMILLDDNFASIVTGVEEGRIIFDNLKKSIAYTLTSNIPEITPFLVFILADVPLPLGTITILCIDLGTDMVPAISLAYEEAESDIMKRKPRDPKHDKLVNERLISMAYGQIGMIQASGGFFVYFVIMAEQGFWPSRLLGLRKEWDSAAVNDLADSYGQEWTFDQRKKLEYTCHTAFFVSIVIVQWTDLMICKTRRNSIFQQGMWNHQMTFGLFFETTLAAFLTYCPGLDVALKMQPLRFTWWLPAIPFSASIFIYDEIRKFLLRKW 3102
            KGL+ +EA  +L  DG NAL+PPKT      F RQ      +L++  AALCFL Y      Y+     NLY+GI + A+V I    S+++E K  +++ +F  ++P    VIRDGK + +  E LV GD++ V+ G +VPAD+R+I  + F ++ S++TGE+E     S+  +      E+ NIAF  +  V+G   G++I TG+NTV+G+IA+L  G +        EI  F+  IT +A+ +    F I  ++        +F+ G   +I+ANVP+GL  TVT  LT+ A++MAKKN  +K LE ++++G+T+ I SDKTGTLT+N MTV  +W++N    S   ENQ  ++ K+         W     K +  V  +CN+A+ ++                    + +PV +   +G+ SE ALL+     +  + + R     + E+PFNS  KY + +  T             + +  ++L +KGAP+ +++ CSTI IDG  ME++     +FN AY   G  G RV+GF   +      P    F+      P+D   F+G+ +++DPPR   P A+  C+ AGIKV MVTGDH  TA AIA+ +G+I    + V ++   R +     N +D    VI G +L  +S +Q D +L+H   IVFART+P+ KL+IV   Q++G  V VTGDGVND+PALKKAD+GVAMG+AGSDV+KQAAD+ILLDDNF+SIV G+EEGR++FDNL+K+IAYT+T   PE+ P ++      PL L  + IL IDL TD+ PA+SLAYE  E+DIM + PR  +   LV + LI+  Y  + +  + GG   Y +     G +PS L     +      ++     G     +Q+  +      AF +++V+ Q   L +C TRR SIF  GM N      +  +  L    T+ PG+      QP  +  WL  +     I+I++E+RKF +R +
Sbjct:   65 KGLTKQEAAQKLKTDGKNALSPPKTISNMELFVRQFKNLLWVLMFGAAALCFLTYI-----YDPTDALNLYVGIFIVAIVFIMCVVSFFEEKKGVEVVRAFQTLMPTSCQVIRDGKEILLNPEELVVGDVVVVRSGCKVPADMRIIACTDFFLETSSITGEAEPLEFHSKTADAKTSIFESYNIAFNGSFCVDGEGYGIIIRTGENTVIGQIASLTLGQKDKKCKFETEIERFVQFITVMAITMATVIFTIGLLVNGGNDVIRLFVTGFLMVIIANVPQGLPTTVTTELTIIARRMAKKNVFLKKLEKIDSVGATTLIASDKTGTLTKNCMTVTDLWYNNSYN-SARPENQGRTTKKRNLNAINTIGWYDAPLKDILSVICVCNKARIENNLTTKVRPPRVDSELDLTVYKSQPVKEMLISGNPSEVALLRYASGMLDAM-EVRDSFHVVFEVPFNSVRKYHLILATTEATWAEIDDKKKVNADVEFILMIKGAPDVLIKSCSTINIDGVPMELNGKRMDDFNEAYETFGDEGCRVIGFACKKFRA---PATSTFSIKSNTIPMDNWDFLGMSAIMDPPRDDTPRAIKACKEAGIKVYMVTGDHKSTATAIARQIGMID--TEEVTNLDHNRQVI-RRTNSQDW--AVITGPELPGLSEKQWDALLEHR-YIVFARTTPEHKLMIVTESQKRGECVTVTGDGVNDAPALKKADVGVAMGLAGSDVAKQAADIILLDDNFSSIVAGIEEGRLLFDNLRKTIAYTMTHMWPELVPVMLNFFFGFPLGLTPVQILSIDLITDIPPAVSLAYEGPEADIMLQPPRK-RETHLVTKGLITYTYLFMSIFISVGGVVAYLLSYYLNGIYPSELAFSSNDHFKVGASNFTTYNGVVLNAEQQVFMAAQAAAAFHIAVVVGQAWHLWMCLTRRVSIFVHGMANIVAILAVIIDLLLICLFTFVPGVQYVFGSQPPPWECWLVPVIVGIWIWIFNELRKFGIRNY 1043          
BLAST of non-gastric H ,K -ATPase alpha subunit vs. Ensembl Celegans
Match: catp-2 (Cation transporting ATPase [Source:UniProtKB/TrEMBL;Acc:A0A131MBN3])

HSP 1 Score: 541.191 bits (1393), Expect = 1.379e-174
Identity = 378/1025 (36.88%), Postives = 559/1025 (54.54%), Query Frame = 1
Query:  196 SHKISIKDLYIRLQTDPE--KGLSIEEAKIRLARDGPNALTPPKTTPEWVKFCRQLFGGFSLLLWIGAALCFLAYAILSGAYEDPPKD--NLYLGIVLTAVVVITGCFSYYQEAKSSKIMESFGKMVPQKANVIRDGKILEIAAENLVTGDIIDVKFGDRVPADIRVIQASSFKVDNSALTGESEAQVRSSEFTNDNP--LETKNIAFFSTNAVEGTCKGVVISTGDNTVMGRIANLASGLEMGMTPIAKEINHFIHIITGVAVFLGVSFFVIAF-------ILGYFWLDAVIFLIGIIVANVPEGXXXXXXXXXXXXXKKMAKKNCLVKNLEAVETLGSTSTICSDKTGTLTQNRMTVAHMWFDNKI--------QESDTSENQITSSTKQESET-WKMLARVAMLCNRAQFK------------------SGEEEKPVLKRECTGDASESALLKCVELSIGGVTKYRGENKKIVEIPFNSTNKYQVSIHETSDG-NQ-------GYLLAMKGAPERILERCSTILIDGKEMEMDDHWRQEFNNAYLELGGMGERVLGFCDYRLDENNFPRGFDFNPDEVNFPLDGLRFVGLMSMIXXXXXXXXXXXXKCRSAGIKVIMVTGDHPITAKAIAKGVGII-SEGNKTVDDIAAERGISPSEVNPRDARACVIHGSDLRDMSSEQLDEVLKHHDEIVFARTSPQQKLIIVEGCQRQGAIVAVTGDGVNDSPALKKADIGVAMGIAGSDVSKQAADMILLDDNFASIVTGVEEGRIIFDNLKKSIAYTLTSNIPEITPFLVFILADVPLPLGTITILCIDLGTDMVPAISLAYEEAESDIMKRKPRDPKHDKLVNERLISMAYGQIGMIQASGGFFVYFVIMAEQGFWPSRLLGLRKEWDSAAVNDLADSYGQEWTFDQRKKLEYTCHTAFFVSIVIVQWTDLMICKTRRNSIFQQGMWNHQMTFGLFFETTLAAFLTYCPGLDVALKMQPLRFTWWLPAIPFSASIFIYDEIRKFLLRKWKNGSWLE 3123
            S K S+  L I    DP+  +GLS + A  RL  DG NAL+PPK    W  F RQ    F  LLWI   L F A A+   AY   P D  NL +GI +  ++ +    S+++E K  +++ +F  ++P    VIRDG    +  E LV GDI+ V+ G +VPADIRVI  + F ++ S++TGE+E    +S   +      E+ NIAF  +  V+G   G+VI TG+ TV+G+IA++    +        EI  F+  IT +A+ + V  F +         ++ YF    V   + +I+ANVP+GL  TVT  LT+ A++MAKKN  +K LE ++++G+T+ I SDKTGTLT+N MTV  +W++N          + S  +   ITS+  Q  +     L  V  +CN+A+ +                  S    +PV +    G+ SE ALL+     +    + R   + + EIPFNS  KY + +    +  NQ        +++ +KGAPE +++ CST+ I+G+  E+D    ++FN AY   G  G RV+GF   +         F    + V  P++   F+G+ +++DPPR   P A+  C++AGIKV MVTGDH  TA AIA+ +G+I +E    VD    ++ I  S  N +D    VI GS+L  ++ +Q DE+L+H   IVFART+P+ KL+IV   Q++G  V VTGDGVND+PALKKAD+GVAMG+AGSDV+KQAAD+ILLDDNF+SIV G+EEGR++FDNL+K+IAYT+    PE+ P ++      PL L  + IL IDL +D+ PA+SLAYE  E+DIM + PR  K   LV + LI+  Y  + +  + G    Y +     G  P  L      +      +   + G     +Q+  +      AF +S+V+ Q   L +C TRR SIF  G+ N    F +  +  L    T+ PG+      QP  +  WL  I     I+I++E+RK  +RK+    ++ 
Sbjct:   48 SEKFSMSKLDI---VDPKVSRGLSKQVAAERLESDGRNALSPPKVISNWKLFLRQ----FKNLLWI---LMFGAAALSLVAYIYDPSDLTNLCVGIFIIVIIFVMCIVSFFEEKKGVEVVRAFQSLMPLSCQVIRDGVEQTLNPEELVVGDIVVVRSGCKVPADIRVIACTDFYLETSSITGEAEPLEFNSAMADQKTSIFESYNIAFNGSFCVDGEGYGIVIRTGERTVIGQIASMTLDQKEQKCKFQVEIGRFVKFITVMAIIMAVIIFSVGLGINKGHDVIRYF----VTGFLMVIIANVPQGLPTTVTTELTIIARRMAKKNVFLKKLEKIDSVGATTLIASDKTGTLTKNCMTVTDLWYNNSYNSGRPENRRRSTKTRFSITSNPAQSFDAPLSDLLSVVCVCNKARIENTVTVNRPPPNVDSELDMSMYRIQPVKEMTIVGNPSEVALLRYASAMLDA-KELRESFQVVFEIPFNSVRKYHLILATNKNTWNQVDKNDDVEFVVMIKGAPEVLIKNCSTMNINGESKELDLKRMEDFNEAYEAFGDEGCRVIGFAQKKFRARA-STVFSLKSNTV--PMEDWDFLGMSAIMDPPRDDTPKAIKACKAAGIKVYMVTGDHKSTATAIARQIGMIDTEEVSRVDH--NQQIIRRS--NSQDW--AVITGSELPALTQKQWDELLQHR-YIVFARTTPEHKLMIVTESQKRGECVTVTGDGVNDAPALKKADVGVAMGLAGSDVAKQAADIILLDDNFSSIVAGIEEGRLLFDNLRKTIAYTMAHMWPELVPVILNFFFGFPLGLTPVQILSIDLISDIPPAVSLAYEGPEADIMLQPPRK-KDTHLVTKGLITYTYLFMSIFISIGCVCAYLLSYYINGIGPWELAFTASTYFKHGAANFTTAKGVILNEEQQMYMANQAAAAFHISLVLGQAFHLWMCLTRRVSIFAHGLGNIVAIFAVIIDLLLICIFTFVPGVKYIFGSQPPPWQCWLVPIVVGVWIWIFNELRKLGIRKYPKNKFVR 1046          
BLAST of non-gastric H ,K -ATPase alpha subunit vs. Ensembl Fly
Match: Atpalpha (gene:FBgn0002921 transcript:FBtr0089516)

HSP 1 Score: 1523.45 bits (3943), Expect = 0.000e+0
Identity = 754/987 (76.39%), Postives = 857/987 (86.83%), Query Frame = 1
Query:  181 ELDIDSHKISIKDLYIRLQTDPEKGLSIEEAKIRLARDGPNALTPPKTTPEWVKFCRQLFGGFSLLLWIGAALCFLAYAILSGAYEDPPKDNLYLGIVLTAVVVITGCFSYYQEAKSSKIMESFGKMVPQKANVIRDGKILEIAAENLVTGDIIDVKFGDRVPADIRVIQASSFKVDNSALTGESEAQVRSSEFTNDNPLETKNIAFFSTNAVEGTCKGVVISTGDNTVMGRIANLASGLEMGMTPIAKEINHFIHIITGVAVFLGVSFFVIAFILGYFWLDAVIFLIGIIVANVPEGXXXXXXXXXXXXXKKMAKKNCLVKNLEAVETLGSTSTICSDKTGTLTQNRMTVAHMWFDNKIQESDTSENQITSSTKQESETWKMLARVAMLCNRAQFKSGEEEKPVLKRECTGDASESALLKCVELSIGGVTKYRGENKKIVEIPFNSTNKYQVSIHETSDGNQG-YLLAMKGAPERILERCSTILIDGKEMEMDDHWRQEFNNAYLELGGMGERVLGFCDYRLDENNFPRGFDFNPDEVNFPLDGLRFVGLMSMIXXXXXXXXXXXXKCRSAGIKVIMVTGDHPITAKAIAKGVGIISEGNKTVDDIAAERGISPSEVNPRDARACVIHGSDLRDMSSEQLDEVLKHHDEIVFARTSPQQKLIIVEGCQRQGAIVAVTGDGVNDSPALKKADIGVAMGIAGSDVSKQAADMILLDDNFASIVTGVEEGRIIFDNLKKSIAYTLTSNIPEITPFLVFILADVPLPLGTITILCIDLGTDMVPAISLAYEEAESDIMKRKPRDPKHDKLVNERLISMAYGQIGMIQASGGFFVYFVIMAEQGFWPSRLLGLRKEWDSAAVNDLADSYGQEWTFDQRKKLEYTCHTAFFVSIVIVQWTDLMICKTRRNSIFQQGMWNHQMTFGLFFETTLAAFLTYCPGLDVALKMQPLRFTWWLPAIPFSASIFIYDEIRKFLLRKWKNGSWLENETYY 3138
            ELDID HKIS ++LY R QT PE GLS  +AK  L RDGPNALTPPK TPEWVKFC+ LFGGF++LLWIGA LCF+AY+I +   E+P  DNLYLGIVL+AVV++TG FSYYQE+KSSKIMESF  MVPQ A VIR+G+ L + AE+LV GD+++VKFGDR+PADIR+I+A +FKVDNS+LTGESE Q R +EFT++NPLETKN+AFFSTNAVEGT KGVVIS GD+TVMGRIA LASGL+ G TPIAKEI+HFIH+ITGVAVFLGV+FFVIAFILGY WLDAVIFLIGIIVANVPEGLLATVTVCLTLTAK+MA KNCLVKNLEAVETLGSTSTICSDKTGTLTQNRMTVAHMWFDN+I E+DT+E+Q      + S  +K L+R+A LCNRA+FK G++  P+LK+E +GDASE+ALLKC+EL++G V   R  NKKI E+PFNSTNKYQVSIHET D N   YLL MKGAPERILERCSTI I+GKE  +D+  ++ FNNAY+ELGG+GERVLGFCD+ L  + +P GF FN D++NFP+D LRFVGLMSMIDPPRAAVPDAVAKCRSAGIKVIMVTGDHPITAKAIAK VGIISEGN+TV+DIA    I  SEVNPR+A+A V+HG++LRD+SS+QLDE+L++H EIVFARTSPQQKLIIVEGCQR GAIVAVTGDGVNDSPALKKADIGVAMGIAGSDVSKQAADMILLDDNFASIVTGVEEGR+IFDNLKKSIAYTLTSNIPEI+PFL FIL D+PLPLGT+TILCIDLGTDMVPAISLAYE AESDIMKR+PR+P  DKLVNERLISMAYGQIGMIQA+ GFFVYFVIMAE GF P +L G+RK WDS AVNDL DSYGQEWT+  RK LEYTCHTAFF+SIV+VQW DL+ICKTRRNSIFQQGM N  + FGL FET LAAFL+YCPG++  L+M PL+  WW PAIPF+ +IFIYDE R+F LR+   G WLE ETYY
Sbjct:   17 ELDIDFHKISPEELYQRFQTHPENGLSHAKAKENLERDGPNALTPPKQTPEWVKFCKNLFGGFAMLLWIGAILCFVAYSIQASTSEEPADDNLYLGIVLSAVVIVTGIFSYYQESKSSKIMESFKNMVPQFATVIREGEKLTLRAEDLVLGDVVEVKFGDRIPADIRIIEARNFKVDNSSLTGESEPQSRGAEFTHENPLETKNLAFFSTNAVEGTAKGVVISCGDHTVMGRIAGLASGLDTGETPIAKEIHHFIHLITGVAVFLGVTFFVIAFILGYHWLDAVIFLIGIIVANVPEGLLATVTVCLTLTAKRMASKNCLVKNLEAVETLGSTSTICSDKTGTLTQNRMTVAHMWFDNQIIEADTTEDQSGVQYDRTSPGFKALSRIATLCNRAEFKGGQDGVPILKKEVSGDASEAALLKCMELALGDVMNIRKRNKKIAEVPFNSTNKYQVSIHETEDTNDPRYLLVMKGAPERILERCSTIFINGKEKVLDEEMKEAFNNAYMELGGLGERVLGFCDFMLPSDKYPNGFKFNTDDINFPIDNLRFVGLMSMIDPPRAAVPDAVAKCRSAGIKVIMVTGDHPITAKAIAKSVGIISEGNETVEDIAQRLNIPVSEVNPREAKAAVVHGAELRDVSSDQLDEILRYHTEIVFARTSPQQKLIIVEGCQRMGAIVAVTGDGVNDSPALKKADIGVAMGIAGSDVSKQAADMILLDDNFASIVTGVEEGRLIFDNLKKSIAYTLTSNIPEISPFLAFILCDIPLPLGTVTILCIDLGTDMVPAISLAYETAESDIMKRQPRNPFQDKLVNERLISMAYGQIGMIQAAAGFFVYFVIMAENGFLPKKLFGIRKMWDSKAVNDLTDSYGQEWTYRDRKTLEYTCHTAFFISIVVVQWADLIICKTRRNSIFQQGMRNWALNFGLVFETVLAAFLSYCPGMEKGLRMYPLKLVWWFPAIPFALAIFIYDETRRFYLRR-NPGGWLEQETYY 1002          
BLAST of non-gastric H ,K -ATPase alpha subunit vs. Ensembl Fly
Match: Atpalpha (gene:FBgn0002921 transcript:FBtr0089514)

HSP 1 Score: 1523.45 bits (3943), Expect = 0.000e+0
Identity = 754/987 (76.39%), Postives = 857/987 (86.83%), Query Frame = 1
Query:  181 ELDIDSHKISIKDLYIRLQTDPEKGLSIEEAKIRLARDGPNALTPPKTTPEWVKFCRQLFGGFSLLLWIGAALCFLAYAILSGAYEDPPKDNLYLGIVLTAVVVITGCFSYYQEAKSSKIMESFGKMVPQKANVIRDGKILEIAAENLVTGDIIDVKFGDRVPADIRVIQASSFKVDNSALTGESEAQVRSSEFTNDNPLETKNIAFFSTNAVEGTCKGVVISTGDNTVMGRIANLASGLEMGMTPIAKEINHFIHIITGVAVFLGVSFFVIAFILGYFWLDAVIFLIGIIVANVPEGXXXXXXXXXXXXXKKMAKKNCLVKNLEAVETLGSTSTICSDKTGTLTQNRMTVAHMWFDNKIQESDTSENQITSSTKQESETWKMLARVAMLCNRAQFKSGEEEKPVLKRECTGDASESALLKCVELSIGGVTKYRGENKKIVEIPFNSTNKYQVSIHETSDGNQG-YLLAMKGAPERILERCSTILIDGKEMEMDDHWRQEFNNAYLELGGMGERVLGFCDYRLDENNFPRGFDFNPDEVNFPLDGLRFVGLMSMIXXXXXXXXXXXXKCRSAGIKVIMVTGDHPITAKAIAKGVGIISEGNKTVDDIAAERGISPSEVNPRDARACVIHGSDLRDMSSEQLDEVLKHHDEIVFARTSPQQKLIIVEGCQRQGAIVAVTGDGVNDSPALKKADIGVAMGIAGSDVSKQAADMILLDDNFASIVTGVEEGRIIFDNLKKSIAYTLTSNIPEITPFLVFILADVPLPLGTITILCIDLGTDMVPAISLAYEEAESDIMKRKPRDPKHDKLVNERLISMAYGQIGMIQASGGFFVYFVIMAEQGFWPSRLLGLRKEWDSAAVNDLADSYGQEWTFDQRKKLEYTCHTAFFVSIVIVQWTDLMICKTRRNSIFQQGMWNHQMTFGLFFETTLAAFLTYCPGLDVALKMQPLRFTWWLPAIPFSASIFIYDEIRKFLLRKWKNGSWLENETYY 3138
            ELDID HKIS ++LY R QT PE GLS  +AK  L RDGPNALTPPK TPEWVKFC+ LFGGF++LLWIGA LCF+AY+I +   E+P  DNLYLGIVL+AVV++TG FSYYQE+KSSKIMESF  MVPQ A VIR+G+ L + AE+LV GD+++VKFGDR+PADIR+I+A +FKVDNS+LTGESE Q R +EFT++NPLETKN+AFFSTNAVEGT KGVVIS GD+TVMGRIA LASGL+ G TPIAKEI+HFIH+ITGVAVFLGV+FFVIAFILGY WLDAVIFLIGIIVANVPEGLLATVTVCLTLTAK+MA KNCLVKNLEAVETLGSTSTICSDKTGTLTQNRMTVAHMWFDN+I E+DT+E+Q      + S  +K L+R+A LCNRA+FK G++  P+LK+E +GDASE+ALLKC+EL++G V   R  NKKI E+PFNSTNKYQVSIHET D N   YLL MKGAPERILERCSTI I+GKE  +D+  ++ FNNAY+ELGG+GERVLGFCD+ L  + +P GF FN D++NFP+D LRFVGLMSMIDPPRAAVPDAVAKCRSAGIKVIMVTGDHPITAKAIAK VGIISEGN+TV+DIA    I  SEVNPR+A+A V+HG++LRD+SS+QLDE+L++H EIVFARTSPQQKLIIVEGCQR GAIVAVTGDGVNDSPALKKADIGVAMGIAGSDVSKQAADMILLDDNFASIVTGVEEGR+IFDNLKKSIAYTLTSNIPEI+PFL FIL D+PLPLGT+TILCIDLGTDMVPAISLAYE AESDIMKR+PR+P  DKLVNERLISMAYGQIGMIQA+ GFFVYFVIMAE GF P +L G+RK WDS AVNDL DSYGQEWT+  RK LEYTCHTAFF+SIV+VQW DL+ICKTRRNSIFQQGM N  + FGL FET LAAFL+YCPG++  L+M PL+  WW PAIPF+ +IFIYDE R+F LR+   G WLE ETYY
Sbjct:   17 ELDIDFHKISPEELYQRFQTHPENGLSHAKAKENLERDGPNALTPPKQTPEWVKFCKNLFGGFAMLLWIGAILCFVAYSIQASTSEEPADDNLYLGIVLSAVVIVTGIFSYYQESKSSKIMESFKNMVPQFATVIREGEKLTLRAEDLVLGDVVEVKFGDRIPADIRIIEARNFKVDNSSLTGESEPQSRGAEFTHENPLETKNLAFFSTNAVEGTAKGVVISCGDHTVMGRIAGLASGLDTGETPIAKEIHHFIHLITGVAVFLGVTFFVIAFILGYHWLDAVIFLIGIIVANVPEGLLATVTVCLTLTAKRMASKNCLVKNLEAVETLGSTSTICSDKTGTLTQNRMTVAHMWFDNQIIEADTTEDQSGVQYDRTSPGFKALSRIATLCNRAEFKGGQDGVPILKKEVSGDASEAALLKCMELALGDVMNIRKRNKKIAEVPFNSTNKYQVSIHETEDTNDPRYLLVMKGAPERILERCSTIFINGKEKVLDEEMKEAFNNAYMELGGLGERVLGFCDFMLPSDKYPNGFKFNTDDINFPIDNLRFVGLMSMIDPPRAAVPDAVAKCRSAGIKVIMVTGDHPITAKAIAKSVGIISEGNETVEDIAQRLNIPVSEVNPREAKAAVVHGAELRDVSSDQLDEILRYHTEIVFARTSPQQKLIIVEGCQRMGAIVAVTGDGVNDSPALKKADIGVAMGIAGSDVSKQAADMILLDDNFASIVTGVEEGRLIFDNLKKSIAYTLTSNIPEISPFLAFILCDIPLPLGTVTILCIDLGTDMVPAISLAYETAESDIMKRQPRNPFQDKLVNERLISMAYGQIGMIQAAAGFFVYFVIMAENGFLPKKLFGIRKMWDSKAVNDLTDSYGQEWTYRDRKTLEYTCHTAFFISIVVVQWADLIICKTRRNSIFQQGMRNWALNFGLVFETVLAAFLSYCPGMEKGLRMYPLKLVWWFPAIPFALAIFIYDETRRFYLRR-NPGGWLEQETYY 1002          
BLAST of non-gastric H ,K -ATPase alpha subunit vs. Ensembl Fly
Match: Atpalpha (gene:FBgn0002921 transcript:FBtr0089515)

HSP 1 Score: 1521.91 bits (3939), Expect = 0.000e+0
Identity = 752/987 (76.19%), Postives = 856/987 (86.73%), Query Frame = 1
Query:  181 ELDIDSHKISIKDLYIRLQTDPEKGLSIEEAKIRLARDGPNALTPPKTTPEWVKFCRQLFGGFSLLLWIGAALCFLAYAILSGAYEDPPKDNLYLGIVLTAVVVITGCFSYYQEAKSSKIMESFGKMVPQKANVIRDGKILEIAAENLVTGDIIDVKFGDRVPADIRVIQASSFKVDNSALTGESEAQVRSSEFTNDNPLETKNIAFFSTNAVEGTCKGVVISTGDNTVMGRIANLASGLEMGMTPIAKEINHFIHIITGVAVFLGVSFFVIAFILGYFWLDAVIFLIGIIVANVPEGXXXXXXXXXXXXXKKMAKKNCLVKNLEAVETLGSTSTICSDKTGTLTQNRMTVAHMWFDNKIQESDTSENQITSSTKQESETWKMLARVAMLCNRAQFKSGEEEKPVLKRECTGDASESALLKCVELSIGGVTKYRGENKKIVEIPFNSTNKYQVSIHETSDGNQG-YLLAMKGAPERILERCSTILIDGKEMEMDDHWRQEFNNAYLELGGMGERVLGFCDYRLDENNFPRGFDFNPDEVNFPLDGLRFVGLMSMIXXXXXXXXXXXXKCRSAGIKVIMVTGDHPITAKAIAKGVGIISEGNKTVDDIAAERGISPSEVNPRDARACVIHGSDLRDMSSEQLDEVLKHHDEIVFARTSPQQKLIIVEGCQRQGAIVAVTGDGVNDSPALKKADIGVAMGIAGSDVSKQAADMILLDDNFASIVTGVEEGRIIFDNLKKSIAYTLTSNIPEITPFLVFILADVPLPLGTITILCIDLGTDMVPAISLAYEEAESDIMKRKPRDPKHDKLVNERLISMAYGQIGMIQASGGFFVYFVIMAEQGFWPSRLLGLRKEWDSAAVNDLADSYGQEWTFDQRKKLEYTCHTAFFVSIVIVQWTDLMICKTRRNSIFQQGMWNHQMTFGLFFETTLAAFLTYCPGLDVALKMQPLRFTWWLPAIPFSASIFIYDEIRKFLLRKWKNGSWLENETYY 3138
            ELDID HKIS ++LY R QT PE GLS  +AK  L RDGPNALTPPK TPEWVKFC+ LFGGF++LLWIGA LCF+AY+I +   E+P  DNLYLGIVL+AVV++TG FSYYQE+KSSKIMESF  MVPQ A VIR+G+ L + AE+LV GD+++VKFGDR+PADIR+I+A +FKVDNS+LTGESE Q R +EFT++NPLETKN+AFFSTNAVEGT KGVVIS GD+TVMGRIA LASGL+ G TPIAKEI+HFIH+ITGVAVFLGV+FFVIAFILGY WLDAVIFLIGIIVANVPEGLLATVTVCLTLTAK+MA KNCLVKNLEAVETLGSTSTICSDKTGTLTQNRMTVAHMWFDN+I E+DT+E+Q      + S  +K L+R+A LCNRA+FK G++  P+LK+E +GDASE+ALLKC+EL++G V   R  NKKI E+PFNSTNKYQVSIHET D N   YLL MKGAPERILERCSTI I+GKE  +D+  ++ FNNAY+ELGG+GERVLGFCD+ L  + +P GF FN D++NFP+D LRFVGLMSMIDPPRAAVPDAVAKCRSAGIKVIMVTGDHPITAKAIAK VGIISEGN+TV+DIA    I  SEVNPR+A+A V+HG++LRD+SS+QLDE+L++H EIVFARTSPQQKLIIVEGCQR GAIVAVTGDGVNDSPALKKADIGVAMGIAGSDVSKQAADMILLDDNFASIVTGVEEGR+IFDNLKKSIAYTLTSNIPEI+PFL FIL D+PLPLGT+TILCIDLGTDM+PAISLAYE+AESDIMKR+PRDP  D LVN RLISMAYGQIGMIQA+ GFFVYFVIMAE GF P +L G+RK WDS AVNDL DSYGQEWT+  RK LEYTCHTAFF+SIV+VQW DL+ICKTRRNSIFQQGM N  + FGL FET LAAFL+YCPG++  L+M PL+  WW PAIPF+ +IFIYDE R+F LR+   G WLE ETYY
Sbjct:   17 ELDIDFHKISPEELYQRFQTHPENGLSHAKAKENLERDGPNALTPPKQTPEWVKFCKNLFGGFAMLLWIGAILCFVAYSIQASTSEEPADDNLYLGIVLSAVVIVTGIFSYYQESKSSKIMESFKNMVPQFATVIREGEKLTLRAEDLVLGDVVEVKFGDRIPADIRIIEARNFKVDNSSLTGESEPQSRGAEFTHENPLETKNLAFFSTNAVEGTAKGVVISCGDHTVMGRIAGLASGLDTGETPIAKEIHHFIHLITGVAVFLGVTFFVIAFILGYHWLDAVIFLIGIIVANVPEGLLATVTVCLTLTAKRMASKNCLVKNLEAVETLGSTSTICSDKTGTLTQNRMTVAHMWFDNQIIEADTTEDQSGVQYDRTSPGFKALSRIATLCNRAEFKGGQDGVPILKKEVSGDASEAALLKCMELALGDVMNIRKRNKKIAEVPFNSTNKYQVSIHETEDTNDPRYLLVMKGAPERILERCSTIFINGKEKVLDEEMKEAFNNAYMELGGLGERVLGFCDFMLPSDKYPNGFKFNTDDINFPIDNLRFVGLMSMIDPPRAAVPDAVAKCRSAGIKVIMVTGDHPITAKAIAKSVGIISEGNETVEDIAQRLNIPVSEVNPREAKAAVVHGAELRDVSSDQLDEILRYHTEIVFARTSPQQKLIIVEGCQRMGAIVAVTGDGVNDSPALKKADIGVAMGIAGSDVSKQAADMILLDDNFASIVTGVEEGRLIFDNLKKSIAYTLTSNIPEISPFLAFILCDIPLPLGTVTILCIDLGTDMIPAISLAYEQAESDIMKRQPRDPYRDNLVNRRLISMAYGQIGMIQAAAGFFVYFVIMAENGFLPKKLFGIRKMWDSKAVNDLTDSYGQEWTYRDRKTLEYTCHTAFFISIVVVQWADLIICKTRRNSIFQQGMRNWALNFGLVFETVLAAFLSYCPGMEKGLRMYPLKLVWWFPAIPFALAIFIYDETRRFYLRR-NPGGWLEQETYY 1002          
BLAST of non-gastric H ,K -ATPase alpha subunit vs. Ensembl Fly
Match: Atpalpha (gene:FBgn0002921 transcript:FBtr0089510)

HSP 1 Score: 1521.91 bits (3939), Expect = 0.000e+0
Identity = 753/987 (76.29%), Postives = 856/987 (86.73%), Query Frame = 1
Query:  181 ELDIDSHKISIKDLYIRLQTDPEKGLSIEEAKIRLARDGPNALTPPKTTPEWVKFCRQLFGGFSLLLWIGAALCFLAYAILSGAYEDPPKDNLYLGIVLTAVVVITGCFSYYQEAKSSKIMESFGKMVPQKANVIRDGKILEIAAENLVTGDIIDVKFGDRVPADIRVIQASSFKVDNSALTGESEAQVRSSEFTNDNPLETKNIAFFSTNAVEGTCKGVVISTGDNTVMGRIANLASGLEMGMTPIAKEINHFIHIITGVAVFLGVSFFVIAFILGYFWLDAVIFLIGIIVANVPEGXXXXXXXXXXXXXKKMAKKNCLVKNLEAVETLGSTSTICSDKTGTLTQNRMTVAHMWFDNKIQESDTSENQITSSTKQESETWKMLARVAMLCNRAQFKSGEEEKPVLKRECTGDASESALLKCVELSIGGVTKYRGENKKIVEIPFNSTNKYQVSIHETSDGNQG-YLLAMKGAPERILERCSTILIDGKEMEMDDHWRQEFNNAYLELGGMGERVLGFCDYRLDENNFPRGFDFNPDEVNFPLDGLRFVGLMSMIXXXXXXXXXXXXKCRSAGIKVIMVTGDHPITAKAIAKGVGIISEGNKTVDDIAAERGISPSEVNPRDARACVIHGSDLRDMSSEQLDEVLKHHDEIVFARTSPQQKLIIVEGCQRQGAIVAVTGDGVNDSPALKKADIGVAMGIAGSDVSKQAADMILLDDNFASIVTGVEEGRIIFDNLKKSIAYTLTSNIPEITPFLVFILADVPLPLGTITILCIDLGTDMVPAISLAYEEAESDIMKRKPRDPKHDKLVNERLISMAYGQIGMIQASGGFFVYFVIMAEQGFWPSRLLGLRKEWDSAAVNDLADSYGQEWTFDQRKKLEYTCHTAFFVSIVIVQWTDLMICKTRRNSIFQQGMWNHQMTFGLFFETTLAAFLTYCPGLDVALKMQPLRFTWWLPAIPFSASIFIYDEIRKFLLRKWKNGSWLENETYY 3138
            ELDID HKIS ++LY R QT PE GLS  +AK  L RDGPNALTPPK TPEWVKFC+ LFGGF++LLWIGA LCF+AY+I +   E+P  DNLYLGIVL+AVV++TG FSYYQE+KSSKIMESF  MVPQ A VIR+G+ L + AE+LV GD+++VKFGDR+PADIR+I+A +FKVDNS+LTGESE Q R +EFT++NPLETKN+AFFSTNAVEGT KGVVIS GD+TVMGRIA LASGL+ G TPIAKEI+HFIH+ITGVAVFLGV+FFVIAFILGY WLDAVIFLIGIIVANVPEGLLATVTVCLTLTAK+MA KNCLVKNLEAVETLGSTSTICSDKTGTLTQNRMTVAHMWFDN+I E+DT+E+Q      + S  +K L+R+A LCNRA+FK G++  P+LK+E +GDASE+ALLKC+EL++G V   R  NKKI E+PFNSTNKYQVSIHET D N   YLL MKGAPERILERCSTI I+GKE  +D+  ++ FNNAY+ELGG+GERVLGFCD+ L  + +P GF FN D++NFP+D LRFVGLMSMIDPPRAAVPDAVAKCRSAGIKVIMVTGDHPITAKAIAK VGIISEGN+TV+DIA    I  SEVNPR+A+A V+HG++LRD+SS+QLDE+L++H EIVFARTSPQQKLIIVEGCQR GAIVAVTGDGVNDSPALKKADIGVAMGIAGSDVSKQAADMILLDDNFASIVTGVEEGR+IFDNLKKSIAYTLTSNIPEI+PFL FIL D+PLPLGT+TILCIDLGTDMVPAISLAYE AE+DIMKR PRDP +DKLVN RLISMAYGQIGMIQA+ GFFVYFVIMAE GF P +L G+RK WDS AVNDL DSYGQEWT+  RK LEYTCHTAFF+SIV+VQW DL+ICKTRRNSIFQQGM N  + FGL FET LAAFL+YCPG++  L+M PL+  WW PAIPF+ +IFIYDE R+F LR+   G WLE ETYY
Sbjct:   56 ELDIDFHKISPEELYQRFQTHPENGLSHAKAKENLERDGPNALTPPKQTPEWVKFCKNLFGGFAMLLWIGAILCFVAYSIQASTSEEPADDNLYLGIVLSAVVIVTGIFSYYQESKSSKIMESFKNMVPQFATVIREGEKLTLRAEDLVLGDVVEVKFGDRIPADIRIIEARNFKVDNSSLTGESEPQSRGAEFTHENPLETKNLAFFSTNAVEGTAKGVVISCGDHTVMGRIAGLASGLDTGETPIAKEIHHFIHLITGVAVFLGVTFFVIAFILGYHWLDAVIFLIGIIVANVPEGLLATVTVCLTLTAKRMASKNCLVKNLEAVETLGSTSTICSDKTGTLTQNRMTVAHMWFDNQIIEADTTEDQSGVQYDRTSPGFKALSRIATLCNRAEFKGGQDGVPILKKEVSGDASEAALLKCMELALGDVMNIRKRNKKIAEVPFNSTNKYQVSIHETEDTNDPRYLLVMKGAPERILERCSTIFINGKEKVLDEEMKEAFNNAYMELGGLGERVLGFCDFMLPSDKYPNGFKFNTDDINFPIDNLRFVGLMSMIDPPRAAVPDAVAKCRSAGIKVIMVTGDHPITAKAIAKSVGIISEGNETVEDIAQRLNIPVSEVNPREAKAAVVHGAELRDVSSDQLDEILRYHTEIVFARTSPQQKLIIVEGCQRMGAIVAVTGDGVNDSPALKKADIGVAMGIAGSDVSKQAADMILLDDNFASIVTGVEEGRLIFDNLKKSIAYTLTSNIPEISPFLAFILCDIPLPLGTVTILCIDLGTDMVPAISLAYEHAEADIMKRPPRDPFNDKLVNSRLISMAYGQIGMIQAAAGFFVYFVIMAENGFLPKKLFGIRKMWDSKAVNDLTDSYGQEWTYRDRKTLEYTCHTAFFISIVVVQWADLIICKTRRNSIFQQGMRNWALNFGLVFETVLAAFLSYCPGMEKGLRMYPLKLVWWFPAIPFALAIFIYDETRRFYLRR-NPGGWLEQETYY 1041          
BLAST of non-gastric H ,K -ATPase alpha subunit vs. Ensembl Fly
Match: Atpalpha (gene:FBgn0002921 transcript:FBtr0089511)

HSP 1 Score: 1521.52 bits (3938), Expect = 0.000e+0
Identity = 753/987 (76.29%), Postives = 856/987 (86.73%), Query Frame = 1
Query:  181 ELDIDSHKISIKDLYIRLQTDPEKGLSIEEAKIRLARDGPNALTPPKTTPEWVKFCRQLFGGFSLLLWIGAALCFLAYAILSGAYEDPPKDNLYLGIVLTAVVVITGCFSYYQEAKSSKIMESFGKMVPQKANVIRDGKILEIAAENLVTGDIIDVKFGDRVPADIRVIQASSFKVDNSALTGESEAQVRSSEFTNDNPLETKNIAFFSTNAVEGTCKGVVISTGDNTVMGRIANLASGLEMGMTPIAKEINHFIHIITGVAVFLGVSFFVIAFILGYFWLDAVIFLIGIIVANVPEGXXXXXXXXXXXXXKKMAKKNCLVKNLEAVETLGSTSTICSDKTGTLTQNRMTVAHMWFDNKIQESDTSENQITSSTKQESETWKMLARVAMLCNRAQFKSGEEEKPVLKRECTGDASESALLKCVELSIGGVTKYRGENKKIVEIPFNSTNKYQVSIHETSDGNQG-YLLAMKGAPERILERCSTILIDGKEMEMDDHWRQEFNNAYLELGGMGERVLGFCDYRLDENNFPRGFDFNPDEVNFPLDGLRFVGLMSMIXXXXXXXXXXXXKCRSAGIKVIMVTGDHPITAKAIAKGVGIISEGNKTVDDIAAERGISPSEVNPRDARACVIHGSDLRDMSSEQLDEVLKHHDEIVFARTSPQQKLIIVEGCQRQGAIVAVTGDGVNDSPALKKADIGVAMGIAGSDVSKQAADMILLDDNFASIVTGVEEGRIIFDNLKKSIAYTLTSNIPEITPFLVFILADVPLPLGTITILCIDLGTDMVPAISLAYEEAESDIMKRKPRDPKHDKLVNERLISMAYGQIGMIQASGGFFVYFVIMAEQGFWPSRLLGLRKEWDSAAVNDLADSYGQEWTFDQRKKLEYTCHTAFFVSIVIVQWTDLMICKTRRNSIFQQGMWNHQMTFGLFFETTLAAFLTYCPGLDVALKMQPLRFTWWLPAIPFSASIFIYDEIRKFLLRKWKNGSWLENETYY 3138
            ELDID HKIS ++LY R QT PE GLS  +AK  L RDGPNALTPPK TPEWVKFC+ LFGGF++LLWIGA LCF+AY+I +   E+P  DNLYLGIVL+AVV++TG FSYYQE+KSSKIMESF  MVPQ A VIR+G+ L + AE+LV GD+++VKFGDR+PADIR+I+A +FKVDNS+LTGESE Q R +EFT++NPLETKN+AFFSTNAVEGT KGVVIS GD+TVMGRIA LASGL+ G TPIAKEI+HFIH+ITGVAVFLGV+FFVIAFILGY WLDAVIFLIGIIVANVPEGLLATVTVCLTLTAK+MA KNCLVKNLEAVETLGSTSTICSDKTGTLTQNRMTVAHMWFDN+I E+DT+E+Q      + S  +K L+R+A LCNRA+FK G++  P+LK+E +GDASE+ALLKC+EL++G V   R  NKKI E+PFNSTNKYQVSIHET D N   YLL MKGAPERILERCSTI I+GKE  +D+  ++ FNNAY+ELGG+GERVLGFCD+ L  + +P GF FN D++NFP+D LRFVGLMSMIDPPRAAVPDAVAKCRSAGIKVIMVTGDHPITAKAIAK VGIISEGN+TV+DIA    I  SEVNPR+A+A V+HG++LRD+SS+QLDE+L++H EIVFARTSPQQKLIIVEGCQR GAIVAVTGDGVNDSPALKKADIGVAMGIAGSDVSKQAADMILLDDNFASIVTGVEEGR+IFDNLKKSIAYTLTSNIPEI+PFL FIL D+PLPLGT+TILCIDLGTDMVPAISLAYE AE+DIMKR PRDP +DKLVN RLISMAYGQIGMIQA+ GFFVYFVIMAE GF P +L G+RK WDS AVNDL DSYGQEWT+  RK LEYTCHTAFF+SIV+VQW DL+ICKTRRNSIFQQGM N  + FGL FET LAAFL+YCPG++  L+M PL+  WW PAIPF+ +IFIYDE R+F LR+   G WLE ETYY
Sbjct:   17 ELDIDFHKISPEELYQRFQTHPENGLSHAKAKENLERDGPNALTPPKQTPEWVKFCKNLFGGFAMLLWIGAILCFVAYSIQASTSEEPADDNLYLGIVLSAVVIVTGIFSYYQESKSSKIMESFKNMVPQFATVIREGEKLTLRAEDLVLGDVVEVKFGDRIPADIRIIEARNFKVDNSSLTGESEPQSRGAEFTHENPLETKNLAFFSTNAVEGTAKGVVISCGDHTVMGRIAGLASGLDTGETPIAKEIHHFIHLITGVAVFLGVTFFVIAFILGYHWLDAVIFLIGIIVANVPEGLLATVTVCLTLTAKRMASKNCLVKNLEAVETLGSTSTICSDKTGTLTQNRMTVAHMWFDNQIIEADTTEDQSGVQYDRTSPGFKALSRIATLCNRAEFKGGQDGVPILKKEVSGDASEAALLKCMELALGDVMNIRKRNKKIAEVPFNSTNKYQVSIHETEDTNDPRYLLVMKGAPERILERCSTIFINGKEKVLDEEMKEAFNNAYMELGGLGERVLGFCDFMLPSDKYPNGFKFNTDDINFPIDNLRFVGLMSMIDPPRAAVPDAVAKCRSAGIKVIMVTGDHPITAKAIAKSVGIISEGNETVEDIAQRLNIPVSEVNPREAKAAVVHGAELRDVSSDQLDEILRYHTEIVFARTSPQQKLIIVEGCQRMGAIVAVTGDGVNDSPALKKADIGVAMGIAGSDVSKQAADMILLDDNFASIVTGVEEGRLIFDNLKKSIAYTLTSNIPEISPFLAFILCDIPLPLGTVTILCIDLGTDMVPAISLAYEHAEADIMKRPPRDPFNDKLVNSRLISMAYGQIGMIQAAAGFFVYFVIMAENGFLPKKLFGIRKMWDSKAVNDLTDSYGQEWTYRDRKTLEYTCHTAFFISIVVVQWADLIICKTRRNSIFQQGMRNWALNFGLVFETVLAAFLSYCPGMEKGLRMYPLKLVWWFPAIPFALAIFIYDETRRFYLRR-NPGGWLEQETYY 1002          
BLAST of non-gastric H ,K -ATPase alpha subunit vs. Ensembl Zebrafish
Match: atp1a3b (ATPase Na+/K+ transporting subunit alpha 3b [Source:ZFIN;Acc:ZDB-GENE-001212-8])

HSP 1 Score: 1488.78 bits (3853), Expect = 0.000e+0
Identity = 739/987 (74.87%), Postives = 850/987 (86.12%), Query Frame = 1
Query:  181 ELDIDSHKISIKDLYIRLQTDPEKGLSIEEAKIRLARDGPNALTPPKTTPEWVKFCRQLFGGFSLLLWIGAALCFLAYAILSGAYEDPPKDNLYLGIVLTAVVVITGCFSYYQEAKSSKIMESFGKMVPQKANVIRDGKILEIAAENLVTGDIIDVKFGDRVPADIRVIQASSFKVDNSALTGESEAQVRSSEFTNDNPLETKNIAFFSTNAVEGTCKGVVISTGDNTVMGRIANLASGLEMGMTPIAKEINHFIHIITGVAVFLGVSFFVIAFILGYFWLDAVIFLIGIIVANVPEGXXXXXXXXXXXXXKKMAKKNCLVKNLEAVETLGSTSTICSDKTGTLTQNRMTVAHMWFDNKIQESDTSENQITSSTKQESETWKMLARVAMLCNRAQFKSGEEEKPVLKRECTGDASESALLKCVELSIGGVTKYRGENKKIVEIPFNSTNKYQVSIHETSDGNQG-YLLAMKGAPERILERCSTILIDGKEMEMDDHWRQEFNNAYLELGGMGERVLGFCDYRLDENNFPRGFDFNPDEVNFPLDGLRFVGLMSMIXXXXXXXXXXXXKCRSAGIKVIMVTGDHPITAKAIAKGVGIISEGNKTVDDIAAERGISPSEVNPRDARACVIHGSDLRDMSSEQLDEVLKHHDEIVFARTSPQQKLIIVEGCQRQGAIVAVTGDGVNDSPALKKADIGVAMGIAGSDVSKQAADMILLDDNFASIVTGVEEGRIIFDNLKKSIAYTLTSNIPEITPFLVFILADVPLPLGTITILCIDLGTDMVPAISLAYEEAESDIMKRKPRDPKHDKLVNERLISMAYGQIGMIQASGGFFVYFVIMAEQGFWPSRLLGLRKEWDSAAVNDLADSYGQEWTFDQRKKLEYTCHTAFFVSIVIVQWTDLMICKTRRNSIFQQGMWNHQMTFGLFFETTLAAFLTYCPGLDVALKMQPLRFTWWLPAIPFSASIFIYDEIRKFLLRKWKNGSWLENETYY 3138
            E+ +  HK+S++++  + QTD  +GL+  +A+  LARDGPNALTPP TTPEWVKFCRQLFGGFS+LLWIGA LCFLAYAI +   +DP  DNLYLGIVL+AVV+ITGCFSY+QEAKSSKIMESF  MVPQ+A VIR+G+ ++I AE +V GD+++VK GDR+PAD+R+I A   KVDNS+LTGESE Q RS + T+DNPLET+NIAFFSTN VEGT +GVV+ TGD TVMGRIA L SGLE G TPIAKEI HFIHIITGVAVFLGVSFF++A ILGY WL+AVIFLIGIIVANVPEGLLATVTVCLTLTAK+MA+KNCLVKNLEAVETLGSTSTICSDKTGTLTQNRMTVAHMWFDN+I E+DT+E+Q  +S  + S TW  LARVA LCNRA FK+G++  P+LKR+  GDASESALLKC+ELS G V   R +NKK+ EIPFNSTNKYQ+SIHET D N   YLL MKGAPERIL+RCSTI++ GKE  MD+  ++ F NAYLELGG+GERVLGFC   + E+ +P+GF F+ D+VNF  D L FVGLMSMIDPPRAAVPDAV KCRSAGIKVIMVTGDHPITAKAIAKGVGIISEGN+TV+DIAA   I  S+VNPRDA+ACVIHG+DL+D S EQ+DEVL++H EIVFARTSPQQKLIIVEGCQRQGAIVAVTGDGVNDSPALKKADIGVAMGI+GSDVSKQAADMILLDDNFASIVTGVEEGR+IFDNLKKSIAYTLTSNIPEITPFL+FI+ ++PLPLGTITILCIDLGTDMVPAISLAYE AESDIMKR+PR+P  DKLVNERLIS+AYGQIGMIQA GGFF YFVI+AE GF PS L+G+R  WD  A+NDL DSYGQ+WT++QRK +E+TCHTAFFVSIV+VQW D++ICKTRRNS+FQQGM N  + FGLF ET LAAFL+YCPG+DVAL+M PL+ +WW  A P+S  IF+YDE+RK LLR+   G W+E ETYY
Sbjct:   38 EVPLTEHKMSVEEVCRKFQTDIVQGLTNAKARDFLARDGPNALTPPPTTPEWVKFCRQLFGGFSILLWIGAILCFLAYAIQAATEDDPAGDNLYLGIVLSAVVIITGCFSYFQEAKSSKIMESFKNMVPQQALVIREGEKMQINAEEVVAGDLVEVKGGDRIPADLRIISAHGCKVDNSSLTGESEPQTRSPDCTHDNPLETRNIAFFSTNCVEGTARGVVVCTGDRTVMGRIATLTSGLETGKTPIAKEIEHFIHIITGVAVFLGVSFFILAVILGYTWLEAVIFLIGIIVANVPEGLLATVTVCLTLTAKRMARKNCLVKNLEAVETLGSTSTICSDKTGTLTQNRMTVAHMWFDNQIHEADTTEDQSGASFDKSSVTWVALARVAALCNRAVFKAGQDSLPILKRDVAGDASESALLKCIELSSGSVKAMREKNKKVAEIPFNSTNKYQLSIHETEDNNDNRYLLVMKGAPERILDRCSTIMLQGKEQPMDEEMKEAFQNAYLELGGLGERVLGFCHVLMPEDQYPKGFAFDTDDVNFQTDNLCFVGLMSMIDPPRAAVPDAVGKCRSAGIKVIMVTGDHPITAKAIAKGVGIISEGNETVEDIAARLNIPVSQVNPRDAKACVIHGTDLKDYSQEQIDEVLRNHTEIVFARTSPQQKLIIVEGCQRQGAIVAVTGDGVNDSPALKKADIGVAMGISGSDVSKQAADMILLDDNFASIVTGVEEGRLIFDNLKKSIAYTLTSNIPEITPFLLFIIVNIPLPLGTITILCIDLGTDMVPAISLAYEAAESDIMKRQPRNPMRDKLVNERLISIAYGQIGMIQALGGFFAYFVILAENGFLPSLLVGIRLNWDDRAMNDLEDSYGQQWTYEQRKIVEFTCHTAFFVSIVVVQWADVIICKTRRNSVFQQGMKNKILIFGLFEETALAAFLSYCPGMDVALRMYPLKPSWWFCAFPYSFLIFVYDEVRKLLLRR-NPGGWVEKETYY 1023          
BLAST of non-gastric H ,K -ATPase alpha subunit vs. Ensembl Zebrafish
Match: atp1a3b (ATPase Na+/K+ transporting subunit alpha 3b [Source:ZFIN;Acc:ZDB-GENE-001212-8])

HSP 1 Score: 1488.78 bits (3853), Expect = 0.000e+0
Identity = 739/987 (74.87%), Postives = 850/987 (86.12%), Query Frame = 1
Query:  181 ELDIDSHKISIKDLYIRLQTDPEKGLSIEEAKIRLARDGPNALTPPKTTPEWVKFCRQLFGGFSLLLWIGAALCFLAYAILSGAYEDPPKDNLYLGIVLTAVVVITGCFSYYQEAKSSKIMESFGKMVPQKANVIRDGKILEIAAENLVTGDIIDVKFGDRVPADIRVIQASSFKVDNSALTGESEAQVRSSEFTNDNPLETKNIAFFSTNAVEGTCKGVVISTGDNTVMGRIANLASGLEMGMTPIAKEINHFIHIITGVAVFLGVSFFVIAFILGYFWLDAVIFLIGIIVANVPEGXXXXXXXXXXXXXKKMAKKNCLVKNLEAVETLGSTSTICSDKTGTLTQNRMTVAHMWFDNKIQESDTSENQITSSTKQESETWKMLARVAMLCNRAQFKSGEEEKPVLKRECTGDASESALLKCVELSIGGVTKYRGENKKIVEIPFNSTNKYQVSIHETSDGNQG-YLLAMKGAPERILERCSTILIDGKEMEMDDHWRQEFNNAYLELGGMGERVLGFCDYRLDENNFPRGFDFNPDEVNFPLDGLRFVGLMSMIXXXXXXXXXXXXKCRSAGIKVIMVTGDHPITAKAIAKGVGIISEGNKTVDDIAAERGISPSEVNPRDARACVIHGSDLRDMSSEQLDEVLKHHDEIVFARTSPQQKLIIVEGCQRQGAIVAVTGDGVNDSPALKKADIGVAMGIAGSDVSKQAADMILLDDNFASIVTGVEEGRIIFDNLKKSIAYTLTSNIPEITPFLVFILADVPLPLGTITILCIDLGTDMVPAISLAYEEAESDIMKRKPRDPKHDKLVNERLISMAYGQIGMIQASGGFFVYFVIMAEQGFWPSRLLGLRKEWDSAAVNDLADSYGQEWTFDQRKKLEYTCHTAFFVSIVIVQWTDLMICKTRRNSIFQQGMWNHQMTFGLFFETTLAAFLTYCPGLDVALKMQPLRFTWWLPAIPFSASIFIYDEIRKFLLRKWKNGSWLENETYY 3138
            E+ +  HK+S++++  + QTD  +GL+  +A+  LARDGPNALTPP TTPEWVKFCRQLFGGFS+LLWIGA LCFLAYAI +   +DP  DNLYLGIVL+AVV+ITGCFSY+QEAKSSKIMESF  MVPQ+A VIR+G+ ++I AE +V GD+++VK GDR+PAD+R+I A   KVDNS+LTGESE Q RS + T+DNPLET+NIAFFSTN VEGT +GVV+ TGD TVMGRIA L SGLE G TPIAKEI HFIHIITGVAVFLGVSFF++A ILGY WL+AVIFLIGIIVANVPEGLLATVTVCLTLTAK+MA+KNCLVKNLEAVETLGSTSTICSDKTGTLTQNRMTVAHMWFDN+I E+DT+E+Q  +S  + S TW  LARVA LCNRA FK+G++  P+LKR+  GDASESALLKC+ELS G V   R +NKK+ EIPFNSTNKYQ+SIHET D N   YLL MKGAPERIL+RCSTI++ GKE  MD+  ++ F NAYLELGG+GERVLGFC   + E+ +P+GF F+ D+VNF  D L FVGLMSMIDPPRAAVPDAV KCRSAGIKVIMVTGDHPITAKAIAKGVGIISEGN+TV+DIAA   I  S+VNPRDA+ACVIHG+DL+D S EQ+DEVL++H EIVFARTSPQQKLIIVEGCQRQGAIVAVTGDGVNDSPALKKADIGVAMGI+GSDVSKQAADMILLDDNFASIVTGVEEGR+IFDNLKKSIAYTLTSNIPEITPFL+FI+ ++PLPLGTITILCIDLGTDMVPAISLAYE AESDIMKR+PR+P  DKLVNERLIS+AYGQIGMIQA GGFF YFVI+AE GF PS L+G+R  WD  A+NDL DSYGQ+WT++QRK +E+TCHTAFFVSIV+VQW D++ICKTRRNS+FQQGM N  + FGLF ET LAAFL+YCPG+DVAL+M PL+ +WW  A P+S  IF+YDE+RK LLR+   G W+E ETYY
Sbjct:   38 EVPLTEHKMSVEEVCRKFQTDIVQGLTNAKARDFLARDGPNALTPPPTTPEWVKFCRQLFGGFSILLWIGAILCFLAYAIQAATEDDPAGDNLYLGIVLSAVVIITGCFSYFQEAKSSKIMESFKNMVPQQALVIREGEKMQINAEEVVAGDLVEVKGGDRIPADLRIISAHGCKVDNSSLTGESEPQTRSPDCTHDNPLETRNIAFFSTNCVEGTARGVVVCTGDRTVMGRIATLTSGLETGKTPIAKEIEHFIHIITGVAVFLGVSFFILAVILGYTWLEAVIFLIGIIVANVPEGLLATVTVCLTLTAKRMARKNCLVKNLEAVETLGSTSTICSDKTGTLTQNRMTVAHMWFDNQIHEADTTEDQSGASFDKSSVTWVALARVAALCNRAVFKAGQDSLPILKRDVAGDASESALLKCIELSSGSVKAMREKNKKVAEIPFNSTNKYQLSIHETEDNNDNRYLLVMKGAPERILDRCSTIMLQGKEQPMDEEMKEAFQNAYLELGGLGERVLGFCHVLMPEDQYPKGFAFDTDDVNFQTDNLCFVGLMSMIDPPRAAVPDAVGKCRSAGIKVIMVTGDHPITAKAIAKGVGIISEGNETVEDIAARLNIPVSQVNPRDAKACVIHGTDLKDYSQEQIDEVLRNHTEIVFARTSPQQKLIIVEGCQRQGAIVAVTGDGVNDSPALKKADIGVAMGISGSDVSKQAADMILLDDNFASIVTGVEEGRLIFDNLKKSIAYTLTSNIPEITPFLLFIIVNIPLPLGTITILCIDLGTDMVPAISLAYEAAESDIMKRQPRNPMRDKLVNERLISIAYGQIGMIQALGGFFAYFVILAENGFLPSLLVGIRLNWDDRAMNDLEDSYGQQWTYEQRKIVEFTCHTAFFVSIVVVQWADVIICKTRRNSVFQQGMKNKILIFGLFEETALAAFLSYCPGMDVALRMYPLKPSWWFCAFPYSFLIFVYDEVRKLLLRR-NPGGWVEKETYY 1023          
BLAST of non-gastric H ,K -ATPase alpha subunit vs. Ensembl Zebrafish
Match: atp1a2a (ATPase Na+/K+ transporting subunit alpha 2 [Source:ZFIN;Acc:ZDB-GENE-001212-6])

HSP 1 Score: 1467.6 bits (3798), Expect = 0.000e+0
Identity = 724/985 (73.50%), Postives = 841/985 (85.38%), Query Frame = 1
Query:  184 LDIDSHKISIKDLYIRLQTDPEKGLSIEEAKIRLARDGPNALTPPKTTPEWVKFCRQLFGGFSLLLWIGAALCFLAYAILSGAYEDPPKDNLYLGIVLTAVVVITGCFSYYQEAKSSKIMESFGKMVPQKANVIRDGKILEIAAENLVTGDIIDVKFGDRVPADIRVIQASSFKVDNSALTGESEAQVRSSEFTNDNPLETKNIAFFSTNAVEGTCKGVVISTGDNTVMGRIANLASGLEMGMTPIAKEINHFIHIITGVAVFLGVSFFVIAFILGYFWLDAVIFLIGIIVANVPEGXXXXXXXXXXXXXKKMAKKNCLVKNLEAVETLGSTSTICSDKTGTLTQNRMTVAHMWFDNKIQESDTSENQITSSTKQESETWKMLARVAMLCNRAQFKSGEEEKPVLKRECTGDASESALLKCVELSIGGVTKYRGENKKIVEIPFNSTNKYQVSIHETSDGNQGYLLAMKGAPERILERCSTILIDGKEMEMDDHWRQEFNNAYLELGGMGERVLGFCDYRLDENNFPRGFDFNPDEVNFPLDGLRFVGLMSMIXXXXXXXXXXXXKCRSAGIKVIMVTGDHPITAKAIAKGVGIISEGNKTVDDIAAERGISPSEVNPRDARACVIHGSDLRDMSSEQLDEVLKHHDEIVFARTSPQQKLIIVEGCQRQGAIVAVTGDGVNDSPALKKADIGVAMGIAGSDVSKQAADMILLDDNFASIVTGVEEGRIIFDNLKKSIAYTLTSNIPEITPFLVFILADVPLPLGTITILCIDLGTDMVPAISLAYEEAESDIMKRKPRDPKHDKLVNERLISMAYGQIGMIQASGGFFVYFVIMAEQGFWPSRLLGLRKEWDSAAVNDLADSYGQEWTFDQRKKLEYTCHTAFFVSIVIVQWTDLMICKTRRNSIFQQGMWNHQMTFGLFFETTLAAFLTYCPGLDVALKMQPLRFTWWLPAIPFSASIFIYDEIRKFLLRKWKNGSWLENETYY 3138
            + +D HK+++ +L  R   D  +GL+ + A   LARDGPNALTPP TTPEWVKFC+QLFGGFS+LLWIGA LCFLAY+I +   ++P  DNLYLG+VL+AVV+ITGCFSYYQEAKSS+IM+SF  MVPQ+A VIRDG+ L+I AE +V GD++++K GDRVPAD+R+I +S  KVDNS+LTGESE Q RS EFT++NPLET+NI+FFSTN VEGT  G+VI+TGD+TVMGRIA LASGLE+G TPI  EI HFIHIITGVA+FLG+SFF+++ ILGY WL+AVIFLIGIIVANVPEGLLATVTVCLTLTAK+MA+KNCLVKNLEAVETLGSTSTICSDKTGTLTQNRMTVAHMWFDN+I E+DT+E+Q      + S TW  L+RV  LCNRA FK+G+EE P+  R+  GDASESALLKCVE+  G V   R  N+K+ EIPFNSTNKYQ+SIHE  D   G+LL MKGAPERIL+RCSTI+I+G+E  +DD W   F  AY+ELGG+GERVLGFC   L  + FPRGF+F+ D+VNFP++ L F+GL+SMIDPPRAAVPDAV KCRSAGIKVIMVTGDHPITAKAIAKGVGIISEGN+TV+DIA    I  S+VNPR+A+ACV+HGSDL+DMS+E LD++L++H EIVFARTSPQQKLIIVEGCQRQGAIVAVTGDGVNDSPALKKADIGVAMGI GSDVSKQAADMILLDDNFASIVTGVEEGR+IFDNLKKSIAYTLTSNIPEITPFL+FI+A VPLPLGT+TILCIDLGTDMVPAISLAYE AESDIMKR+PR+PK DKLVNERLISMAYGQIGMIQA GGFF YFVIMAE GF P  LLG+R +WD   VNDL D YGQ+WT++QRK +E+TCHT+FFVSIV+VQW DL+ICKTRRNS+FQQGM N  + FGLF ET LAAFL+YCPG+DVAL+M PL+  WW  A P+S  IF+YDEIRKF+LR+   G W+E ETYY
Sbjct:   30 VSLDDHKLTLDELSTRYGVDLARGLTHKRAMEILARDGPNALTPPPTTPEWVKFCKQLFGGFSILLWIGAILCFLAYSIQAATEDEPVNDNLYLGVVLSAVVIITGCFSYYQEAKSSRIMDSFKNMVPQQALVIRDGEKLQINAEEVVQGDLVEIKGGDRVPADLRIISSSGCKVDNSSLTGESEPQTRSPEFTHENPLETRNISFFSTNCVEGTAHGIVIATGDHTVMGRIATLASGLEVGQTPINMEIEHFIHIITGVAIFLGMSFFILSIILGYTWLEAVIFLIGIIVANVPEGLLATVTVCLTLTAKRMARKNCLVKNLEAVETLGSTSTICSDKTGTLTQNRMTVAHMWFDNQIHEADTTEDQSGCDFDKSSPTWFSLSRVGGLCNRAVFKAGQEEIPIRTRDTAGDASESALLKCVEILSGNVETLRENNRKVAEIPFNSTNKYQLSIHELEDSPTGHLLVMKGAPERILDRCSTIMINGEEFPIDDDWMDAFQGAYMELGGLGERVLGFCHLFLSPSQFPRGFEFDCDDVNFPVNQLCFLGLISMIDPPRAAVPDAVGKCRSAGIKVIMVTGDHPITAKAIAKGVGIISEGNETVEDIAERLNIPLSQVNPREAKACVVHGSDLKDMSAEYLDDILRNHTEIVFARTSPQQKLIIVEGCQRQGAIVAVTGDGVNDSPALKKADIGVAMGITGSDVSKQAADMILLDDNFASIVTGVEEGRLIFDNLKKSIAYTLTSNIPEITPFLLFIIASVPLPLGTVTILCIDLGTDMVPAISLAYESAESDIMKRQPRNPKTDKLVNERLISMAYGQIGMIQALGGFFTYFVIMAENGFLPQTLLGIRLDWDDRTVNDLEDGYGQQWTYEQRKIIEFTCHTSFFVSIVVVQWADLIICKTRRNSVFQQGMKNRILIFGLFAETALAAFLSYCPGMDVALRMYPLKIMWWFCAFPYSLLIFVYDEIRKFILRR-NPGGWVEIETYY 1013          
BLAST of non-gastric H ,K -ATPase alpha subunit vs. Ensembl Zebrafish
Match: atp1a3a (ATPase Na+/K+ transporting subunit alpha 3a [Source:ZFIN;Acc:ZDB-GENE-001212-7])

HSP 1 Score: 1467.6 bits (3798), Expect = 0.000e+0
Identity = 732/987 (74.16%), Postives = 843/987 (85.41%), Query Frame = 1
Query:  181 ELDIDSHKISIKDLYIRLQTDPEKGLSIEEAKIRLARDGPNALTPPKTTPEWVKFCRQLFGGFSLLLWIGAALCFLAYAILSGAYEDPPKDNLYLGIVLTAVVVITGCFSYYQEAKSSKIMESFGKMVPQKANVIRDGKILEIAAENLVTGDIIDVKFGDRVPADIRVIQASSFKVDNSALTGESEAQVRSSEFTNDNPLETKNIAFFSTNAVEGTCKGVVISTGDNTVMGRIANLASGLEMGMTPIAKEINHFIHIITGVAVFLGVSFFVIAFILGYFWLDAVIFLIGIIVANVPEGXXXXXXXXXXXXXKKMAKKNCLVKNLEAVETLGSTSTICSDKTGTLTQNRMTVAHMWFDNKIQESDTSENQITSSTKQESETWKMLARVAMLCNRAQFKSGEEEKPVLKRECTGDASESALLKCVELSIGGVTKYRGENKKIVEIPFNSTNKYQVSIHETSDGNQG-YLLAMKGAPERILERCSTILIDGKEMEMDDHWRQEFNNAYLELGGMGERVLGFCDYRLDENNFPRGFDFNPDEVNFPLDGLRFVGLMSMIXXXXXXXXXXXXKCRSAGIKVIMVTGDHPITAKAIAKGVGIISEGNKTVDDIAAERGISPSEVNPRDARACVIHGSDLRDMSSEQLDEVLKHHDEIVFARTSPQQKLIIVEGCQRQGAIVAVTGDGVNDSPALKKADIGVAMGIAGSDVSKQAADMILLDDNFASIVTGVEEGRIIFDNLKKSIAYTLTSNIPEITPFLVFILADVPLPLGTITILCIDLGTDMVPAISLAYEEAESDIMKRKPRDPKHDKLVNERLISMAYGQIGMIQASGGFFVYFVIMAEQGFWPSRLLGLRKEWDSAAVNDLADSYGQEWTFDQRKKLEYTCHTAFFVSIVIVQWTDLMICKTRRNSIFQQGMWNHQMTFGLFFETTLAAFLTYCPGLDVALKMQPLRFTWWLPAIPFSASIFIYDEIRKFLLRKWKNGSWLENETYY 3138
            E+ +  HK+SI+++  +  TD  +GL+   A   LARDGPNALTPP TTPEWVKFCRQLFGGFS+LLWIGA LCFLAYAI +   ++P  DNLYLGIVL+AVV+ITGCFSY+QEAKSSKIMESF  MVPQ+A VIR+G+ L+I AE +V GD+++VK GDR+PAD+R+I A   KVDNS+LTGESE Q RS + T+DNPLET+NIAFFSTN VEGT +G+V+ TGD TVMGRIA L SGLE G TPIAKEI HFIHIITGVAVFLGV+FF+++ ILGY WL+AVIFLIGIIVANVPEGLLATVTVCLTLTAK+MA+KNCLVKNLEAVETLGSTSTICSDKTGTLTQNRMTVAHMWFDN+I E+DT+E+Q  +S  + S TW  LARVA LCNRA FK+G+E  P+LKR+  GDASESALLKC+ELS G V   R +NKK+ EIPFNSTNKYQ+S+HE  +  +  YLL MKGAPERIL+RCSTIL  GKE  MD+  ++ F NAYLELGG+GERVLGFC   +  + +P+GF F+ D++NF  D L FVGLMSMIDPPRAAVPDAV KCRSAGIKVIMVTGDHPITAKAIAKGVGIISEGN+TV+DIAA   I  S+VNPRDA+ACVIHG+DL+D+S +Q+DEVLK+H EIVFARTSPQQKLIIVEGCQRQGAIVAVTGDGVNDSPALKKADIGVAMGI+GSDVSKQAADMILLDDNFASIVTGVEEGR+IFDNLKKSIAYTLTSNIPEITPFL FIL ++PLPLGTITILCIDLGTDMVPAISLAYE AESDIMKR+PR+P  DKLVNERLIS+AYGQIGMIQA GGFF YFVI+AE GF PS L+G+R  WD  + NDL DSYGQ+WT++QRK +E+TCHTAFFVSIV+VQW D++ICKTRRNS+FQQGM N  + FGLF ET LAAFL+YCPG+DVAL+M PL+ +WW  A P+S  IF+YDEIRK +LR+   G W+E ETYY
Sbjct:   38 EVPLTEHKMSIEEVCRKYNTDIVQGLTNARAAEYLARDGPNALTPPPTTPEWVKFCRQLFGGFSILLWIGAILCFLAYAIQAATEDEPAGDNLYLGIVLSAVVIITGCFSYFQEAKSSKIMESFKNMVPQQALVIREGEKLQINAEEVVGGDLVEVKGGDRIPADLRIISAHGCKVDNSSLTGESEPQTRSPDCTHDNPLETRNIAFFSTNCVEGTARGIVVCTGDRTVMGRIATLTSGLETGKTPIAKEIEHFIHIITGVAVFLGVTFFILSIILGYSWLEAVIFLIGIIVANVPEGLLATVTVCLTLTAKRMARKNCLVKNLEAVETLGSTSTICSDKTGTLTQNRMTVAHMWFDNQIHEADTTEDQSGASFDKSSGTWLALARVAALCNRAVFKAGQESLPILKRDVAGDASESALLKCIELSCGSVKAMRDKNKKVAEIPFNSTNKYQLSVHELDESEENHYLLVMKGAPERILDRCSTILQQGKEQPMDEELKEAFQNAYLELGGLGERVLGFCHLVMPGDKYPKGFAFDTDDINFQTDNLCFVGLMSMIDPPRAAVPDAVGKCRSAGIKVIMVTGDHPITAKAIAKGVGIISEGNETVEDIAARLNIPVSQVNPRDAKACVIHGTDLKDLSQDQMDEVLKNHTEIVFARTSPQQKLIIVEGCQRQGAIVAVTGDGVNDSPALKKADIGVAMGISGSDVSKQAADMILLDDNFASIVTGVEEGRLIFDNLKKSIAYTLTSNIPEITPFLFFILVNIPLPLGTITILCIDLGTDMVPAISLAYEAAESDIMKRQPRNPLRDKLVNERLISIAYGQIGMIQALGGFFSYFVILAENGFLPSVLVGIRLNWDDRSNNDLEDSYGQQWTYEQRKIVEFTCHTAFFVSIVVVQWADVIICKTRRNSVFQQGMKNKILIFGLFEETALAAFLSYCPGMDVALRMYPLKPSWWFCAFPYSFLIFVYDEIRKLILRR-NPGGWVEKETYY 1023          
BLAST of non-gastric H ,K -ATPase alpha subunit vs. Ensembl Zebrafish
Match: atp1a2a (ATPase Na+/K+ transporting subunit alpha 2 [Source:ZFIN;Acc:ZDB-GENE-001212-6])

HSP 1 Score: 1467.6 bits (3798), Expect = 0.000e+0
Identity = 724/985 (73.50%), Postives = 841/985 (85.38%), Query Frame = 1
Query:  184 LDIDSHKISIKDLYIRLQTDPEKGLSIEEAKIRLARDGPNALTPPKTTPEWVKFCRQLFGGFSLLLWIGAALCFLAYAILSGAYEDPPKDNLYLGIVLTAVVVITGCFSYYQEAKSSKIMESFGKMVPQKANVIRDGKILEIAAENLVTGDIIDVKFGDRVPADIRVIQASSFKVDNSALTGESEAQVRSSEFTNDNPLETKNIAFFSTNAVEGTCKGVVISTGDNTVMGRIANLASGLEMGMTPIAKEINHFIHIITGVAVFLGVSFFVIAFILGYFWLDAVIFLIGIIVANVPEGXXXXXXXXXXXXXKKMAKKNCLVKNLEAVETLGSTSTICSDKTGTLTQNRMTVAHMWFDNKIQESDTSENQITSSTKQESETWKMLARVAMLCNRAQFKSGEEEKPVLKRECTGDASESALLKCVELSIGGVTKYRGENKKIVEIPFNSTNKYQVSIHETSDGNQGYLLAMKGAPERILERCSTILIDGKEMEMDDHWRQEFNNAYLELGGMGERVLGFCDYRLDENNFPRGFDFNPDEVNFPLDGLRFVGLMSMIXXXXXXXXXXXXKCRSAGIKVIMVTGDHPITAKAIAKGVGIISEGNKTVDDIAAERGISPSEVNPRDARACVIHGSDLRDMSSEQLDEVLKHHDEIVFARTSPQQKLIIVEGCQRQGAIVAVTGDGVNDSPALKKADIGVAMGIAGSDVSKQAADMILLDDNFASIVTGVEEGRIIFDNLKKSIAYTLTSNIPEITPFLVFILADVPLPLGTITILCIDLGTDMVPAISLAYEEAESDIMKRKPRDPKHDKLVNERLISMAYGQIGMIQASGGFFVYFVIMAEQGFWPSRLLGLRKEWDSAAVNDLADSYGQEWTFDQRKKLEYTCHTAFFVSIVIVQWTDLMICKTRRNSIFQQGMWNHQMTFGLFFETTLAAFLTYCPGLDVALKMQPLRFTWWLPAIPFSASIFIYDEIRKFLLRKWKNGSWLENETYY 3138
            + +D HK+++ +L  R   D  +GL+ + A   LARDGPNALTPP TTPEWVKFC+QLFGGFS+LLWIGA LCFLAY+I +   ++P  DNLYLG+VL+AVV+ITGCFSYYQEAKSS+IM+SF  MVPQ+A VIRDG+ L+I AE +V GD++++K GDRVPAD+R+I +S  KVDNS+LTGESE Q RS EFT++NPLET+NI+FFSTN VEGT  G+VI+TGD+TVMGRIA LASGLE+G TPI  EI HFIHIITGVA+FLG+SFF+++ ILGY WL+AVIFLIGIIVANVPEGLLATVTVCLTLTAK+MA+KNCLVKNLEAVETLGSTSTICSDKTGTLTQNRMTVAHMWFDN+I E+DT+E+Q      + S TW  L+RV  LCNRA FK+G+EE P+  R+  GDASESALLKCVE+  G V   R  N+K+ EIPFNSTNKYQ+SIHE  D   G+LL MKGAPERIL+RCSTI+I+G+E  +DD W   F  AY+ELGG+GERVLGFC   L  + FPRGF+F+ D+VNFP++ L F+GL+SMIDPPRAAVPDAV KCRSAGIKVIMVTGDHPITAKAIAKGVGIISEGN+TV+DIA    I  S+VNPR+A+ACV+HGSDL+DMS+E LD++L++H EIVFARTSPQQKLIIVEGCQRQGAIVAVTGDGVNDSPALKKADIGVAMGI GSDVSKQAADMILLDDNFASIVTGVEEGR+IFDNLKKSIAYTLTSNIPEITPFL+FI+A VPLPLGT+TILCIDLGTDMVPAISLAYE AESDIMKR+PR+PK DKLVNERLISMAYGQIGMIQA GGFF YFVIMAE GF P  LLG+R +WD   VNDL D YGQ+WT++QRK +E+TCHT+FFVSIV+VQW DL+ICKTRRNS+FQQGM N  + FGLF ET LAAFL+YCPG+DVAL+M PL+  WW  A P+S  IF+YDEIRKF+LR+   G W+E ETYY
Sbjct:   34 VSLDDHKLTLDELSTRYGVDLARGLTHKRAMEILARDGPNALTPPPTTPEWVKFCKQLFGGFSILLWIGAILCFLAYSIQAATEDEPVNDNLYLGVVLSAVVIITGCFSYYQEAKSSRIMDSFKNMVPQQALVIRDGEKLQINAEEVVQGDLVEIKGGDRVPADLRIISSSGCKVDNSSLTGESEPQTRSPEFTHENPLETRNISFFSTNCVEGTAHGIVIATGDHTVMGRIATLASGLEVGQTPINMEIEHFIHIITGVAIFLGMSFFILSIILGYTWLEAVIFLIGIIVANVPEGLLATVTVCLTLTAKRMARKNCLVKNLEAVETLGSTSTICSDKTGTLTQNRMTVAHMWFDNQIHEADTTEDQSGCDFDKSSPTWFSLSRVGGLCNRAVFKAGQEEIPIRTRDTAGDASESALLKCVEILSGNVETLRENNRKVAEIPFNSTNKYQLSIHELEDSPTGHLLVMKGAPERILDRCSTIMINGEEFPIDDDWMDAFQGAYMELGGLGERVLGFCHLFLSPSQFPRGFEFDCDDVNFPVNQLCFLGLISMIDPPRAAVPDAVGKCRSAGIKVIMVTGDHPITAKAIAKGVGIISEGNETVEDIAERLNIPLSQVNPREAKACVVHGSDLKDMSAEYLDDILRNHTEIVFARTSPQQKLIIVEGCQRQGAIVAVTGDGVNDSPALKKADIGVAMGITGSDVSKQAADMILLDDNFASIVTGVEEGRLIFDNLKKSIAYTLTSNIPEITPFLLFIIASVPLPLGTVTILCIDLGTDMVPAISLAYESAESDIMKRQPRNPKTDKLVNERLISMAYGQIGMIQALGGFFTYFVIMAENGFLPQTLLGIRLDWDDRTVNDLEDGYGQQWTYEQRKIIEFTCHTSFFVSIVVVQWADLIICKTRRNSVFQQGMKNRILIFGLFAETALAAFLSYCPGMDVALRMYPLKIMWWFCAFPYSLLIFVYDEIRKFILRR-NPGGWVEIETYY 1017          
BLAST of non-gastric H ,K -ATPase alpha subunit vs. Ensembl Xenopus
Match: naif1 (nuclear apoptosis inducing factor 1 [Source:Xenbase;Acc:XB-GENE-986890])

HSP 1 Score: 1471.83 bits (3809), Expect = 0.000e+0
Identity = 733/990 (74.04%), Postives = 848/990 (85.66%), Query Frame = 1
Query:  199 HKISIKDLYIRLQTDPEKGLSIEEAKIRLARDGPNALTPPKTTPEWVKFCRQLFGGFSLLLWIGAALCFLAYAILSGAYEDPPKDNLYLGIVLTAVVVITGCFSYYQEAKSSKIMESFGKMVPQKANVIRDGKILEIAAENLVTGDIIDVKFGDRVPADIRVIQASSFKVDNSALTGESEAQVRSSEFTNDNPLETKNIAFFSTNAVEGTCKGVVISTGDNTVMGRIANLASGLEMGMTPIAKEINHFIHIITGVAVFLGVSFFVIAFILGYFWLDAVIFLIGIIVANVPEGXXXXXXXXXXXXXKKMAKKNCLVKNLEAVETLGSTSTICSDKTGTLTQNRMTVAHMWFDNKIQESDTSENQIT---------SSTKQESETWKMLARVAMLCNRAQFKSGEEEKPVLKRECTGDASESALLKCVELSIGGVTKYRGENKKIVEIPFNSTNKYQVSIHETSDGNQG-YLLAMKGAPERILERCSTILIDGKEMEMDDHWRQEFNNAYLELGGMGERVLGFCDYRLDENNFPRGFDFNPDEVNFPLDGLRFVGLMSMIXXXXXXXXXXXXKCRSAGIKVIMVTGDHPITAKAIAKGVGIISEGNKTVDDIAAERGISPSEVNPRDARACVIHGSDLRDMSSEQLDEVLKHHDEIVFARTSPQQKLIIVEGCQRQGAIVAVTGDGVNDSPALKKADIGVAMGIAGSDVSKQAADMILLDDNFASIVTGVEEGRIIFDNLKKSIAYTLTSNIPEITPFLVFILADVPLPLGTITILCIDLGTDMVPAISLAYEEAESDIMKRKPRDPKHDKLVNERLISMAYGQIGMIQASGGFFVYFVIMAEQGFWPSRLLGLRKEWDSAAVNDLADSYGQEWTFDQRKKLEYTCHTAFFVSIVIVQWTDLMICKTRRNSIFQQGMWNHQMTFGLFFETTLAAFLTYCPGLDVALKMQPLRFTWWLPAIPFSASIFIYDEIRKFLLRKWKNGSWLENETYY 3138
            HKI+++++  +L TD  +GL++ +A   LARDGPNALTPP TTPEW+KFCRQLFGGFS+LLWIGA LCF AY IL+   E+P  DNLYLGIVL AVV+ITGCFSYYQEAKSSKIMESF  MVPQ+A VIR+G+ +++ AE +V GD+++VK GDRVPAD+R+I +   KVDNS+LTGESE Q RS + T++NPLET+NIAFFSTN VEGT +G+V++TGD TVMGRIA LASGLE+G TPIAKEI HFIH+ITGVAVFLGV+FFV++ ILGY WL+AVIFLIGIIVANVPEGLLATVTVCLTLTAK+MA+KNCLVKNLEAVETLGSTSTICSDKTGTLTQNRMTVAHMWFDN+I E+DT+E+Q           SS  + S TW  LAR+A LCNRA FK+G +  PVLKR+  GDASESALLKC+ELS G V   R ++KK+ EIPFNSTNKYQ+SIHET D N   YLL MKGAPERIL+ CSTILI GKE  +DD  ++ F NAYLELGG+GERVLGFC Y   E   P+GF F+ +++NF  + L FVGLMSMIDPPRAAVPDAV KCRSAGIKVIMVTGDHPITAKAIAKGVGIISEGN+TV+DIAA   I  S+VNPRDA+ACVIHG+DL+DMS+EQ+DE+L++H EIVFARTSPQQKLIIVEGCQRQGAIVAVTGDGVNDSPALKKADIGVAMGIAGSDVSKQAADMILLDDNFASIVTGVEEGR+IFDNLKKSIAYTLTSNIPEITPFL+FI+A++PLPLGTITILCIDLGTDMVPAISLAYE AESDIMKR+PR+P+ DKLVNERLISMAYGQIGMIQA GGFF YFVI+AE GF PS L+G+R  WD  +VNDL DSYGQ+WT++QRK +E+TCHTAFFVSIV+VQW D++ICKTRRNS+FQQGM N  + FGLF ET LAAFL+YCPG+D+AL+M PL+ +WW  A P+S  IF+YDEIRK +LR+   G W+E E+YY
Sbjct:    4 HKITVEEVCRKLNTDCVQGLTLSKAAEILARDGPNALTPPPTTPEWIKFCRQLFGGFSILLWIGAILCFFAYGILASMEEEPSGDNLYLGIVLAAVVIITGCFSYYQEAKSSKIMESFKNMVPQQALVIREGEKMQLNAEEVVVGDLVEVKGGDRVPADLRIISSHGCKVDNSSLTGESEPQTRSPDCTHENPLETRNIAFFSTNCVEGTARGIVVATGDRTVMGRIATLASGLEVGKTPIAKEIEHFIHLITGVAVFLGVTFFVLSLILGYTWLEAVIFLIGIIVANVPEGLLATVTVCLTLTAKRMARKNCLVKNLEAVETLGSTSTICSDKTGTLTQNRMTVAHMWFDNQIHEADTTEDQSAHSYPYYFSISSFDKSSPTWLGLARIAALCNRAVFKAGNDNIPVLKRDVAGDASESALLKCIELSCGSVKAMREKSKKVAEIPFNSTNKYQLSIHETEDPNDNRYLLVMKGAPERILDVCSTILIQGKEQPLDDELKEAFQNAYLELGGLGERVLGFCHYYFPEELHPKGFAFDTEDLNFSTENLCFVGLMSMIDPPRAAVPDAVGKCRSAGIKVIMVTGDHPITAKAIAKGVGIISEGNETVEDIAARLNIPVSQVNPRDAKACVIHGTDLKDMSTEQIDEILQNHTEIVFARTSPQQKLIIVEGCQRQGAIVAVTGDGVNDSPALKKADIGVAMGIAGSDVSKQAADMILLDDNFASIVTGVEEGRLIFDNLKKSIAYTLTSNIPEITPFLLFIMANIPLPLGTITILCIDLGTDMVPAISLAYEAAESDIMKRQPRNPRTDKLVNERLISMAYGQIGMIQALGGFFSYFVILAENGFLPSHLIGIRLTWDDRSVNDLEDSYGQQWTYEQRKIVEFTCHTAFFVSIVVVQWADVIICKTRRNSVFQQGMKNKILIFGLFEETALAAFLSYCPGMDIALRMYPLKPSWWFCAFPYSFLIFVYDEIRKLILRR-HPGGWVEKESYY 992          
BLAST of non-gastric H ,K -ATPase alpha subunit vs. Ensembl Xenopus
Match: cdk2 (cyclin-dependent kinase 2 [Source:Xenbase;Acc:XB-GENE-1001990])

HSP 1 Score: 1462.59 bits (3785), Expect = 0.000e+0
Identity = 726/986 (73.63%), Postives = 841/986 (85.29%), Query Frame = 1
Query:  181 ELDIDSHKISIKDLYIRLQTDPEKGLSIEEAKIRLARDGPNALTPPKTTPEWVKFCRQLFGGFSLLLWIGAALCFLAYAILSGAYEDPPKDNLYLGIVLTAVVVITGCFSYYQEAKSSKIMESFGKMVPQKANVIRDGKILEIAAENLVTGDIIDVKFGDRVPADIRVIQASSFKVDNSALTGESEAQVRSSEFTNDNPLETKNIAFFSTNAVEGTCKGVVISTGDNTVMGRIANLASGLEMGMTPIAKEINHFIHIITGVAVFLGVSFFVIAFILGYFWLDAVIFLIGIIVANVPEGXXXXXXXXXXXXXKKMAKKNCLVKNLEAVETLGSTSTICSDKTGTLTQNRMTVAHMWFDNKIQESDTSENQITSSTKQESETWKMLARVAMLCNRAQFKSGEEEKPVLKRECTGDASESALLKCVELSIGGVTKYRGENKKIVEIPFNSTNKYQVSIHETSDGNQGYLLAMKGAPERILERCSTILIDGKEMEMDDHWRQEFNNAYLELGGMGERVLGFCDYRLDENNFPRGFDFNPDEVNFPLDGLRFVGLMSMIXXXXXXXXXXXXKCRSAGIKVIMVTGDHPITAKAIAKGVGIISEGNKTVDDIAAERGISPSEVNPRDARACVIHGSDLRDMSSEQLDEVLKHHDEIVFARTSPQQKLIIVEGCQRQGAIVAVTGDGVNDSPALKKADIGVAMGIAGSDVSKQAADMILLDDNFASIVTGVEEGRIIFDNLKKSIAYTLTSNIPEITPFLVFILADVPLPLGTITILCIDLGTDMVPAISLAYEEAESDIMKRKPRDPKHDKLVNERLISMAYGQIGMIQASGGFFVYFVIMAEQGFWPSRLLGLRKEWDSAAVNDLADSYGQEWTFDQRKKLEYTCHTAFFVSIVIVQWTDLMICKTRRNSIFQQGMWNHQMTFGLFFETTLAAFLTYCPGLDVALKMQPLRFTWWLPAIPFSASIFIYDEIRKFLLRKWKNGSWLENETYY 3138
            E+ +D HK+S++++  +  TD  KGL+   A   LA+DGPNALTPP TTPEWVKFCRQLFGGFS+LLWIGA LCFLAY I     ++P  DNLYLG+VL AVV++TGCFSYYQEAKSSKIM+SF  MVPQ+A VIR+G+ L+I AE +V GD++++K GDRVPADIR+I A   KVDNS+LTGESE Q RS EFT++NPLET+NI FFSTN VEGT +G+VI+TGD TVMGRIA LASGLE+G TPIA EI HFIHIITGVAVFLGVSFFV++ ILGY WL+AVIFLIGIIVANVPEGLLATVTVCLTLTAK+MA+KNCLVKNLEAVETLGSTSTICSDKTGTLTQNRMTVAHMWFDN+I E+DT+E+Q  ++  + S TW  L+R+A LCNRA FK G+E+  V KR+  GDASESALLKC+ELS G V K R  N K+ EIPFNSTNK+Q+SIHE  D  +G+LL MKGAPERIL+RCSTI++ G E  +D+  +  F NAY ELGG+GERVLGFC   +  + F RGF F+ DE NFPL  L F+GL+SMIDPPRAAVPDAV KCRSAGIKVIMVTGDHPITAKAIAKGVGIISEGN+TV+DIA    I  ++VNPR+A+ACV+HGSDL+DM+SEQLD++LK+H EIVFARTSPQQKLIIVEGCQRQGAIVAVTGDGVNDSPALKKADIGVAMGIAGSDVSKQAADMILLDDNFASIVTGVEEGR+IFDNLKKSIAYTLTSNIPEITPFL+FI+A++PLPLGT+TILCIDLGTDMVPAISLAYE AESDIMKR+PR+P+ DKLVNERLISMAYGQIGMIQA GGFF YFVI+AE GF PSRLLG+R +WD  + ND+ DSYGQEWT++QRK +E+TCHTAFF SIV+VQW DL+ICKTRRNS+FQQGM N  + FGL  ET LAAFL+YCPG+DVAL+M PL+ TWW  A P+S  IF+YDE+RK +LR+   G W+E E+YY
Sbjct:   36 EVAMDDHKLSMEEIGRKYGTDLAKGLTNARAAEVLAQDGPNALTPPPTTPEWVKFCRQLFGGFSILLWIGAILCFLAYGIQIAMEDEPINDNLYLGVVLAAVVIVTGCFSYYQEAKSSKIMDSFKNMVPQQALVIREGEKLQINAEMVVVGDLVEIKGGDRVPADIRIIIAHGCKVDNSSLTGESEPQTRSPEFTHENPLETRNICFFSTNCVEGTGRGIVINTGDRTVMGRIATLASGLEVGRTPIAMEIEHFIHIITGVAVFLGVSFFVLSLILGYSWLEAVIFLIGIIVANVPEGLLATVTVCLTLTAKRMARKNCLVKNLEAVETLGSTSTICSDKTGTLTQNRMTVAHMWFDNQIHEADTTEDQSGTTFDKRSPTWTALSRIAGLCNRAVFKVGQEKVAVSKRDTAGDASESALLKCIELSCGSVRKLRDRNPKVAEIPFNSTNKFQLSIHEREDSPEGHLLVMKGAPERILDRCSTIMLHGAEQPLDEEMKDAFQNAYFELGGLGERVLGFCHLYIPADKFQRGFKFDTDEPNFPLTDLCFIGLISMIDPPRAAVPDAVGKCRSAGIKVIMVTGDHPITAKAIAKGVGIISEGNETVEDIADRLNIPVNQVNPREAKACVVHGSDLKDMTSEQLDDLLKNHTEIVFARTSPQQKLIIVEGCQRQGAIVAVTGDGVNDSPALKKADIGVAMGIAGSDVSKQAADMILLDDNFASIVTGVEEGRLIFDNLKKSIAYTLTSNIPEITPFLLFIIANIPLPLGTVTILCIDLGTDMVPAISLAYEAAESDIMKRQPRNPRTDKLVNERLISMAYGQIGMIQALGGFFTYFVILAENGFLPSRLLGIRLDWDDRSNNDVEDSYGQEWTYEQRKVVEFTCHTAFFASIVVVQWADLIICKTRRNSVFQQGMKNKILIFGLLEETALAAFLSYCPGMDVALRMYPLKVTWWFCAFPYSLLIFLYDEVRKLILRR-DPGGWVEKESYY 1020          
BLAST of non-gastric H ,K -ATPase alpha subunit vs. Ensembl Xenopus
Match: rab8b (RAB8B, member RAS oncogene family [Source:Xenbase;Acc:XB-GENE-480278])

HSP 1 Score: 1461.82 bits (3783), Expect = 0.000e+0
Identity = 732/987 (74.16%), Postives = 848/987 (85.92%), Query Frame = 1
Query:  181 ELDIDSHKISIKDLYIRLQTDPEKGLSIEEAKIRLARDGPNALTPPKTTPEWVKFCRQLFGGFSLLLWIGAALCFLAYAILSGAYEDPPKDNLYLGIVLTAVVVITGCFSYYQEAKSSKIMESFGKMVPQKANVIRDGKILEIAAENLVTGDIIDVKFGDRVPADIRVIQASSFKVDNSALTGESEAQVRSSEFTNDNPLETKNIAFFSTNAVEGTCKGVVISTGDNTVMGRIANLASGLEMGMTPIAKEINHFIHIITGVAVFLGVSFFVIAFILGYFWLDAVIFLIGIIVANVPEGXXXXXXXXXXXXXKKMAKKNCLVKNLEAVETLGSTSTICSDKTGTLTQNRMTVAHMWFDNKIQESDTSENQITSSTKQESETWKMLARVAMLCNRAQFKSGEEEKPVLKRECTGDASESALLKCVELSIGGVTKYRGENKKIVEIPFNSTNKYQVSIHETSDGNQG-YLLAMKGAPERILERCSTILIDGKEMEMDDHWRQEFNNAYLELGGMGERVLGFCDYRLDENNFPRGFDFNPDEVNFPLDGLRFVGLMSMIXXXXXXXXXXXXKCRSAGIKVIMVTGDHPITAKAIAKGVGIISEGNKTVDDIAAERGISPSEVNPRDARACVIHGSDLRDMSSEQLDEVLKHHDEIVFARTSPQQKLIIVEGCQRQGAIVAVTGDGVNDSPALKKADIGVAMGIAGSDVSKQAADMILLDDNFASIVTGVEEGRIIFDNLKKSIAYTLTSNIPEITPFLVFILADVPLPLGTITILCIDLGTDMVPAISLAYEEAESDIMKRKPRDPKHDKLVNERLISMAYGQIGMIQASGGFFVYFVIMAEQGFWPSRLLGLRKEWDSAAVNDLADSYGQEWTFDQRKKLEYTCHTAFFVSIVIVQWTDLMICKTRRNSIFQQGMWNHQMTFGLFFETTLAAFLTYCPGLDVALKMQPLRFTWWLPAIPFSASIFIYDEIRKFLLRKWKNGSWLENETYY 3138
            EL ++ HK+S+ +L+ +  TD ++GLS   A   LARDGPNALTPP TTPEWVKFCRQLFGGFS+LLWIGA LCFLAY I +   E+P  DNLYLG+VL+AVV+ITGCFSYYQEAKSSKIMESF  MVPQ+A VIR+G+ L I AE++V GD+++VK GDR+PAD+R+I A   KVDNS+LTGESE Q RS +FTN+NPLET+NIAFFSTN VEGT +GVV++TGD TVMGRIA LASGLE G TPIA EI HFIHIITGVAVFLGVSFF+++ IL Y WL+AVIFLIGIIVANVPEGLLATVTVCLTLTAK+MA+KNCLVKNLEAVETLGSTSTICSDKTGTLTQNRMTVAHMWFDN+I E+DT+ENQ  +S  + S TW  L+RVA LCNRA F++G+E  P+LKR+  GDASESALLKC+EL  G V   R +N K+ EIPFNSTNKYQ+S+H+ ++ ++  Y+L MKGAPERIL+RCSTI++ GKE  +D+  +  F NAYLELGG+GERVLGFC   L ++ FP GF F+ +EVNFP + L FVGL+SMIDPPRAAVPDAV KCRSAGIKVIMVTGDHPITAKAIAKGVGIISEGN+TV+DIAA   I  ++VNPRDA+ACVIHGSDL+DM+ EQ+D++LKHH EIVFARTSPQQKLIIVEGCQRQGAIVAVTGDGVNDSPALKKADIG+AMGIAGSDVSKQAADMILLDDNFASIVTGVEEGR+IFDNLKKSIAYTLTSNIPEITPFL+FI+A++PLPLGT+TILCIDLGTDMVPAISLAYE+AESDIMKR+PR+PK DKLVNERLISMAYGQIGMIQA GGFF YFVI+AE GF P  LLG+R  WD    ND+ DSYGQ+WT++QRK +E+TCHTAFFVSIV+VQW DL+ICKTRRNS+FQQGM N  + FGLF ET LAAFL+YCPG+DVAL+M PL+ TWW  A P+S  IFIYDE+RK ++R+   G W+E ETYY
Sbjct:   38 ELTMEDHKLSLDELHRKFGTDMQRGLSTARAAEILARDGPNALTPPPTTPEWVKFCRQLFGGFSMLLWIGAILCFLAYGITAATEEEPTNDNLYLGVVLSAVVIITGCFSYYQEAKSSKIMESFKNMVPQQALVIRNGEKLSINAEDVVLGDLVEVKGGDRIPADVRIISAHGCKVDNSSLTGESEPQTRSPDFTNENPLETRNIAFFSTNCVEGTARGVVVNTGDRTVMGRIATLASGLEGGRTPIAIEIEHFIHIITGVAVFLGVSFFILSLILQYTWLEAVIFLIGIIVANVPEGLLATVTVCLTLTAKRMARKNCLVKNLEAVETLGSTSTICSDKTGTLTQNRMTVAHMWFDNQIHEADTTENQSGASFDKSSPTWTALSRVAGLCNRAVFQAGQENTPILKRDVAGDASESALLKCIELCCGSVRDMREKNPKVAEIPFNSTNKYQLSVHKNANPSESRYILVMKGAPERILDRCSTIVLQGKEQPLDEELKDAFQNAYLELGGLGERVLGFCHLALSDDQFPDGFQFDTEEVNFPTENLCFVGLISMIDPPRAAVPDAVGKCRSAGIKVIMVTGDHPITAKAIAKGVGIISEGNETVEDIAARLNIPVNQVNPRDAKACVIHGSDLKDMAQEQIDDILKHHTEIVFARTSPQQKLIIVEGCQRQGAIVAVTGDGVNDSPALKKADIGIAMGIAGSDVSKQAADMILLDDNFASIVTGVEEGRLIFDNLKKSIAYTLTSNIPEITPFLIFIVANIPLPLGTVTILCIDLGTDMVPAISLAYEQAESDIMKRQPRNPKTDKLVNERLISMAYGQIGMIQALGGFFTYFVILAENGFLPWTLLGIRVNWDDRWNNDVEDSYGQQWTYEQRKIVEFTCHTAFFVSIVVVQWADLIICKTRRNSVFQQGMKNKILIFGLFEETALAAFLSYCPGMDVALRMYPLKPTWWFCAFPYSLLIFIYDEVRKLIIRR-SPGGWVEKETYY 1023          
BLAST of non-gastric H ,K -ATPase alpha subunit vs. Ensembl Xenopus
Match: rab8b (RAB8B, member RAS oncogene family [Source:Xenbase;Acc:XB-GENE-480278])

HSP 1 Score: 1450.26 bits (3753), Expect = 0.000e+0
Identity = 726/980 (74.08%), Postives = 842/980 (85.92%), Query Frame = 1
Query:  181 ELDIDSHKISIKDLYIRLQTDPEKGLSIEEAKIRLARDGPNALTPPKTTPEWVKFCRQLFGGFSLLLWIGAALCFLAYAILSGAYEDPPKDNLYLGIVLTAVVVITGCFSYYQEAKSSKIMESFGKMVPQKANVIRDGKILEIAAENLVTGDIIDVKFGDRVPADIRVIQASSFKVDNSALTGESEAQVRSSEFTNDNPLETKNIAFFSTNAVEGTCKGVVISTGDNTVMGRIANLASGLEMGMTPIAKEINHFIHIITGVAVFLGVSFFVIAFILGYFWLDAVIFLIGIIVANVPEGXXXXXXXXXXXXXKKMAKKNCLVKNLEAVETLGSTSTICSDKTGTLTQNRMTVAHMWFDNKIQESDTSENQITSSTKQESETWKMLARVAMLCNRAQFKSGEEEKPVLKRECTGDASESALLKCVELSIGGVTKYRGENKKIVEIPFNSTNKYQVSIHETSDGNQG-YLLAMKGAPERILERCSTILIDGKEMEMDDHWRQEFNNAYLELGGMGERVLGFCDYRLDENNFPRGFDFNPDEVNFPLDGLRFVGLMSMIXXXXXXXXXXXXKCRSAGIKVIMVTGDHPITAKAIAKGVGIISEGNKTVDDIAAERGISPSEVNPRDARACVIHGSDLRDMSSEQLDEVLKHHDEIVFARTSPQQKLIIVEGCQRQGAIVAVTGDGVNDSPALKKADIGVAMGIAGSDVSKQAADMILLDDNFASIVTGVEEGRIIFDNLKKSIAYTLTSNIPEITPFLVFILADVPLPLGTITILCIDLGTDMVPAISLAYEEAESDIMKRKPRDPKHDKLVNERLISMAYGQIGMIQASGGFFVYFVIMAEQGFWPSRLLGLRKEWDSAAVNDLADSYGQEWTFDQRKKLEYTCHTAFFVSIVIVQWTDLMICKTRRNSIFQQGMWNHQMTFGLFFETTLAAFLTYCPGLDVALKMQPLRFTWWLPAIPFSASIFIYDEIRKFLLRKWKNGSW 3117
            EL ++ HK+S+ +L+ +  TD ++GLS   A   LARDGPNALTPP TTPEWVKFCRQLFGGFS+LLWIGA LCFLAY I +   E+P  DNLYLG+VL+AVV+ITGCFSYYQEAKSSKIMESF  MVPQ+A VIR+G+ L I AE++V GD+++VK GDR+PAD+R+I A   KVDNS+LTGESE Q RS +FTN+NPLET+NIAFFSTN VEGT +GVV++TGD TVMGRIA LASGLE G TPIA EI HFIHIITGVAVFLGVSFF+++ IL Y WL+AVIFLIGIIVANVPEGLLATVTVCLTLTAK+MA+KNCLVKNLEAVETLGSTSTICSDKTGTLTQNRMTVAHMWFDN+I E+DT+ENQ  +S  + S TW  L+RVA LCNRA F++G+E  P+LKR+  GDASESALLKC+EL  G V   R +N K+ EIPFNSTNKYQ+S+H+ ++ ++  Y+L MKGAPERIL+RCSTI++ GKE  +D+  +  F NAYLELGG+GERVLGFC   L ++ FP GF F+ +EVNFP + L FVGL+SMIDPPRAAVPDAV KCRSAGIKVIMVTGDHPITAKAIAKGVGIISEGN+TV+DIAA   I  ++VNPRDA+ACVIHGSDL+DM+ EQ+D++LKHH EIVFARTSPQQKLIIVEGCQRQGAIVAVTGDGVNDSPALKKADIG+AMGIAGSDVSKQAADMILLDDNFASIVTGVEEGR+IFDNLKKSIAYTLTSNIPEITPFL+FI+A++PLPLGT+TILCIDLGTDMVPAISLAYE+AESDIMKR+PR+PK DKLVNERLISMAYGQIGMIQA GGFF YFVI+AE GF P  LLG+R  WD    ND+ DSYGQ+WT++QRK +E+TCHTAFFVSIV+VQW DL+ICKTRRNS+FQQGM N  + FGLF ET LAAFL+YCPG+DVAL+M PL+ TWW  A P+S  IFIYDE+RK ++R+   G +
Sbjct:   35 ELTMEDHKLSLDELHRKFGTDMQRGLSTARAAEILARDGPNALTPPPTTPEWVKFCRQLFGGFSMLLWIGAILCFLAYGITAATEEEPTNDNLYLGVVLSAVVIITGCFSYYQEAKSSKIMESFKNMVPQQALVIRNGEKLSINAEDVVLGDLVEVKGGDRIPADVRIISAHGCKVDNSSLTGESEPQTRSPDFTNENPLETRNIAFFSTNCVEGTARGVVVNTGDRTVMGRIATLASGLEGGRTPIAIEIEHFIHIITGVAVFLGVSFFILSLILQYTWLEAVIFLIGIIVANVPEGLLATVTVCLTLTAKRMARKNCLVKNLEAVETLGSTSTICSDKTGTLTQNRMTVAHMWFDNQIHEADTTENQSGASFDKSSPTWTALSRVAGLCNRAVFQAGQENTPILKRDVAGDASESALLKCIELCCGSVRDMREKNPKVAEIPFNSTNKYQLSVHKNANPSESRYILVMKGAPERILDRCSTIVLQGKEQPLDEELKDAFQNAYLELGGLGERVLGFCHLALSDDQFPDGFQFDTEEVNFPTENLCFVGLISMIDPPRAAVPDAVGKCRSAGIKVIMVTGDHPITAKAIAKGVGIISEGNETVEDIAARLNIPVNQVNPRDAKACVIHGSDLKDMAQEQIDDILKHHTEIVFARTSPQQKLIIVEGCQRQGAIVAVTGDGVNDSPALKKADIGIAMGIAGSDVSKQAADMILLDDNFASIVTGVEEGRLIFDNLKKSIAYTLTSNIPEITPFLIFIVANIPLPLGTVTILCIDLGTDMVPAISLAYEQAESDIMKRQPRNPKTDKLVNERLISMAYGQIGMIQALGGFFTYFVILAENGFLPWTLLGIRVNWDDRWNNDVEDSYGQQWTYEQRKIVEFTCHTAFFVSIVVVQWADLIICKTRRNSVFQQGMKNKILIFGLFEETALAAFLSYCPGMDVALRMYPLKPTWWFCAFPYSLLIFIYDEVRKLIIRRSPGGEY 1014          
BLAST of non-gastric H ,K -ATPase alpha subunit vs. Ensembl Xenopus
Match: rab8b (RAB8B, member RAS oncogene family [Source:Xenbase;Acc:XB-GENE-480278])

HSP 1 Score: 1449.49 bits (3751), Expect = 0.000e+0
Identity = 732/1007 (72.69%), Postives = 848/1007 (84.21%), Query Frame = 1
Query:  181 ELDIDSHKISIKDLYIRLQTDPEKGLSIEEAKIRLARDGPNALTPPKTTPEWVKFCRQLFGGFSLLLWIGAALCFLAYAILSGAYEDPPKDNLYLGIVLTAVVVITGCFSYYQEAKSSKIMESFGKMVPQKANVIRDGKILEIAAENLVTGDIIDVKFGDRVPADIRVIQASSFKVDNSALTGESEAQVRSSEFTNDNPLETKNIAFFSTNAVEGTCKGVVISTGDNTVMGRIANLASGLEMGMTPIAKEINHFIHIITGVAVFLGVSFFVIAFILGYFWLDAVIFLIGIIVANVPEGXXXXXXXXXXXXXKKMAKKNCLVKNLEAVETLGSTSTICSDKTGTLTQNRMTVAHMWFDNKIQESDTSENQITSSTKQESETWKMLARVAMLCNRAQFKSGEEEKPVLKRECTGDASESALLKCVELSIGGVTKYRGENKKIVEIPFNSTNKYQVSIHETSDGNQG-YLLAMKGAPERILERCSTILIDGKEMEMDDHWRQEFNNAYLELGGMGERVLGFCDYRLDENNFPRGFDFNPDEVNFPLDGLRFVGLMSMIXXXXXXXXXXXXKCRSAGIKVIMVTGDHPITAKAIAKGVGIISEGNKTVDDIAAERGISPSEVNPRDARACVIHGSDLRDMSSEQLDEVLKHHDEIVFARTSPQQKLIIVEGCQR--------------------QGAIVAVTGDGVNDSPALKKADIGVAMGIAGSDVSKQAADMILLDDNFASIVTGVEEGRIIFDNLKKSIAYTLTSNIPEITPFLVFILADVPLPLGTITILCIDLGTDMVPAISLAYEEAESDIMKRKPRDPKHDKLVNERLISMAYGQIGMIQASGGFFVYFVIMAEQGFWPSRLLGLRKEWDSAAVNDLADSYGQEWTFDQRKKLEYTCHTAFFVSIVIVQWTDLMICKTRRNSIFQQGMWNHQMTFGLFFETTLAAFLTYCPGLDVALKMQPLRFTWWLPAIPFSASIFIYDEIRKFLLRKWKNGSWLENETYY 3138
            EL ++ HK+S+ +L+ +  TD ++GLS   A   LARDGPNALTPP TTPEWVKFCRQLFGGFS+LLWIGA LCFLAY I +   E+P  DNLYLG+VL+AVV+ITGCFSYYQEAKSSKIMESF  MVPQ+A VIR+G+ L I AE++V GD+++VK GDR+PAD+R+I A   KVDNS+LTGESE Q RS +FTN+NPLET+NIAFFSTN VEGT +GVV++TGD TVMGRIA LASGLE G TPIA EI HFIHIITGVAVFLGVSFF+++ IL Y WL+AVIFLIGIIVANVPEGLLATVTVCLTLTAK+MA+KNCLVKNLEAVETLGSTSTICSDKTGTLTQNRMTVAHMWFDN+I E+DT+ENQ  +S  + S TW  L+RVA LCNRA F++G+E  P+LKR+  GDASESALLKC+EL  G V   R +N K+ EIPFNSTNKYQ+S+H+ ++ ++  Y+L MKGAPERIL+RCSTI++ GKE  +D+  +  F NAYLELGG+GERVLGFC   L ++ FP GF F+ +EVNFP + L FVGL+SMIDPPRAAVPDAV KCRSAGIKVIMVTGDHPITAKAIAKGVGIISEGN+TV+DIAA   I  ++VNPRDA+ACVIHGSDL+DM+ EQ+D++LKHH EIVFARTSPQQKLIIVEGCQR                    QGAIVAVTGDGVNDSPALKKADIG+AMGIAGSDVSKQAADMILLDDNFASIVTGVEEGR+IFDNLKKSIAYTLTSNIPEITPFL+FI+A++PLPLGT+TILCIDLGTDMVPAISLAYE+AESDIMKR+PR+PK DKLVNERLISMAYGQIGMIQA GGFF YFVI+AE GF P  LLG+R  WD    ND+ DSYGQ+WT++QRK +E+TCHTAFFVSIV+VQW DL+ICKTRRNS+FQQGM N  + FGLF ET LAAFL+YCPG+DVAL+M PL+ TWW  A P+S  IFIYDE+RK ++R+   G W+E ETYY
Sbjct:   66 ELTMEDHKLSLDELHRKFGTDMQRGLSTARAAEILARDGPNALTPPPTTPEWVKFCRQLFGGFSMLLWIGAILCFLAYGITAATEEEPTNDNLYLGVVLSAVVIITGCFSYYQEAKSSKIMESFKNMVPQQALVIRNGEKLSINAEDVVLGDLVEVKGGDRIPADVRIISAHGCKVDNSSLTGESEPQTRSPDFTNENPLETRNIAFFSTNCVEGTARGVVVNTGDRTVMGRIATLASGLEGGRTPIAIEIEHFIHIITGVAVFLGVSFFILSLILQYTWLEAVIFLIGIIVANVPEGLLATVTVCLTLTAKRMARKNCLVKNLEAVETLGSTSTICSDKTGTLTQNRMTVAHMWFDNQIHEADTTENQSGASFDKSSPTWTALSRVAGLCNRAVFQAGQENTPILKRDVAGDASESALLKCIELCCGSVRDMREKNPKVAEIPFNSTNKYQLSVHKNANPSESRYILVMKGAPERILDRCSTIVLQGKEQPLDEELKDAFQNAYLELGGLGERVLGFCHLALSDDQFPDGFQFDTEEVNFPTENLCFVGLISMIDPPRAAVPDAVGKCRSAGIKVIMVTGDHPITAKAIAKGVGIISEGNETVEDIAARLNIPVNQVNPRDAKACVIHGSDLKDMAQEQIDDILKHHTEIVFARTSPQQKLIIVEGCQRQVSSVGLPFPLGSALLLCNIQGAIVAVTGDGVNDSPALKKADIGIAMGIAGSDVSKQAADMILLDDNFASIVTGVEEGRLIFDNLKKSIAYTLTSNIPEITPFLIFIVANIPLPLGTVTILCIDLGTDMVPAISLAYEQAESDIMKRQPRNPKTDKLVNERLISMAYGQIGMIQALGGFFTYFVILAENGFLPWTLLGIRVNWDDRWNNDVEDSYGQQWTYEQRKIVEFTCHTAFFVSIVVVQWADLIICKTRRNSVFQQGMKNKILIFGLFEETALAAFLSYCPGMDVALRMYPLKPTWWFCAFPYSLLIFIYDEVRKLIIRR-SPGGWVEKETYY 1071          
BLAST of non-gastric H ,K -ATPase alpha subunit vs. Ensembl Mouse
Match: Atp1a2 (ATPase, Na+/K+ transporting, alpha 2 polypeptide [Source:MGI Symbol;Acc:MGI:88106])

HSP 1 Score: 1484.16 bits (3841), Expect = 0.000e+0
Identity = 732/986 (74.24%), Postives = 843/986 (85.50%), Query Frame = 1
Query:  181 ELDIDSHKISIKDLYIRLQTDPEKGLSIEEAKIRLARDGPNALTPPKTTPEWVKFCRQLFGGFSLLLWIGAALCFLAYAILSGAYEDPPKDNLYLGIVLTAVVVITGCFSYYQEAKSSKIMESFGKMVPQKANVIRDGKILEIAAENLVTGDIIDVKFGDRVPADIRVIQASSFKVDNSALTGESEAQVRSSEFTNDNPLETKNIAFFSTNAVEGTCKGVVISTGDNTVMGRIANLASGLEMGMTPIAKEINHFIHIITGVAVFLGVSFFVIAFILGYFWLDAVIFLIGIIVANVPEGXXXXXXXXXXXXXKKMAKKNCLVKNLEAVETLGSTSTICSDKTGTLTQNRMTVAHMWFDNKIQESDTSENQITSSTKQESETWKMLARVAMLCNRAQFKSGEEEKPVLKRECTGDASESALLKCVELSIGGVTKYRGENKKIVEIPFNSTNKYQVSIHETSDGNQGYLLAMKGAPERILERCSTILIDGKEMEMDDHWRQEFNNAYLELGGMGERVLGFCDYRLDENNFPRGFDFNPDEVNFPLDGLRFVGLMSMIXXXXXXXXXXXXKCRSAGIKVIMVTGDHPITAKAIAKGVGIISEGNKTVDDIAAERGISPSEVNPRDARACVIHGSDLRDMSSEQLDEVLKHHDEIVFARTSPQQKLIIVEGCQRQGAIVAVTGDGVNDSPALKKADIGVAMGIAGSDVSKQAADMILLDDNFASIVTGVEEGRIIFDNLKKSIAYTLTSNIPEITPFLVFILADVPLPLGTITILCIDLGTDMVPAISLAYEEAESDIMKRKPRDPKHDKLVNERLISMAYGQIGMIQASGGFFVYFVIMAEQGFWPSRLLGLRKEWDSAAVNDLADSYGQEWTFDQRKKLEYTCHTAFFVSIVIVQWTDLMICKTRRNSIFQQGMWNHQMTFGLFFETTLAAFLTYCPGLDVALKMQPLRFTWWLPAIPFSASIFIYDEIRKFLLRKWKNGSWLENETYY 3138
            E+ +D HK+S+ +L  + Q D  KGL+ + A+  LARDGPNALTPP TTPEWVKFCRQLFGGFS+LLWIGA LCFLAY IL+   ++P  DNLYLGIVL AVV++TGCFSYYQEAKSSKIM+SF  MVPQ+A VIR+G+ ++I AE +V GD+++VK GDRVPAD+R+I +   KVDNS+LTGESE Q RS EFT++NPLET+NI FFSTN VEGT +G+VI+TGD TVMGRIA LASGLE+G TPIA EI HFI +ITGVAVFLGVSFFV++ ILGY WL+AVIFLIGIIVANVPEGLLATVTVCLTLTAK+MA+KNCLVKNLEAVETLGSTSTICSDKTGTLTQNRMTVAHMWFDN+I E+DT+E+Q  ++  + S TW  L+R+A LCNRA FK+G+E   V KR+  GDASESALLKC+ELS G V K R  N K+ EIPFNSTNKYQ+SIHE  D  Q ++L MKGAPERIL+RCSTIL+ GKE+ +D   +  F NAY+ELGG+GERVLGFC   L    FPRGF F+ DE+NFP + L FVGLMSMIDPPRAAVPDAV KCRSAGIKVIMVTGDHPITAKAIAKGVGIISEGN+TV+DIAA   I  S+VNPR+A+ACV+HGSDL+DM+SEQLDE+L+ H EIVFARTSPQQKLIIVEGCQRQGAIVAVTGDGVNDSPALKKADIG+AMGI+GSDVSKQAADMILLDDNFASIVTGVEEGR+IFDNLKKSIAYTLTSNIPEITPFL+FI+A++PLPLGT+TILCIDLGTDMVPAISLAYE AESDIMKR+PR+ + DKLVNERLISMAYGQIGMIQA GGFF YFVI+AE GF PSRLLG+R +WD    NDL DSYGQEWT++QRK +E+TCHTAFF SIV+VQW DL+ICKTRRNS+FQQGM N  + FGL  ET LAAFL+YCPG+ VAL+M PL+ TWW  A P+S  IFIYDE+RK +LR++  G W+E ETYY
Sbjct:   36 EVAMDDHKLSLDELGRKYQVDLSKGLTNQRAQDILARDGPNALTPPPTTPEWVKFCRQLFGGFSILLWIGALLCFLAYGILAAMEDEPSNDNLYLGIVLAAVVIVTGCFSYYQEAKSSKIMDSFKNMVPQQALVIREGEKMQINAEEVVVGDLVEVKGGDRVPADLRIISSHGCKVDNSSLTGESEPQTRSPEFTHENPLETRNICFFSTNCVEGTARGIVIATGDRTVMGRIATLASGLEVGQTPIAMEIEHFIQLITGVAVFLGVSFFVLSLILGYSWLEAVIFLIGIIVANVPEGLLATVTVCLTLTAKRMARKNCLVKNLEAVETLGSTSTICSDKTGTLTQNRMTVAHMWFDNQIHEADTTEDQSGATFDKRSPTWTALSRIAGLCNRAVFKAGQENISVSKRDTAGDASESALLKCIELSCGSVRKMRDRNPKVAEIPFNSTNKYQLSIHEREDSPQSHVLVMKGAPERILDRCSTILVQGKEIPLDKEMQDAFQNAYMELGGLGERVLGFCQLNLPSGKFPRGFKFDTDELNFPTEKLCFVGLMSMIDPPRAAVPDAVGKCRSAGIKVIMVTGDHPITAKAIAKGVGIISEGNETVEDIAARLNIPVSQVNPREAKACVVHGSDLKDMTSEQLDEILRDHTEIVFARTSPQQKLIIVEGCQRQGAIVAVTGDGVNDSPALKKADIGIAMGISGSDVSKQAADMILLDDNFASIVTGVEEGRLIFDNLKKSIAYTLTSNIPEITPFLLFIIANIPLPLGTVTILCIDLGTDMVPAISLAYEAAESDIMKRQPRNSQTDKLVNERLISMAYGQIGMIQALGGFFTYFVILAENGFLPSRLLGIRLDWDDRTTNDLEDSYGQEWTYEQRKVVEFTCHTAFFASIVVVQWADLIICKTRRNSVFQQGMKNKILIFGLLEETALAAFLSYCPGMGVALRMYPLKVTWWFCAFPYSLLIFIYDEVRKLILRRYPGG-WVEKETYY 1020          
BLAST of non-gastric H ,K -ATPase alpha subunit vs. Ensembl Mouse
Match: Atp1a3 (ATPase, Na+/K+ transporting, alpha 3 polypeptide [Source:MGI Symbol;Acc:MGI:88107])

HSP 1 Score: 1481.46 bits (3834), Expect = 0.000e+0
Identity = 736/987 (74.57%), Postives = 846/987 (85.71%), Query Frame = 1
Query:  181 ELDIDSHKISIKDLYIRLQTDPEKGLSIEEAKIRLARDGPNALTPPKTTPEWVKFCRQLFGGFSLLLWIGAALCFLAYAILSGAYEDPPKDNLYLGIVLTAVVVITGCFSYYQEAKSSKIMESFGKMVPQKANVIRDGKILEIAAENLVTGDIIDVKFGDRVPADIRVIQASSFKVDNSALTGESEAQVRSSEFTNDNPLETKNIAFFSTNAVEGTCKGVVISTGDNTVMGRIANLASGLEMGMTPIAKEINHFIHIITGVAVFLGVSFFVIAFILGYFWLDAVIFLIGIIVANVPEGXXXXXXXXXXXXXKKMAKKNCLVKNLEAVETLGSTSTICSDKTGTLTQNRMTVAHMWFDNKIQESDTSENQITSSTKQESETWKMLARVAMLCNRAQFKSGEEEKPVLKRECTGDASESALLKCVELSIGGVTKYRGENKKIVEIPFNSTNKYQVSIHETSDGNQG-YLLAMKGAPERILERCSTILIDGKEMEMDDHWRQEFNNAYLELGGMGERVLGFCDYRLDENNFPRGFDFNPDEVNFPLDGLRFVGLMSMIXXXXXXXXXXXXKCRSAGIKVIMVTGDHPITAKAIAKGVGIISEGNKTVDDIAAERGISPSEVNPRDARACVIHGSDLRDMSSEQLDEVLKHHDEIVFARTSPQQKLIIVEGCQRQGAIVAVTGDGVNDSPALKKADIGVAMGIAGSDVSKQAADMILLDDNFASIVTGVEEGRIIFDNLKKSIAYTLTSNIPEITPFLVFILADVPLPLGTITILCIDLGTDMVPAISLAYEEAESDIMKRKPRDPKHDKLVNERLISMAYGQIGMIQASGGFFVYFVIMAEQGFWPSRLLGLRKEWDSAAVNDLADSYGQEWTFDQRKKLEYTCHTAFFVSIVIVQWTDLMICKTRRNSIFQQGMWNHQMTFGLFFETTLAAFLTYCPGLDVALKMQPLRFTWWLPAIPFSASIFIYDEIRKFLLRKWKNGSWLENETYY 3138
            E+ +  HK+S++++  +  TD  +GL+  +A+  LARDGPNALTPP TTPEWVKFCRQLFGGFS+LLWIGA LCFLAY I +G  +DP  DNLYLGIVL AVV+ITGCFSYYQEAKSSKIMESF  MVPQ+A VIR+G+ +++ AE +V GD++++K GDRVPAD+R+I A   KVDNS+LTGESE Q RS + T+DNPLET+NI FFSTN VEGT +GVV++TGD TVMGRIA LASGLE+G TPIA EI HFI +ITGVAVFLGVSFF+++ ILGY WL+AVIFLIGIIVANVPEGLLATVTVCLTLTAK+MA+KNCLVKNLEAVETLGSTSTICSDKTGTLTQNRMTVAHMWFDN+I E+DT+E+Q  +S  + S TW  L+ +A LCNRA FK G++  PVLKR+  GDASESALLKC+ELS G V   R  NKK+ EIPFNSTNKYQ+SIHET D N   YLL MKGAPERIL+RC+TIL+ GKE  +D+  ++ F NAYLELGG+GERVLGFC Y L E  FP+GF F+ D+VNF  D L FVGLMSMIDPPRAAVPDAV KCRSAGIKVIMVTGDHPITAKAIAKGVGIISEGN+TV+DIAA   I  S+VNPRDA+ACVIHG+DL+D +SEQ+DE+L++H EIVFARTSPQQKLIIVEGCQRQGAIVAVTGDGVNDSPALKKADIGVAMGIAGSDVSKQAADMILLDDNFASIVTGVEEGR+IFDNLKKSIAYTLTSNIPEITPFL+FI+A++PLPLGTITILCIDLGTDMVPAISLAYE AESDIMKR+PR+P+ DKLVNERLISMAYGQIGMIQA GGFF YFVI+AE GF P  L+G+R  WD   VNDL DSYGQ+WT++QRK +E+TCHTAFFVSIV+VQW DL+ICKTRRNS+FQQGM N  + FGLF ET LAAFL+YCPG+DVAL+M PL+ +WW  A P+S  IF+YDEIRK +LR+   G W+E ETYY
Sbjct:   28 EVAMTEHKMSVEEVCRKYNTDCVQGLTHSKAQEILARDGPNALTPPPTTPEWVKFCRQLFGGFSILLWIGAILCFLAYGIQAGTEDDPSGDNLYLGIVLAAVVIITGCFSYYQEAKSSKIMESFKNMVPQQALVIREGEKMQVNAEEVVVGDLVEIKGGDRVPADLRIISAHGCKVDNSSLTGESEPQTRSPDCTHDNPLETRNITFFSTNCVEGTARGVVVATGDRTVMGRIATLASGLEVGKTPIAIEIEHFIQLITGVAVFLGVSFFILSLILGYTWLEAVIFLIGIIVANVPEGLLATVTVCLTLTAKRMARKNCLVKNLEAVETLGSTSTICSDKTGTLTQNRMTVAHMWFDNQIHEADTTEDQSGTSFDKSSHTWVALSHIAGLCNRAVFKGGQDNIPVLKRDVAGDASESALLKCIELSSGSVKLMRERNKKVAEIPFNSTNKYQLSIHETEDPNDNRYLLVMKGAPERILDRCATILLQGKEQPLDEEMKEAFQNAYLELGGLGERVLGFCHYYLPEEQFPKGFAFDCDDVNFTTDNLCFVGLMSMIDPPRAAVPDAVGKCRSAGIKVIMVTGDHPITAKAIAKGVGIISEGNETVEDIAARLNIPVSQVNPRDAKACVIHGTDLKDFTSEQIDEILQNHTEIVFARTSPQQKLIIVEGCQRQGAIVAVTGDGVNDSPALKKADIGVAMGIAGSDVSKQAADMILLDDNFASIVTGVEEGRLIFDNLKKSIAYTLTSNIPEITPFLLFIMANIPLPLGTITILCIDLGTDMVPAISLAYEAAESDIMKRQPRNPRTDKLVNERLISMAYGQIGMIQALGGFFSYFVILAENGFLPGNLVGIRLNWDDRTVNDLEDSYGQQWTYEQRKVVEFTCHTAFFVSIVVVQWADLIICKTRRNSVFQQGMKNKILIFGLFEETALAAFLSYCPGMDVALRMYPLKPSWWFCAFPYSFLIFVYDEIRKLILRR-NPGGWVEKETYY 1013          
BLAST of non-gastric H ,K -ATPase alpha subunit vs. Ensembl Mouse
Match: Atp1a3 (ATPase, Na+/K+ transporting, alpha 3 polypeptide [Source:MGI Symbol;Acc:MGI:88107])

HSP 1 Score: 1480.31 bits (3831), Expect = 0.000e+0
Identity = 736/987 (74.57%), Postives = 846/987 (85.71%), Query Frame = 1
Query:  181 ELDIDSHKISIKDLYIRLQTDPEKGLSIEEAKIRLARDGPNALTPPKTTPEWVKFCRQLFGGFSLLLWIGAALCFLAYAILSGAYEDPPKDNLYLGIVLTAVVVITGCFSYYQEAKSSKIMESFGKMVPQKANVIRDGKILEIAAENLVTGDIIDVKFGDRVPADIRVIQASSFKVDNSALTGESEAQVRSSEFTNDNPLETKNIAFFSTNAVEGTCKGVVISTGDNTVMGRIANLASGLEMGMTPIAKEINHFIHIITGVAVFLGVSFFVIAFILGYFWLDAVIFLIGIIVANVPEGXXXXXXXXXXXXXKKMAKKNCLVKNLEAVETLGSTSTICSDKTGTLTQNRMTVAHMWFDNKIQESDTSENQITSSTKQESETWKMLARVAMLCNRAQFKSGEEEKPVLKRECTGDASESALLKCVELSIGGVTKYRGENKKIVEIPFNSTNKYQVSIHETSDGNQG-YLLAMKGAPERILERCSTILIDGKEMEMDDHWRQEFNNAYLELGGMGERVLGFCDYRLDENNFPRGFDFNPDEVNFPLDGLRFVGLMSMIXXXXXXXXXXXXKCRSAGIKVIMVTGDHPITAKAIAKGVGIISEGNKTVDDIAAERGISPSEVNPRDARACVIHGSDLRDMSSEQLDEVLKHHDEIVFARTSPQQKLIIVEGCQRQGAIVAVTGDGVNDSPALKKADIGVAMGIAGSDVSKQAADMILLDDNFASIVTGVEEGRIIFDNLKKSIAYTLTSNIPEITPFLVFILADVPLPLGTITILCIDLGTDMVPAISLAYEEAESDIMKRKPRDPKHDKLVNERLISMAYGQIGMIQASGGFFVYFVIMAEQGFWPSRLLGLRKEWDSAAVNDLADSYGQEWTFDQRKKLEYTCHTAFFVSIVIVQWTDLMICKTRRNSIFQQGMWNHQMTFGLFFETTLAAFLTYCPGLDVALKMQPLRFTWWLPAIPFSASIFIYDEIRKFLLRKWKNGSWLENETYY 3138
            E+ +  HK+S++++  +  TD  +GL+  +A+  LARDGPNALTPP TTPEWVKFCRQLFGGFS+LLWIGA LCFLAY I +G  +DP  DNLYLGIVL AVV+ITGCFSYYQEAKSSKIMESF  MVPQ+A VIR+G+ +++ AE +V GD++++K GDRVPAD+R+I A   KVDNS+LTGESE Q RS + T+DNPLET+NI FFSTN VEGT +GVV++TGD TVMGRIA LASGLE+G TPIA EI HFI +ITGVAVFLGVSFF+++ ILGY WL+AVIFLIGIIVANVPEGLLATVTVCLTLTAK+MA+KNCLVKNLEAVETLGSTSTICSDKTGTLTQNRMTVAHMWFDN+I E+DT+E+Q  +S  + S TW  L+ +A LCNRA FK G++  PVLKR+  GDASESALLKC+ELS G V   R  NKK+ EIPFNSTNKYQ+SIHET D N   YLL MKGAPERIL+RC+TIL+ GKE  +D+  ++ F NAYLELGG+GERVLGFC Y L E  FP+GF F+ D+VNF  D L FVGLMSMIDPPRAAVPDAV KCRSAGIKVIMVTGDHPITAKAIAKGVGIISEGN+TV+DIAA   I  S+VNPRDA+ACVIHG+DL+D +SEQ+DE+L++H EIVFARTSPQQKLIIVEGCQRQGAIVAVTGDGVNDSPALKKADIGVAMGIAGSDVSKQAADMILLDDNFASIVTGVEEGR+IFDNLKKSIAYTLTSNIPEITPFL+FI+A++PLPLGTITILCIDLGTDMVPAISLAYE AESDIMKR+PR+P+ DKLVNERLISMAYGQIGMIQA GGFF YFVI+AE GF P  L+G+R  WD   VNDL DSYGQ+WT++QRK +E+TCHTAFFVSIV+VQW DL+ICKTRRNS+FQQGM N  + FGLF ET LAAFL+YCPG+DVAL+M PL+ +WW  A P+S  IF+YDEIRK +LR+   G W+E ETYY
Sbjct:   41 EVAMTEHKMSVEEVCRKYNTDCVQGLTHSKAQEILARDGPNALTPPPTTPEWVKFCRQLFGGFSILLWIGAILCFLAYGIQAGTEDDPSGDNLYLGIVLAAVVIITGCFSYYQEAKSSKIMESFKNMVPQQALVIREGEKMQVNAEEVVVGDLVEIKGGDRVPADLRIISAHGCKVDNSSLTGESEPQTRSPDCTHDNPLETRNITFFSTNCVEGTARGVVVATGDRTVMGRIATLASGLEVGKTPIAIEIEHFIQLITGVAVFLGVSFFILSLILGYTWLEAVIFLIGIIVANVPEGLLATVTVCLTLTAKRMARKNCLVKNLEAVETLGSTSTICSDKTGTLTQNRMTVAHMWFDNQIHEADTTEDQSGTSFDKSSHTWVALSHIAGLCNRAVFKGGQDNIPVLKRDVAGDASESALLKCIELSSGSVKLMRERNKKVAEIPFNSTNKYQLSIHETEDPNDNRYLLVMKGAPERILDRCATILLQGKEQPLDEEMKEAFQNAYLELGGLGERVLGFCHYYLPEEQFPKGFAFDCDDVNFTTDNLCFVGLMSMIDPPRAAVPDAVGKCRSAGIKVIMVTGDHPITAKAIAKGVGIISEGNETVEDIAARLNIPVSQVNPRDAKACVIHGTDLKDFTSEQIDEILQNHTEIVFARTSPQQKLIIVEGCQRQGAIVAVTGDGVNDSPALKKADIGVAMGIAGSDVSKQAADMILLDDNFASIVTGVEEGRLIFDNLKKSIAYTLTSNIPEITPFLLFIMANIPLPLGTITILCIDLGTDMVPAISLAYEAAESDIMKRQPRNPRTDKLVNERLISMAYGQIGMIQALGGFFSYFVILAENGFLPGNLVGIRLNWDDRTVNDLEDSYGQQWTYEQRKVVEFTCHTAFFVSIVVVQWADLIICKTRRNSVFQQGMKNKILIFGLFEETALAAFLSYCPGMDVALRMYPLKPSWWFCAFPYSFLIFVYDEIRKLILRR-NPGGWVEKETYY 1026          
BLAST of non-gastric H ,K -ATPase alpha subunit vs. Ensembl Mouse
Match: Atp1a1 (ATPase, Na+/K+ transporting, alpha 1 polypeptide [Source:MGI Symbol;Acc:MGI:88105])

HSP 1 Score: 1468.75 bits (3801), Expect = 0.000e+0
Identity = 725/987 (73.45%), Postives = 847/987 (85.82%), Query Frame = 1
Query:  181 ELDIDSHKISIKDLYIRLQTDPEKGLSIEEAKIRLARDGPNALTPPKTTPEWVKFCRQLFGGFSLLLWIGAALCFLAYAILSGAYEDPPKDNLYLGIVLTAVVVITGCFSYYQEAKSSKIMESFGKMVPQKANVIRDGKILEIAAENLVTGDIIDVKFGDRVPADIRVIQASSFKVDNSALTGESEAQVRSSEFTNDNPLETKNIAFFSTNAVEGTCKGVVISTGDNTVMGRIANLASGLEMGMTPIAKEINHFIHIITGVAVFLGVSFFVIAFILGYFWLDAVIFLIGIIVANVPEGXXXXXXXXXXXXXKKMAKKNCLVKNLEAVETLGSTSTICSDKTGTLTQNRMTVAHMWFDNKIQESDTSENQITSSTKQESETWKMLARVAMLCNRAQFKSGEEEKPVLKRECTGDASESALLKCVELSIGGVTKYRGENKKIVEIPFNSTNKYQVSIHETSDGNQ-GYLLAMKGAPERILERCSTILIDGKEMEMDDHWRQEFNNAYLELGGMGERVLGFCDYRLDENNFPRGFDFNPDEVNFPLDGLRFVGLMSMIXXXXXXXXXXXXKCRSAGIKVIMVTGDHPITAKAIAKGVGIISEGNKTVDDIAAERGISPSEVNPRDARACVIHGSDLRDMSSEQLDEVLKHHDEIVFARTSPQQKLIIVEGCQRQGAIVAVTGDGVNDSPALKKADIGVAMGIAGSDVSKQAADMILLDDNFASIVTGVEEGRIIFDNLKKSIAYTLTSNIPEITPFLVFILADVPLPLGTITILCIDLGTDMVPAISLAYEEAESDIMKRKPRDPKHDKLVNERLISMAYGQIGMIQASGGFFVYFVIMAEQGFWPSRLLGLRKEWDSAAVNDLADSYGQEWTFDQRKKLEYTCHTAFFVSIVIVQWTDLMICKTRRNSIFQQGMWNHQMTFGLFFETTLAAFLTYCPGLDVALKMQPLRFTWWLPAIPFSASIFIYDEIRKFLLRKWKNGSWLENETYY 3138
            E+ +D HK+S+ +L+ +  TD  +GL+   A   LARDGPNALTPP TTPEWVKFCRQLFGGFS+LLWIGA LCFLAY I S   E+PP D+LYLG+VL+AVV+ITGCFSYYQEAKSSKIMESF  MVPQ+A VIR+G+ + I AE++V GD+++VK GDR+PAD+R+I A+  KVDNS+LTGESE Q RS +FTN+NPLET+NIAFFSTN VEGT +G+V+ TGD TVMGRIA LASGLE G TPIA+EI HFIH+ITGVAVFLGVSFF+++ IL Y WL+AVIFLIGIIVANVPEGLLATVTVCLTLTAK+MA+KNCLVKNLEAVETLGSTSTICSDKTGTLTQNRMTVAHMWFDN+I E+DT+ENQ   S  + S TW  L+R+A LCNRA F++ +E  P+LKR   GDASESALLKC+E+  G V + R +  KIVEIPFNSTNKYQ+SIH+  + ++  +LL MKGAPERIL+RCS+IL+ GKE  +D+  +  F NAYLELGG+GERVLGFC   L +  FP GF F+ D+VNFP+D L FVGL+SMIDPPRAAVPDAV KCRSAGIKVIMVTGDHPITAKAIAKGVGIISEGN+TV+DIAA   I  ++VNPRDA+ACV+HGSDL+DM+SE+LD++L++H EIVFARTSPQQKLIIVEGCQRQGAIVAVTGDGVNDSPALKKADIGVAMGI GSDVSKQAADMILLDDNFASIVTGVEEGR+IFDNLKKSIAYTLTSNIPEITPFL+FI+A++PLPLGT+TILCIDLGTDMVPAISLAYE+AESDIMKR+PR+PK DKLVNERLISMAYGQIGMIQA GGFF YFVI+AE GF P  LLG+R+ WD   VND+ DSYGQ+WT++QRK +E+TCHTAFFVSIV+VQW DL+ICKTRRNS+FQQGM N  + FGLF ET LAAFL+YCPG+  AL+M PL+ TWW  A P+S  IF+YDE+RK ++R+ + G W+E ETYY
Sbjct:   38 EVSMDDHKLSLDELHRKYGTDLSRGLTPARAAEILARDGPNALTPPPTTPEWVKFCRQLFGGFSMLLWIGAILCFLAYGIRSATEEEPPNDDLYLGVVLSAVVIITGCFSYYQEAKSSKIMESFKNMVPQQALVIRNGEKMSINAEDVVVGDLVEVKGGDRIPADLRIISANGCKVDNSSLTGESEPQTRSPDFTNENPLETRNIAFFSTNCVEGTARGIVVYTGDRTVMGRIATLASGLEGGQTPIAEEIEHFIHLITGVAVFLGVSFFILSLILEYTWLEAVIFLIGIIVANVPEGLLATVTVCLTLTAKRMARKNCLVKNLEAVETLGSTSTICSDKTGTLTQNRMTVAHMWFDNQIHEADTTENQSGVSFDKTSATWFALSRIAGLCNRAVFQANQENLPILKRAVAGDASESALLKCIEVCCGSVMEMREKYSKIVEIPFNSTNKYQLSIHKNPNASEPKHLLVMKGAPERILDRCSSILLHGKEQPLDEELKDAFQNAYLELGGLGERVLGFCHLLLPDEQFPEGFQFDTDDVNFPVDNLCFVGLISMIDPPRAAVPDAVGKCRSAGIKVIMVTGDHPITAKAIAKGVGIISEGNETVEDIAARLNIPVNQVNPRDAKACVVHGSDLKDMTSEELDDILRYHTEIVFARTSPQQKLIIVEGCQRQGAIVAVTGDGVNDSPALKKADIGVAMGIVGSDVSKQAADMILLDDNFASIVTGVEEGRLIFDNLKKSIAYTLTSNIPEITPFLIFIIANIPLPLGTVTILCIDLGTDMVPAISLAYEQAESDIMKRQPRNPKTDKLVNERLISMAYGQIGMIQALGGFFTYFVILAENGFLPFHLLGIRETWDDRWVNDVEDSYGQQWTYEQRKIVEFTCHTAFFVSIVVVQWADLVICKTRRNSVFQQGMKNKILIFGLFEETALAAFLSYCPGMGAALRMYPLKPTWWFCAFPYSLLIFVYDEVRKLIIRR-RPGGWVEKETYY 1023          
BLAST of non-gastric H ,K -ATPase alpha subunit vs. Ensembl Mouse
Match: Atp1a3 (ATPase, Na+/K+ transporting, alpha 3 polypeptide [Source:MGI Symbol;Acc:MGI:88107])

HSP 1 Score: 1466.44 bits (3795), Expect = 0.000e+0
Identity = 730/978 (74.64%), Postives = 839/978 (85.79%), Query Frame = 1
Query:  181 ELDIDSHKISIKDLYIRLQTDPEKGLSIEEAKIRLARDGPNALTPPKTTPEWVKFCRQLFGGFSLLLWIGAALCFLAYAILSGAYEDPPKDNLYLGIVLTAVVVITGCFSYYQEAKSSKIMESFGKMVPQKANVIRDGKILEIAAENLVTGDIIDVKFGDRVPADIRVIQASSFKVDNSALTGESEAQVRSSEFTNDNPLETKNIAFFSTNAVEGTCKGVVISTGDNTVMGRIANLASGLEMGMTPIAKEINHFIHIITGVAVFLGVSFFVIAFILGYFWLDAVIFLIGIIVANVPEGXXXXXXXXXXXXXKKMAKKNCLVKNLEAVETLGSTSTICSDKTGTLTQNRMTVAHMWFDNKIQESDTSENQITSSTKQESETWKMLARVAMLCNRAQFKSGEEEKPVLKRECTGDASESALLKCVELSIGGVTKYRGENKKIVEIPFNSTNKYQVSIHETSDGNQG-YLLAMKGAPERILERCSTILIDGKEMEMDDHWRQEFNNAYLELGGMGERVLGFCDYRLDENNFPRGFDFNPDEVNFPLDGLRFVGLMSMIXXXXXXXXXXXXKCRSAGIKVIMVTGDHPITAKAIAKGVGIISEGNKTVDDIAAERGISPSEVNPRDARACVIHGSDLRDMSSEQLDEVLKHHDEIVFARTSPQQKLIIVEGCQRQGAIVAVTGDGVNDSPALKKADIGVAMGIAGSDVSKQAADMILLDDNFASIVTGVEEGRIIFDNLKKSIAYTLTSNIPEITPFLVFILADVPLPLGTITILCIDLGTDMVPAISLAYEEAESDIMKRKPRDPKHDKLVNERLISMAYGQIGMIQASGGFFVYFVIMAEQGFWPSRLLGLRKEWDSAAVNDLADSYGQEWTFDQRKKLEYTCHTAFFVSIVIVQWTDLMICKTRRNSIFQQGMWNHQMTFGLFFETTLAAFLTYCPGLDVALKMQPLRFTWWLPAIPFSASIFIYDEIRKFLLRKWKNG 3111
            E+ +  HK+S++++  +  TD  +GL+  +A+  LARDGPNALTPP TTPEWVKFCRQLFGGFS+LLWIGA LCFLAY I +G  +DP  DNLYLGIVL AVV+ITGCFSYYQEAKSSKIMESF  MVPQ+A VIR+G+ +++ AE +V GD++++K GDRVPAD+R+I A   KVDNS+LTGESE Q RS + T+DNPLET+NI FFSTN VEGT +GVV++TGD TVMGRIA LASGLE+G TPIA EI HFI +ITGVAVFLGVSFF+++ ILGY WL+AVIFLIGIIVANVPEGLLATVTVCLTLTAK+MA+KNCLVKNLEAVETLGSTSTICSDKTGTLTQNRMTVAHMWFDN+I E+DT+E+Q  +S  + S TW  L+ +A LCNRA FK G++  PVLKR+  GDASESALLKC+ELS G V   R  NKK+ EIPFNSTNKYQ+SIHET D N   YLL MKGAPERIL+RC+TIL+ GKE  +D+  ++ F NAYLELGG+GERVLGFC Y L E  FP+GF F+ D+VNF  D L FVGLMSMIDPPRAAVPDAV KCRSAGIKVIMVTGDHPITAKAIAKGVGIISEGN+TV+DIAA   I  S+VNPRDA+ACVIHG+DL+D +SEQ+DE+L++H EIVFARTSPQQKLIIVEGCQRQGAIVAVTGDGVNDSPALKKADIGVAMGIAGSDVSKQAADMILLDDNFASIVTGVEEGR+IFDNLKKSIAYTLTSNIPEITPFL+FI+A++PLPLGTITILCIDLGTDMVPAISLAYE AESDIMKR+PR+P+ DKLVNERLISMAYGQIGMIQA GGFF YFVI+AE GF P  L+G+R  WD   VNDL DSYGQ+WT++QRK +E+TCHTAFFVSIV+VQW DL+ICKTRRNS+FQQGM N  + FGLF ET LAAFL+YCPG+DVAL+M PL+ +WW  A P+S  IF+YDEIRK +LR+   G
Sbjct:   28 EVAMTEHKMSVEEVCRKYNTDCVQGLTHSKAQEILARDGPNALTPPPTTPEWVKFCRQLFGGFSILLWIGAILCFLAYGIQAGTEDDPSGDNLYLGIVLAAVVIITGCFSYYQEAKSSKIMESFKNMVPQQALVIREGEKMQVNAEEVVVGDLVEIKGGDRVPADLRIISAHGCKVDNSSLTGESEPQTRSPDCTHDNPLETRNITFFSTNCVEGTARGVVVATGDRTVMGRIATLASGLEVGKTPIAIEIEHFIQLITGVAVFLGVSFFILSLILGYTWLEAVIFLIGIIVANVPEGLLATVTVCLTLTAKRMARKNCLVKNLEAVETLGSTSTICSDKTGTLTQNRMTVAHMWFDNQIHEADTTEDQSGTSFDKSSHTWVALSHIAGLCNRAVFKGGQDNIPVLKRDVAGDASESALLKCIELSSGSVKLMRERNKKVAEIPFNSTNKYQLSIHETEDPNDNRYLLVMKGAPERILDRCATILLQGKEQPLDEEMKEAFQNAYLELGGLGERVLGFCHYYLPEEQFPKGFAFDCDDVNFTTDNLCFVGLMSMIDPPRAAVPDAVGKCRSAGIKVIMVTGDHPITAKAIAKGVGIISEGNETVEDIAARLNIPVSQVNPRDAKACVIHGTDLKDFTSEQIDEILQNHTEIVFARTSPQQKLIIVEGCQRQGAIVAVTGDGVNDSPALKKADIGVAMGIAGSDVSKQAADMILLDDNFASIVTGVEEGRLIFDNLKKSIAYTLTSNIPEITPFLLFIMANIPLPLGTITILCIDLGTDMVPAISLAYEAAESDIMKRQPRNPRTDKLVNERLISMAYGQIGMIQALGGFFSYFVILAENGFLPGNLVGIRLNWDDRTVNDLEDSYGQQWTYEQRKVVEFTCHTAFFVSIVVVQWADLIICKTRRNSVFQQGMKNKILIFGLFEETALAAFLSYCPGMDVALRMYPLKPSWWFCAFPYSFLIFVYDEIRKLILRRNPGG 1005          
BLAST of non-gastric H ,K -ATPase alpha subunit vs. UniProt/SwissProt
Match: sp|Q6RWA9|AT1A_TAESO (Sodium/potassium-transporting ATPase subunit alpha OS=Taenia solium OX=6204 PE=2 SV=1)

HSP 1 Score: 1612.82 bits (4175), Expect = 0.000e+0
Identity = 793/987 (80.34%), Postives = 886/987 (89.77%), Query Frame = 1
Query:  181 ELDIDSHKISIKDLYIRLQTDPEKGLSIEEAKIRLARDGPNALTPPKTTPEWVKFCRQLFGGFSLLLWIGAALCFLAYAILSGAYEDPP-KDNLYLGIVLTAVVVITGCFSYYQEAKSSKIMESFGKMVPQKANVIRDGKILEIAAENLVTGDIIDVKFGDRVPADIRVIQASSFKVDNSALTGESEAQVRSSEFTNDNPLETKNIAFFSTNAVEGTCKGVVISTGDNTVMGRIANLASGLEMGMTPIAKEINHFIHIITGVAVFLGVSFFVIAFILGYFWLDAVIFLIGIIVANVPEGXXXXXXXXXXXXXKKMAKKNCLVKNLEAVETLGSTSTICSDKTGTLTQNRMTVAHMWFDNKIQESDTSENQITSSTKQESETWKMLARVAMLCNRAQFKSGEEEKPVLKRECTGDASESALLKCVELSIGGVTKYRGENKKIVEIPFNSTNKYQVSIHETSDGNQGYLLAMKGAPERILERCSTILIDGKEMEMDDHWRQEFNNAYLELGGMGERVLGFCDYRLDENNFPRGFDFNPDEVNFPLDGLRFVGLMSMIXXXXXXXXXXXXKCRSAGIKVIMVTGDHPITAKAIAKGVGIISEGNKTVDDIAAERGISPSEVNPRDARACVIHGSDLRDMSSEQLDEVLKHHDEIVFARTSPQQKLIIVEGCQRQGAIVAVTGDGVNDSPALKKADIGVAMGIAGSDVSKQAADMILLDDNFASIVTGVEEGRIIFDNLKKSIAYTLTSNIPEITPFLVFILADVPLPLGTITILCIDLGTDMVPAISLAYEEAESDIMKRKPRDPKHDKLVNERLISMAYGQIGMIQASGGFFVYFVIMAEQGFWPSRLLGLRKEWDSAAVNDLADSYGQEWTFDQRKKLEYTCHTAFFVSIVIVQWTDLMICKTRRNSIFQQGMWNHQMTFGLFFETTLAAFLTYCPGLDVALKMQPLRFTWWLPAIPFSASIFIYDEIRKFLLRKWKNGSWLENETYY 3138
            EL +D H+IS+ +LY RL T+P+ GL+ E+AK RL RDGPNALTPPKTTPEWVKFC+ +FGGFSLLLWIGA LCF+A+ I      +P   DNLYLGIVL AVVVITGCFSYYQE+KSSKIMESF K+VPQ A VIR G+ ++  AE LV GDIIDVKFGDRVPADIRVI+ASSFKVDNSALTGESE Q R++E+TN+NPLETKN+AFFSTNAVEGTC+GVV++TGD TVMGRIANLASGLEMG TPIA+EI HFIHIITGVAVFLGV+FF+IAFILGY+WLDAVIFLIGIIVANVPEGLLATVTVCLTLTAK+MA KNCLVKNLEAVETLGSTSTICSDKTGTLTQNRMTVAHMWFDNKI E+DTS++Q T++  + S TW  L+R+AMLCNRA+FK GEE  PVLKREC GDASESALLKCV LSIGGVT YR +  K+ EIPFNSTNKYQVS+H+T DG++ YL+ MKGAPERIL+RCST+L++G+E+ MDD WR+ FNNAYLELGG+GERVLGFCD RL  + FPRGF F+ DE NFP++G+ FVGLMSMIDPPRAAVPDAV+KCRSAGIKV+MVTGDHPITAKAIAKGVGIIS+GNKTV+DIAAERG+  S+VNPR+A ACV+HGSDLRDM+  Q+DE+L++H EIVFARTSPQQKLIIVEG QR GAIVAVTGDGVNDSPALKKADIGVAMGI GSDVSKQAADMILLDDNFASIVTGVEEGRIIFDNLKKSIAYTLTSNIPEITPFL+FILADVPLPLGTITILCIDLGTDMVPAISLAYEEAE DIMKR PRDP  DKLVNERLISMAYGQIGMIQASGGFFVYFVIMAE GFWPSRLLGLRK+WDS A+ND+ADSYGQEWT+ QRK+LEYTCHTAFF SIVIVQWTDL+ICKTR+NSI+QQGMWNH +TFGLFFETTLA FL+YCPGL+  L+M PLR+TWWLP +PFS SIFI+DE+RK  LR    G+W+E ET Y
Sbjct:   29 ELAMDEHQISLDELYARLGTNPDTGLTSEQAKTRLDRDGPNALTPPKTTPEWVKFCKNMFGGFSLLLWIGAVLCFIAHGIPCWCAGEPYLYDNLYLGIVLAAVVVITGCFSYYQESKSSKIMESFAKLVPQYAVVIRGGQRIDAPAEALVVGDIIDVKFGDRVPADIRVIKASSFKVDNSALTGESEPQTRTAEYTNENPLETKNLAFFSTNAVEGTCRGVVVATGDRTVMGRIANLASGLEMGATPIAREIAHFIHIITGVAVFLGVTFFIIAFILGYYWLDAVIFLIGIIVANVPEGLLATVTVCLTLTAKRMASKNCLVKNLEAVETLGSTSTICSDKTGTLTQNRMTVAHMWFDNKIFEADTSDDQSTANYSRASSTWMALSRIAMLCNRAEFKPGEETNPVLKRECNGDASESALLKCVGLSIGGVTGYRTDKPKVAEIPFNSTNKYQVSVHQTDDGDERYLVVMKGAPERILDRCSTVLMEGQELHMDDQWRESFNNAYLELGGIGERVLGFCDLRLPADKFPRGFKFDIDEPNFPIEGMPFVGLMSMIDPPRAAVPDAVSKCRSAGIKVVMVTGDHPITAKAIAKGVGIISDGNKTVEDIAAERGVPVSQVNPREASACVVHGSDLRDMTPAQIDEILENHSEIVFARTSPQQKLIIVEGIQRMGAIVAVTGDGVNDSPALKKADIGVAMGITGSDVSKQAADMILLDDNFASIVTGVEEGRIIFDNLKKSIAYTLTSNIPEITPFLIFILADVPLPLGTITILCIDLGTDMVPAISLAYEEAE-DIMKRMPRDPFRDKLVNERLISMAYGQIGMIQASGGFFVYFVIMAENGFWPSRLLGLRKQWDSPAINDVADSYGQEWTYTQRKRLEYTCHTAFFASIVIVQWTDLLICKTRKNSIYQQGMWNHHLTFGLFFETTLAIFLSYCPGLEHGLRMMPLRWTWWLPVLPFSVSIFIFDEVRKKFLRTLPPGNWVERETNY 1014          
BLAST of non-gastric H ,K -ATPase alpha subunit vs. UniProt/SwissProt
Match: sp|P13607|ATNA_DROME (Sodium/potassium-transporting ATPase subunit alpha OS=Drosophila melanogaster OX=7227 GN=Atpalpha PE=1 SV=3)

HSP 1 Score: 1521.91 bits (3939), Expect = 0.000e+0
Identity = 753/987 (76.29%), Postives = 856/987 (86.73%), Query Frame = 1
Query:  181 ELDIDSHKISIKDLYIRLQTDPEKGLSIEEAKIRLARDGPNALTPPKTTPEWVKFCRQLFGGFSLLLWIGAALCFLAYAILSGAYEDPPKDNLYLGIVLTAVVVITGCFSYYQEAKSSKIMESFGKMVPQKANVIRDGKILEIAAENLVTGDIIDVKFGDRVPADIRVIQASSFKVDNSALTGESEAQVRSSEFTNDNPLETKNIAFFSTNAVEGTCKGVVISTGDNTVMGRIANLASGLEMGMTPIAKEINHFIHIITGVAVFLGVSFFVIAFILGYFWLDAVIFLIGIIVANVPEGXXXXXXXXXXXXXKKMAKKNCLVKNLEAVETLGSTSTICSDKTGTLTQNRMTVAHMWFDNKIQESDTSENQITSSTKQESETWKMLARVAMLCNRAQFKSGEEEKPVLKRECTGDASESALLKCVELSIGGVTKYRGENKKIVEIPFNSTNKYQVSIHETSDGNQG-YLLAMKGAPERILERCSTILIDGKEMEMDDHWRQEFNNAYLELGGMGERVLGFCDYRLDENNFPRGFDFNPDEVNFPLDGLRFVGLMSMIXXXXXXXXXXXXKCRSAGIKVIMVTGDHPITAKAIAKGVGIISEGNKTVDDIAAERGISPSEVNPRDARACVIHGSDLRDMSSEQLDEVLKHHDEIVFARTSPQQKLIIVEGCQRQGAIVAVTGDGVNDSPALKKADIGVAMGIAGSDVSKQAADMILLDDNFASIVTGVEEGRIIFDNLKKSIAYTLTSNIPEITPFLVFILADVPLPLGTITILCIDLGTDMVPAISLAYEEAESDIMKRKPRDPKHDKLVNERLISMAYGQIGMIQASGGFFVYFVIMAEQGFWPSRLLGLRKEWDSAAVNDLADSYGQEWTFDQRKKLEYTCHTAFFVSIVIVQWTDLMICKTRRNSIFQQGMWNHQMTFGLFFETTLAAFLTYCPGLDVALKMQPLRFTWWLPAIPFSASIFIYDEIRKFLLRKWKNGSWLENETYY 3138
            ELDID HKIS ++LY R QT PE GLS  +AK  L RDGPNALTPPK TPEWVKFC+ LFGGF++LLWIGA LCF+AY+I +   E+P  DNLYLGIVL+AVV++TG FSYYQE+KSSKIMESF  MVPQ A VIR+G+ L + AE+LV GD+++VKFGDR+PADIR+I+A +FKVDNS+LTGESE Q R +EFT++NPLETKN+AFFSTNAVEGT KGVVIS GD+TVMGRIA LASGL+ G TPIAKEI+HFIH+ITGVAVFLGV+FFVIAFILGY WLDAVIFLIGIIVANVPEGLLATVTVCLTLTAK+MA KNCLVKNLEAVETLGSTSTICSDKTGTLTQNRMTVAHMWFDN+I E+DT+E+Q      + S  +K L+R+A LCNRA+FK G++  P+LK+E +GDASE+ALLKC+EL++G V   R  NKKI E+PFNSTNKYQVSIHET D N   YLL MKGAPERILERCSTI I+GKE  +D+  ++ FNNAY+ELGG+GERVLGFCD+ L  + +P GF FN D++NFP+D LRFVGLMSMIDPPRAAVPDAVAKCRSAGIKVIMVTGDHPITAKAIAK VGIISEGN+TV+DIA    I  SEVNPR+A+A V+HG++LRD+SS+QLDE+L++H EIVFARTSPQQKLIIVEGCQR GAIVAVTGDGVNDSPALKKADIGVAMGIAGSDVSKQAADMILLDDNFASIVTGVEEGR+IFDNLKKSIAYTLTSNIPEI+PFL FIL D+PLPLGT+TILCIDLGTDMVPAISLAYE AE+DIMKR PRDP +DKLVN RLISMAYGQIGMIQA+ GFFVYFVIMAE GF P +L G+RK WDS AVNDL DSYGQEWT+  RK LEYTCHTAFF+SIV+VQW DL+ICKTRRNSIFQQGM N  + FGL FET LAAFL+YCPG++  L+M PL+  WW PAIPF+ +IFIYDE R+F LR+   G WLE ETYY
Sbjct:   56 ELDIDFHKISPEELYQRFQTHPENGLSHAKAKENLERDGPNALTPPKQTPEWVKFCKNLFGGFAMLLWIGAILCFVAYSIQASTSEEPADDNLYLGIVLSAVVIVTGIFSYYQESKSSKIMESFKNMVPQFATVIREGEKLTLRAEDLVLGDVVEVKFGDRIPADIRIIEARNFKVDNSSLTGESEPQSRGAEFTHENPLETKNLAFFSTNAVEGTAKGVVISCGDHTVMGRIAGLASGLDTGETPIAKEIHHFIHLITGVAVFLGVTFFVIAFILGYHWLDAVIFLIGIIVANVPEGLLATVTVCLTLTAKRMASKNCLVKNLEAVETLGSTSTICSDKTGTLTQNRMTVAHMWFDNQIIEADTTEDQSGVQYDRTSPGFKALSRIATLCNRAEFKGGQDGVPILKKEVSGDASEAALLKCMELALGDVMNIRKRNKKIAEVPFNSTNKYQVSIHETEDTNDPRYLLVMKGAPERILERCSTIFINGKEKVLDEEMKEAFNNAYMELGGLGERVLGFCDFMLPSDKYPNGFKFNTDDINFPIDNLRFVGLMSMIDPPRAAVPDAVAKCRSAGIKVIMVTGDHPITAKAIAKSVGIISEGNETVEDIAQRLNIPVSEVNPREAKAAVVHGAELRDVSSDQLDEILRYHTEIVFARTSPQQKLIIVEGCQRMGAIVAVTGDGVNDSPALKKADIGVAMGIAGSDVSKQAADMILLDDNFASIVTGVEEGRLIFDNLKKSIAYTLTSNIPEISPFLAFILCDIPLPLGTVTILCIDLGTDMVPAISLAYEHAEADIMKRPPRDPFNDKLVNSRLISMAYGQIGMIQAAAGFFVYFVIMAENGFLPKKLFGIRKMWDSKAVNDLTDSYGQEWTYRDRKTLEYTCHTAFFISIVVVQWADLIICKTRRNSIFQQGMRNWALNFGLVFETVLAAFLSYCPGMEKGLRMYPLKLVWWFPAIPFALAIFIYDETRRFYLRR-NPGGWLEQETYY 1041          
BLAST of non-gastric H ,K -ATPase alpha subunit vs. UniProt/SwissProt
Match: sp|D2WKD8|AT1A2_PIG (Sodium/potassium-transporting ATPase subunit alpha-2 OS=Sus scrofa OX=9823 GN=ATP1A2 PE=1 SV=1)

HSP 1 Score: 1487.63 bits (3850), Expect = 0.000e+0
Identity = 732/986 (74.24%), Postives = 846/986 (85.80%), Query Frame = 1
Query:  181 ELDIDSHKISIKDLYIRLQTDPEKGLSIEEAKIRLARDGPNALTPPKTTPEWVKFCRQLFGGFSLLLWIGAALCFLAYAILSGAYEDPPKDNLYLGIVLTAVVVITGCFSYYQEAKSSKIMESFGKMVPQKANVIRDGKILEIAAENLVTGDIIDVKFGDRVPADIRVIQASSFKVDNSALTGESEAQVRSSEFTNDNPLETKNIAFFSTNAVEGTCKGVVISTGDNTVMGRIANLASGLEMGMTPIAKEINHFIHIITGVAVFLGVSFFVIAFILGYFWLDAVIFLIGIIVANVPEGXXXXXXXXXXXXXKKMAKKNCLVKNLEAVETLGSTSTICSDKTGTLTQNRMTVAHMWFDNKIQESDTSENQITSSTKQESETWKMLARVAMLCNRAQFKSGEEEKPVLKRECTGDASESALLKCVELSIGGVTKYRGENKKIVEIPFNSTNKYQVSIHETSDGNQGYLLAMKGAPERILERCSTILIDGKEMEMDDHWRQEFNNAYLELGGMGERVLGFCDYRLDENNFPRGFDFNPDEVNFPLDGLRFVGLMSMIXXXXXXXXXXXXKCRSAGIKVIMVTGDHPITAKAIAKGVGIISEGNKTVDDIAAERGISPSEVNPRDARACVIHGSDLRDMSSEQLDEVLKHHDEIVFARTSPQQKLIIVEGCQRQGAIVAVTGDGVNDSPALKKADIGVAMGIAGSDVSKQAADMILLDDNFASIVTGVEEGRIIFDNLKKSIAYTLTSNIPEITPFLVFILADVPLPLGTITILCIDLGTDMVPAISLAYEEAESDIMKRKPRDPKHDKLVNERLISMAYGQIGMIQASGGFFVYFVIMAEQGFWPSRLLGLRKEWDSAAVNDLADSYGQEWTFDQRKKLEYTCHTAFFVSIVIVQWTDLMICKTRRNSIFQQGMWNHQMTFGLFFETTLAAFLTYCPGLDVALKMQPLRFTWWLPAIPFSASIFIYDEIRKFLLRKWKNGSWLENETYY 3138
            E+ +D HK+S+ +L  + Q D  KGL+ + A+  LARDGPNALTPP TTPEWVKFCRQLFGGFS+LLWIGA LCFLAY I +   ++P  DNLYLG+VL AVV++TGCFSYYQEAKSSKIM+SF  MVPQ+A V+R+G+ ++I AE +V GD+++VK GDRVPAD+R+I +   KVDNS+LTGESE Q RS EFT++NPLET+NI FFSTN VEGT +G+VI+TGD TVMGRIA LASGLE+G TPIA EI HFI +ITGVAVFLGVSFFV++ ILGY WL+AVIFLIGIIVANVPEGLLATVTVCLTLTAK+MA+KNCLVKNLEAVETLGSTSTICSDKTGTLTQNRMTVAHMWFDN+I E+DT+E+Q  ++  + S TW  L+R+A LCNRA FK+G+E   V KR+  GDASESALLKC+ELS G V K R  N K+ EIPFNSTNKYQ+SIHE  D  Q ++L MKGAPERIL+RCS+IL+ GKE+ +D   +  F NAYLELGG+GERVLGFC   L    FPRGF F+ DE+NFP + L FVGLMSMIDPPRAAVPDAV KCRSAGIKVIMVTGDHPITAKAIAKGVGIISEGN+TV+DIAA   I  S+VNPR+A+ACV+HGSDL+DM+SEQLDE+LK+H EIVFARTSPQQKLIIVEGCQRQGAIVAVTGDGVNDSPALKKADIG+AMGIAGSDVSKQAADMILLDDNFASIVTGVEEGR+IFDNLKKSIAYTLTSNIPEITPFL+FI+A++PLPLGT+TILCIDLGTDMVPAISLAYE AESDIMKR+PR+P+ DKLVNERLISMAYGQIGMIQA GGFF YFVI+AE GF PSRLLG+R +WD  ++NDL DSYGQEWT++QRK +E+TCHTAFF SIV+VQW DL+ICKTRRNS+FQQGM N  + FGL  ET LAAFL+YCPG+ VAL+M PL+ TWW  A P+S  IFIYDE+RK +LR++  G W+E ETYY
Sbjct:   36 EVAMDDHKLSLDELGRKYQVDLSKGLTNQRAQDILARDGPNALTPPPTTPEWVKFCRQLFGGFSILLWIGAILCFLAYGIQAAMEDEPSNDNLYLGVVLAAVVIVTGCFSYYQEAKSSKIMDSFKNMVPQQALVVREGEKMQINAEEVVVGDLVEVKGGDRVPADLRIISSHGCKVDNSSLTGESEPQTRSPEFTHENPLETRNICFFSTNCVEGTARGIVIATGDRTVMGRIATLASGLEVGRTPIAMEIEHFIQLITGVAVFLGVSFFVLSLILGYSWLEAVIFLIGIIVANVPEGLLATVTVCLTLTAKRMARKNCLVKNLEAVETLGSTSTICSDKTGTLTQNRMTVAHMWFDNQIHEADTTEDQSGATFDKRSPTWTALSRIAGLCNRAVFKAGQENISVSKRDTAGDASESALLKCIELSCGSVRKMRDRNPKVAEIPFNSTNKYQLSIHEREDNPQSHVLVMKGAPERILDRCSSILVQGKEIPLDKEMQDAFQNAYLELGGLGERVLGFCQLNLPSGKFPRGFKFDTDELNFPTEKLCFVGLMSMIDPPRAAVPDAVGKCRSAGIKVIMVTGDHPITAKAIAKGVGIISEGNETVEDIAARLNIPVSQVNPREAKACVVHGSDLKDMTSEQLDEILKNHTEIVFARTSPQQKLIIVEGCQRQGAIVAVTGDGVNDSPALKKADIGIAMGIAGSDVSKQAADMILLDDNFASIVTGVEEGRLIFDNLKKSIAYTLTSNIPEITPFLLFIIANIPLPLGTVTILCIDLGTDMVPAISLAYEAAESDIMKRQPRNPQTDKLVNERLISMAYGQIGMIQALGGFFTYFVILAENGFLPSRLLGIRLDWDDRSMNDLEDSYGQEWTYEQRKVVEFTCHTAFFASIVVVQWADLIICKTRRNSVFQQGMKNKILIFGLLEETALAAFLSYCPGMGVALRMYPLKVTWWFCAFPYSLLIFIYDEVRKLILRRYPGG-WVEKETYY 1020          
BLAST of non-gastric H ,K -ATPase alpha subunit vs. UniProt/SwissProt
Match: sp|A2VDL6|AT1A2_BOVIN (Sodium/potassium-transporting ATPase subunit alpha-2 OS=Bos taurus OX=9913 GN=ATP1A2 PE=1 SV=1)

HSP 1 Score: 1485.7 bits (3845), Expect = 0.000e+0
Identity = 731/986 (74.14%), Postives = 846/986 (85.80%), Query Frame = 1
Query:  181 ELDIDSHKISIKDLYIRLQTDPEKGLSIEEAKIRLARDGPNALTPPKTTPEWVKFCRQLFGGFSLLLWIGAALCFLAYAILSGAYEDPPKDNLYLGIVLTAVVVITGCFSYYQEAKSSKIMESFGKMVPQKANVIRDGKILEIAAENLVTGDIIDVKFGDRVPADIRVIQASSFKVDNSALTGESEAQVRSSEFTNDNPLETKNIAFFSTNAVEGTCKGVVISTGDNTVMGRIANLASGLEMGMTPIAKEINHFIHIITGVAVFLGVSFFVIAFILGYFWLDAVIFLIGIIVANVPEGXXXXXXXXXXXXXKKMAKKNCLVKNLEAVETLGSTSTICSDKTGTLTQNRMTVAHMWFDNKIQESDTSENQITSSTKQESETWKMLARVAMLCNRAQFKSGEEEKPVLKRECTGDASESALLKCVELSIGGVTKYRGENKKIVEIPFNSTNKYQVSIHETSDGNQGYLLAMKGAPERILERCSTILIDGKEMEMDDHWRQEFNNAYLELGGMGERVLGFCDYRLDENNFPRGFDFNPDEVNFPLDGLRFVGLMSMIXXXXXXXXXXXXKCRSAGIKVIMVTGDHPITAKAIAKGVGIISEGNKTVDDIAAERGISPSEVNPRDARACVIHGSDLRDMSSEQLDEVLKHHDEIVFARTSPQQKLIIVEGCQRQGAIVAVTGDGVNDSPALKKADIGVAMGIAGSDVSKQAADMILLDDNFASIVTGVEEGRIIFDNLKKSIAYTLTSNIPEITPFLVFILADVPLPLGTITILCIDLGTDMVPAISLAYEEAESDIMKRKPRDPKHDKLVNERLISMAYGQIGMIQASGGFFVYFVIMAEQGFWPSRLLGLRKEWDSAAVNDLADSYGQEWTFDQRKKLEYTCHTAFFVSIVIVQWTDLMICKTRRNSIFQQGMWNHQMTFGLFFETTLAAFLTYCPGLDVALKMQPLRFTWWLPAIPFSASIFIYDEIRKFLLRKWKNGSWLENETYY 3138
            E+ +D HK+S+ +L  + Q D  KGL+ + A+  LARDGPNALTPP TTPEWVKFCRQLFGGFS+LLWIGA LCFLA+ I +   ++P  DNLYLG+VL AVV++TGCFSYYQEAKSSKIM+SF  MVPQ+A V+R+G+ ++I AE +V GD+++VK GDRVPAD+R+I +   KVDNS+LTGESE Q RS EFT++NPLET+NI FFSTN VEGT +G+VI+TGD TVMGRIA LASGLE+G TPIA EI HFI +ITGVAVFLGVSFFV++ ILGY WL+AVIFLIGIIVANVPEGLLATVTVCLTLTAK+MA+KNCLVKNLEAVETLGSTSTICSDKTGTLTQNRMTVAHMWFDN+I E+DT+E+Q  ++  + S TW  L+R+A LCNRA FK+G+E   V KR+  GDASESALLKC+ELS G V K R  N K+ EIPFNSTNKYQ+SIHE  D  Q ++L MKGAPERIL+RCS+IL+ GKE+ +D   +  F NAYLELGG+GERVLGFC   L    FPRGF F+ DE+NFP + L FVGLMSMIDPPRAAVPDAV KCRSAGIKVIMVTGDHPITAKAIAKGVGIISEGN+TV+DIAA   I  S+VNPR+A+ACV+HGSDL+DM+SEQLDE+LK+H EIVFARTSPQQKLIIVEGCQRQGAIVAVTGDGVNDSPALKKADIG+AMGIAGSDVSKQAADMILLDDNFASIVTGVEEGR+IFDNLKKSIAYTLTSNIPEITPFL+FI+A++PLPLGT+TILCIDLGTDMVPAISLAYE AESDIMKR+PR+P+ DKLVNERLISMAYGQIGMIQA GGFF YFVI+AE GF PSRLLG+R +WD  ++NDL DSYGQEWT++QRK +E+TCHTAFF SIV+VQW DL+ICKTRRNS+FQQGM N  + FGL  ET LAAFL+YCPG+ VAL+M PL+ TWW  A P+S  IFIYDE+RK +LR++  G W+E ETYY
Sbjct:   36 EVAMDDHKLSLDELGRKYQVDLSKGLTNQRAQDILARDGPNALTPPPTTPEWVKFCRQLFGGFSILLWIGAILCFLAFGIQAAMEDEPSNDNLYLGVVLAAVVIVTGCFSYYQEAKSSKIMDSFKNMVPQQALVVREGEKMQINAEEVVVGDLVEVKGGDRVPADLRIISSHGCKVDNSSLTGESEPQTRSPEFTHENPLETRNICFFSTNCVEGTARGIVIATGDRTVMGRIATLASGLEVGRTPIAMEIEHFIQLITGVAVFLGVSFFVLSLILGYSWLEAVIFLIGIIVANVPEGLLATVTVCLTLTAKRMARKNCLVKNLEAVETLGSTSTICSDKTGTLTQNRMTVAHMWFDNQIHEADTTEDQSGATFDKRSPTWTALSRIAGLCNRAVFKAGQENISVSKRDTAGDASESALLKCIELSCGSVRKMRDRNPKVAEIPFNSTNKYQLSIHEREDSPQSHVLVMKGAPERILDRCSSILVQGKEIPLDKEMQDAFQNAYLELGGLGERVLGFCQLNLPSAKFPRGFKFDTDELNFPTEKLCFVGLMSMIDPPRAAVPDAVGKCRSAGIKVIMVTGDHPITAKAIAKGVGIISEGNETVEDIAARLNIPVSQVNPREAKACVVHGSDLKDMTSEQLDEILKNHTEIVFARTSPQQKLIIVEGCQRQGAIVAVTGDGVNDSPALKKADIGIAMGIAGSDVSKQAADMILLDDNFASIVTGVEEGRLIFDNLKKSIAYTLTSNIPEITPFLLFIIANIPLPLGTVTILCIDLGTDMVPAISLAYEAAESDIMKRQPRNPQTDKLVNERLISMAYGQIGMIQALGGFFTYFVILAENGFLPSRLLGIRLDWDDRSMNDLEDSYGQEWTYEQRKVVEFTCHTAFFASIVVVQWADLIICKTRRNSVFQQGMKNKILIFGLLEETALAAFLSYCPGMGVALRMYPLKVTWWFCAFPYSLLIFIYDEVRKLILRRYPGG-WVEKETYY 1020          
BLAST of non-gastric H ,K -ATPase alpha subunit vs. UniProt/SwissProt
Match: sp|P06686|AT1A2_RAT (Sodium/potassium-transporting ATPase subunit alpha-2 OS=Rattus norvegicus OX=10116 GN=Atp1a2 PE=1 SV=1)

HSP 1 Score: 1484.16 bits (3841), Expect = 0.000e+0
Identity = 732/986 (74.24%), Postives = 843/986 (85.50%), Query Frame = 1
Query:  181 ELDIDSHKISIKDLYIRLQTDPEKGLSIEEAKIRLARDGPNALTPPKTTPEWVKFCRQLFGGFSLLLWIGAALCFLAYAILSGAYEDPPKDNLYLGIVLTAVVVITGCFSYYQEAKSSKIMESFGKMVPQKANVIRDGKILEIAAENLVTGDIIDVKFGDRVPADIRVIQASSFKVDNSALTGESEAQVRSSEFTNDNPLETKNIAFFSTNAVEGTCKGVVISTGDNTVMGRIANLASGLEMGMTPIAKEINHFIHIITGVAVFLGVSFFVIAFILGYFWLDAVIFLIGIIVANVPEGXXXXXXXXXXXXXKKMAKKNCLVKNLEAVETLGSTSTICSDKTGTLTQNRMTVAHMWFDNKIQESDTSENQITSSTKQESETWKMLARVAMLCNRAQFKSGEEEKPVLKRECTGDASESALLKCVELSIGGVTKYRGENKKIVEIPFNSTNKYQVSIHETSDGNQGYLLAMKGAPERILERCSTILIDGKEMEMDDHWRQEFNNAYLELGGMGERVLGFCDYRLDENNFPRGFDFNPDEVNFPLDGLRFVGLMSMIXXXXXXXXXXXXKCRSAGIKVIMVTGDHPITAKAIAKGVGIISEGNKTVDDIAAERGISPSEVNPRDARACVIHGSDLRDMSSEQLDEVLKHHDEIVFARTSPQQKLIIVEGCQRQGAIVAVTGDGVNDSPALKKADIGVAMGIAGSDVSKQAADMILLDDNFASIVTGVEEGRIIFDNLKKSIAYTLTSNIPEITPFLVFILADVPLPLGTITILCIDLGTDMVPAISLAYEEAESDIMKRKPRDPKHDKLVNERLISMAYGQIGMIQASGGFFVYFVIMAEQGFWPSRLLGLRKEWDSAAVNDLADSYGQEWTFDQRKKLEYTCHTAFFVSIVIVQWTDLMICKTRRNSIFQQGMWNHQMTFGLFFETTLAAFLTYCPGLDVALKMQPLRFTWWLPAIPFSASIFIYDEIRKFLLRKWKNGSWLENETYY 3138
            E+ +D HK+S+ +L  + Q D  KGL+ + A+  LARDGPNALTPP TTPEWVKFCRQLFGGFS+LLWIGA LCFLAY IL+   ++P  DNLYLGIVL AVV++TGCFSYYQEAKSSKIM+SF  MVPQ+A VIR+G+ ++I AE +V GD+++VK GDRVPAD+R+I +   KVDNS+LTGESE Q RS EFT++NPLET+NI FFSTN VEGT +G+VI+TGD TVMGRIA LASGLE+G TPIA EI HFI +ITGVAVFLGVSFFV++ ILGY WL+AVIFLIGIIVANVPEGLLATVTVCLTLTAK+MA+KNCLVKNLEAVETLGSTSTICSDKTGTLTQNRMTVAHMWFDN+I E+DT+E+Q  ++  + S TW  L+R+A LCNRA FK+G+E   V KR+  GDASESALLKC+ELS G V K R  N K+ EIPFNSTNKYQ+SIHE  D  Q ++L MKGAPERIL+RCSTIL+ GKE+ +D   +  F NAY+ELGG+GERVLGFC   L    FPRGF F+ DE+NFP + L FVGLMSMIDPPRAAVPDAV KCRSAGIKVIMVTGDHPITAKAIAKGVGIISEGN+TV+DIAA   I  S+VNPR+A+ACV+HGSDL+DM+SEQLDE+L+ H EIVFARTSPQQKLIIVEGCQRQGAIVAVTGDGVNDSPALKKADIG+AMGI+GSDVSKQAADMILLDDNFASIVTGVEEGR+IFDNLKKSIAYTLTSNIPEITPFL+FI+A++PLPLGT+TILCIDLGTDMVPAISLAYE AESDIMKR+PR+ + DKLVNERLISMAYGQIGMIQA GGFF YFVI+AE GF PSRLLG+R +WD    NDL DSYGQEWT++QRK +E+TCHTAFF SIV+VQW DL+ICKTRRNS+FQQGM N  + FGL  ET LAAFL+YCPG+ VAL+M PL+ TWW  A P+S  IFIYDE+RK +LR++  G W+E ETYY
Sbjct:   36 EVAMDDHKLSLDELGRKYQVDLSKGLTNQRAQDILARDGPNALTPPPTTPEWVKFCRQLFGGFSILLWIGALLCFLAYGILAAMEDEPSNDNLYLGIVLAAVVIVTGCFSYYQEAKSSKIMDSFKNMVPQQALVIREGEKMQINAEEVVVGDLVEVKGGDRVPADLRIISSHGCKVDNSSLTGESEPQTRSPEFTHENPLETRNICFFSTNCVEGTARGIVIATGDRTVMGRIATLASGLEVGQTPIAMEIEHFIQLITGVAVFLGVSFFVLSLILGYSWLEAVIFLIGIIVANVPEGLLATVTVCLTLTAKRMARKNCLVKNLEAVETLGSTSTICSDKTGTLTQNRMTVAHMWFDNQIHEADTTEDQSGATFDKRSPTWTALSRIAGLCNRAVFKAGQENISVSKRDTAGDASESALLKCIELSCGSVRKMRDRNPKVAEIPFNSTNKYQLSIHEREDSPQSHVLVMKGAPERILDRCSTILVQGKEIPLDKEMQDAFQNAYMELGGLGERVLGFCQLNLPSGKFPRGFKFDTDELNFPTEKLCFVGLMSMIDPPRAAVPDAVGKCRSAGIKVIMVTGDHPITAKAIAKGVGIISEGNETVEDIAARLNIPVSQVNPREAKACVVHGSDLKDMTSEQLDEILRDHTEIVFARTSPQQKLIIVEGCQRQGAIVAVTGDGVNDSPALKKADIGIAMGISGSDVSKQAADMILLDDNFASIVTGVEEGRLIFDNLKKSIAYTLTSNIPEITPFLLFIIANIPLPLGTVTILCIDLGTDMVPAISLAYEAAESDIMKRQPRNSQTDKLVNERLISMAYGQIGMIQALGGFFTYFVILAENGFLPSRLLGIRLDWDDRTTNDLEDSYGQEWTYEQRKVVEFTCHTAFFASIVVVQWADLIICKTRRNSVFQQGMKNKILIFGLLEETALAAFLSYCPGMGVALRMYPLKVTWWFCAFPYSLLIFIYDEVRKLILRRYPGG-WVEKETYY 1020          
BLAST of non-gastric H ,K -ATPase alpha subunit vs. TrEMBL
Match: M4LUP7 (Sodium/potassium-transporting ATPase subunit alpha OS=Schmidtea mediterranea OX=79327 GN=ATP12A PE=2 SV=1)

HSP 1 Score: 1988.77 bits (5151), Expect = 0.000e+0
Identity = 1022/1022 (100.00%), Postives = 1022/1022 (100.00%), Query Frame = 1
Query:   73 MASDEKVNDXXXXXXXXXXXXXXXXXXXXXXXXXXXELDIDSHKISIKDLYIRLQTDPEKGLSIEEAKIRLARDGPNALTPPKTTPEWVKFCRQLFGGFSLLLWIGAALCFLAYAILSGAYEDPPKDNLYLGIVLTAVVVITGCFSYYQEAKSSKIMESFGKMVPQKANVIRDGKILEIAAENLVTGDIIDVKFGDRVPADIRVIQASSFKVDNSALTGESEAQVRSSEFTNDNPLETKNIAFFSTNAVEGTCKGVVISTGDNTVMGRIANLASGLEMGMTPIAKEINHFIHIITGVAVFLGVSFFVIAFILGYFWLDAVIFLIGIIVANVPEGXXXXXXXXXXXXXKKMAKKNCLVKNLEAVETLGSTSTICSDKTGTLTQNRMTVAHMWFDNKIQESDTSENQITSSTKQESETWKMLARVAMLCNRAQFKSGEEEKPVLKRECTGDASESALLKCVELSIGGVTKYRGENKKIVEIPFNSTNKYQVSIHETSDGNQGYLLAMKGAPERILERCSTILIDGKEMEMDDHWRQEFNNAYLELGGMGERVLGFCDYRLDENNFPRGFDFNPDEVNFPLDGLRFVGLMSMIXXXXXXXXXXXXKCRSAGIKVIMVTGDHPITAKAIAKGVGIISEGNKTVDDIAAERGISPSEVNPRDARACVIHGSDLRDMSSEQLDEVLKHHDEIVFARTSPQQKLIIVEGCQRQGAIVAVTGDGVNDSPALKKADIGVAMGIAGSDVSKQAADMILLDDNFASIVTGVEEGRIIFDNLKKSIAYTLTSNIPEITPFLVFILADVPLPLGTITILCIDLGTDMVPAISLAYEEAESDIMKRKPRDPKHDKLVNERLISMAYGQIGMIQASGGFFVYFVIMAEQGFWPSRLLGLRKEWDSAAVNDLADSYGQEWTFDQRKKLEYTCHTAFFVSIVIVQWTDLMICKTRRNSIFQQGMWNHQMTFGLFFETTLAAFLTYCPGLDVALKMQPLRFTWWLPAIPFSASIFIYDEIRKFLLRKWKNGSWLENETYY 3138
            MASDEKVNDKGDKKNLKSSPKKSKKDKKKDLDNLKKELDIDSHKISIKDLYIRLQTDPEKGLSIEEAKIRLARDGPNALTPPKTTPEWVKFCRQLFGGFSLLLWIGAALCFLAYAILSGAYEDPPKDNLYLGIVLTAVVVITGCFSYYQEAKSSKIMESFGKMVPQKANVIRDGKILEIAAENLVTGDIIDVKFGDRVPADIRVIQASSFKVDNSALTGESEAQVRSSEFTNDNPLETKNIAFFSTNAVEGTCKGVVISTGDNTVMGRIANLASGLEMGMTPIAKEINHFIHIITGVAVFLGVSFFVIAFILGYFWLDAVIFLIGIIVANVPEGLLATVTVCLTLTAKKMAKKNCLVKNLEAVETLGSTSTICSDKTGTLTQNRMTVAHMWFDNKIQESDTSENQITSSTKQESETWKMLARVAMLCNRAQFKSGEEEKPVLKRECTGDASESALLKCVELSIGGVTKYRGENKKIVEIPFNSTNKYQVSIHETSDGNQGYLLAMKGAPERILERCSTILIDGKEMEMDDHWRQEFNNAYLELGGMGERVLGFCDYRLDENNFPRGFDFNPDEVNFPLDGLRFVGLMSMIDPPRAAVPDAVAKCRSAGIKVIMVTGDHPITAKAIAKGVGIISEGNKTVDDIAAERGISPSEVNPRDARACVIHGSDLRDMSSEQLDEVLKHHDEIVFARTSPQQKLIIVEGCQRQGAIVAVTGDGVNDSPALKKADIGVAMGIAGSDVSKQAADMILLDDNFASIVTGVEEGRIIFDNLKKSIAYTLTSNIPEITPFLVFILADVPLPLGTITILCIDLGTDMVPAISLAYEEAESDIMKRKPRDPKHDKLVNERLISMAYGQIGMIQASGGFFVYFVIMAEQGFWPSRLLGLRKEWDSAAVNDLADSYGQEWTFDQRKKLEYTCHTAFFVSIVIVQWTDLMICKTRRNSIFQQGMWNHQMTFGLFFETTLAAFLTYCPGLDVALKMQPLRFTWWLPAIPFSASIFIYDEIRKFLLRKWKNGSWLENETYY
Sbjct:    1 MASDEKVNDKGDKKNLKSSPKKSKKDKKKDLDNLKKELDIDSHKISIKDLYIRLQTDPEKGLSIEEAKIRLARDGPNALTPPKTTPEWVKFCRQLFGGFSLLLWIGAALCFLAYAILSGAYEDPPKDNLYLGIVLTAVVVITGCFSYYQEAKSSKIMESFGKMVPQKANVIRDGKILEIAAENLVTGDIIDVKFGDRVPADIRVIQASSFKVDNSALTGESEAQVRSSEFTNDNPLETKNIAFFSTNAVEGTCKGVVISTGDNTVMGRIANLASGLEMGMTPIAKEINHFIHIITGVAVFLGVSFFVIAFILGYFWLDAVIFLIGIIVANVPEGLLATVTVCLTLTAKKMAKKNCLVKNLEAVETLGSTSTICSDKTGTLTQNRMTVAHMWFDNKIQESDTSENQITSSTKQESETWKMLARVAMLCNRAQFKSGEEEKPVLKRECTGDASESALLKCVELSIGGVTKYRGENKKIVEIPFNSTNKYQVSIHETSDGNQGYLLAMKGAPERILERCSTILIDGKEMEMDDHWRQEFNNAYLELGGMGERVLGFCDYRLDENNFPRGFDFNPDEVNFPLDGLRFVGLMSMIDPPRAAVPDAVAKCRSAGIKVIMVTGDHPITAKAIAKGVGIISEGNKTVDDIAAERGISPSEVNPRDARACVIHGSDLRDMSSEQLDEVLKHHDEIVFARTSPQQKLIIVEGCQRQGAIVAVTGDGVNDSPALKKADIGVAMGIAGSDVSKQAADMILLDDNFASIVTGVEEGRIIFDNLKKSIAYTLTSNIPEITPFLVFILADVPLPLGTITILCIDLGTDMVPAISLAYEEAESDIMKRKPRDPKHDKLVNERLISMAYGQIGMIQASGGFFVYFVIMAEQGFWPSRLLGLRKEWDSAAVNDLADSYGQEWTFDQRKKLEYTCHTAFFVSIVIVQWTDLMICKTRRNSIFQQGMWNHQMTFGLFFETTLAAFLTYCPGLDVALKMQPLRFTWWLPAIPFSASIFIYDEIRKFLLRKWKNGSWLENETYY 1022          
BLAST of non-gastric H ,K -ATPase alpha subunit vs. TrEMBL
Match: O76154 (Sodium/potassium-transporting ATPase subunit alpha OS=Dugesia japonica OX=6161 GN=Djnak PE=2 SV=1)

HSP 1 Score: 1917.51 bits (4966), Expect = 0.000e+0
Identity = 972/1022 (95.11%), Postives = 1007/1022 (98.53%), Query Frame = 1
Query:   73 MASDEKVNDXXXXXXXXXXXXXXXXXXXXXXXXXXXELDIDSHKISIKDLYIRLQTDPEKGLSIEEAKIRLARDGPNALTPPKTTPEWVKFCRQLFGGFSLLLWIGAALCFLAYAILSGAYEDPPKDNLYLGIVLTAVVVITGCFSYYQEAKSSKIMESFGKMVPQKANVIRDGKILEIAAENLVTGDIIDVKFGDRVPADIRVIQASSFKVDNSALTGESEAQVRSSEFTNDNPLETKNIAFFSTNAVEGTCKGVVISTGDNTVMGRIANLASGLEMGMTPIAKEINHFIHIITGVAVFLGVSFFVIAFILGYFWLDAVIFLIGIIVANVPEGXXXXXXXXXXXXXKKMAKKNCLVKNLEAVETLGSTSTICSDKTGTLTQNRMTVAHMWFDNKIQESDTSENQITSSTKQESETWKMLARVAMLCNRAQFKSGEEEKPVLKRECTGDASESALLKCVELSIGGVTKYRGENKKIVEIPFNSTNKYQVSIHETSDGNQGYLLAMKGAPERILERCSTILIDGKEMEMDDHWRQEFNNAYLELGGMGERVLGFCDYRLDENNFPRGFDFNPDEVNFPLDGLRFVGLMSMIXXXXXXXXXXXXKCRSAGIKVIMVTGDHPITAKAIAKGVGIISEGNKTVDDIAAERGISPSEVNPRDARACVIHGSDLRDMSSEQLDEVLKHHDEIVFARTSPQQKLIIVEGCQRQGAIVAVTGDGVNDSPALKKADIGVAMGIAGSDVSKQAADMILLDDNFASIVTGVEEGRIIFDNLKKSIAYTLTSNIPEITPFLVFILADVPLPLGTITILCIDLGTDMVPAISLAYEEAESDIMKRKPRDPKHDKLVNERLISMAYGQIGMIQASGGFFVYFVIMAEQGFWPSRLLGLRKEWDSAAVNDLADSYGQEWTFDQRKKLEYTCHTAFFVSIVIVQWTDLMICKTRRNSIFQQGMWNHQMTFGLFFETTLAAFLTYCPGLDVALKMQPLRFTWWLPAIPFSASIFIYDEIRKFLLRKWKNGSWLENETYY 3138
            MASDEKVNDKGD KNLK SPKKSKKDKKKDLDNLKKELDIDSH+I IKDLYIRLQ+DP+KG+S E+AK+RLARDGPNALTPPKTTPEWVKFC+QLFGGFSLLLWIGA LCFLAYAI SGAYEDPPKDNLYLG+VLTAVVVITGCFSYYQ+AKSSKIMESFGKMVPQKANVIR+GKI EI+AENLV GD+I+VKFGDRVPADIRVIQASSFKVDNSALTGESEAQVR+ EFTNDNPLETKNIAFFSTNAVEGTC+G+VIS GDNTVMGRIANLASGLEMGMTPIAKEINHFIHIITGVAVFLGVSFFVIAFILGYFWLDAVIFLIGIIVANVPEGLLATVTVCLTLTAK+MAKKNCLVKNLEAVETLGSTSTICSDKTGTLTQNRMTVAHMWFDNKIQESDTSENQITSS+KQES+TWKMLAR++MLCNRAQFK+GEE+KPVLKR+CTGDASESALLKCVELSIGGVTKYR ENKKIVEIPFNSTNKYQVSIHET+DGN GYL+AMKGAPERILERCSTILIDGKE+ MDDHW+QEFNNAYLELGGMGERVLGFCD+RLDEN FP+GF FNPDEVNFPLDGLRFVGLMSMIDPPRAAVPDAVAKCRSAGIKVIMVTGDHPITAKAIAKGVGIISEGN+TVDDIAAERGISPSEVNPRDARACVIHGSDLRDM+SEQLDEVLKHHDEIVFARTSPQQKLIIVEGCQRQGAIVAVTGDGVNDSPALKKADIGVAMGIAGSDVSKQAADMILLDDNFASIVTGVEEGRIIFDNLKKSIAYTLTSNIPEITPFLVFILADVPLPLGTITILCIDLGTDMVPAISLAYEEAESDIMKRKPRDPKHDKLVNERLISMAYGQIGMIQASGGFFVYFVIMAEQGFWPSRLLGLRKEWDSAAVNDLADSYGQEWTF+QRKKLEYTCHTAFFVSIVIVQWTDLMICKTRRNSIFQQGMWNHQMTFGLFFETTLAAFLTYCPGLDVALKMQPLRFTWWLPAIPFSASIFIYDE+RK+LLRKWKNGSWLENETYY
Sbjct:    1 MASDEKVNDKGDLKNLKGSPKKSKKDKKKDLDNLKKELDIDSHRIPIKDLYIRLQSDPDKGISYEDAKMRLARDGPNALTPPKTTPEWVKFCKQLFGGFSLLLWIGAVLCFLAYAIQSGAYEDPPKDNLYLGVVLTAVVVITGCFSYYQDAKSSKIMESFGKMVPQKANVIREGKISEISAENLVVGDVIEVKFGDRVPADIRVIQASSFKVDNSALTGESEAQVRTPEFTNDNPLETKNIAFFSTNAVEGTCRGIVISVGDNTVMGRIANLASGLEMGMTPIAKEINHFIHIITGVAVFLGVSFFVIAFILGYFWLDAVIFLIGIIVANVPEGLLATVTVCLTLTAKRMAKKNCLVKNLEAVETLGSTSTICSDKTGTLTQNRMTVAHMWFDNKIQESDTSENQITSSSKQESDTWKMLARISMLCNRAQFKAGEEDKPVLKRDCTGDASESALLKCVELSIGGVTKYREENKKIVEIPFNSTNKYQVSIHETNDGNPGYLIAMKGAPERILERCSTILIDGKEVHMDDHWKQEFNNAYLELGGMGERVLGFCDFRLDENEFPKGFKFNPDEVNFPLDGLRFVGLMSMIDPPRAAVPDAVAKCRSAGIKVIMVTGDHPITAKAIAKGVGIISEGNRTVDDIAAERGISPSEVNPRDARACVIHGSDLRDMTSEQLDEVLKHHDEIVFARTSPQQKLIIVEGCQRQGAIVAVTGDGVNDSPALKKADIGVAMGIAGSDVSKQAADMILLDDNFASIVTGVEEGRIIFDNLKKSIAYTLTSNIPEITPFLVFILADVPLPLGTITILCIDLGTDMVPAISLAYEEAESDIMKRKPRDPKHDKLVNERLISMAYGQIGMIQASGGFFVYFVIMAEQGFWPSRLLGLRKEWDSAAVNDLADSYGQEWTFEQRKKLEYTCHTAFFVSIVIVQWTDLMICKTRRNSIFQQGMWNHQMTFGLFFETTLAAFLTYCPGLDVALKMQPLRFTWWLPAIPFSASIFIYDEVRKYLLRKWKNGSWLENETYY 1022          
BLAST of non-gastric H ,K -ATPase alpha subunit vs. TrEMBL
Match: W6UUP9 (Sodium/potassium-transporting ATPase subunit alpha OS=Echinococcus granulosus OX=6210 GN=EGR_08003 PE=3 SV=1)

HSP 1 Score: 1659.04 bits (4295), Expect = 0.000e+0
Identity = 807/986 (81.85%), Postives = 901/986 (91.38%), Query Frame = 1
Query:  181 ELDIDSHKISIKDLYIRLQTDPEKGLSIEEAKIRLARDGPNALTPPKTTPEWVKFCRQLFGGFSLLLWIGAALCFLAYAILSGAYEDPPKDNLYLGIVLTAVVVITGCFSYYQEAKSSKIMESFGKMVPQKANVIRDGKILEIAAENLVTGDIIDVKFGDRVPADIRVIQASSFKVDNSALTGESEAQVRSSEFTNDNPLETKNIAFFSTNAVEGTCKGVVISTGDNTVMGRIANLASGLEMGMTPIAKEINHFIHIITGVAVFLGVSFFVIAFILGYFWLDAVIFLIGIIVANVPEGXXXXXXXXXXXXXKKMAKKNCLVKNLEAVETLGSTSTICSDKTGTLTQNRMTVAHMWFDNKIQESDTSENQITSSTKQESETWKMLARVAMLCNRAQFKSGEEEKPVLKRECTGDASESALLKCVELSIGGVTKYRGENKKIVEIPFNSTNKYQVSIHETSDGNQGYLLAMKGAPERILERCSTILIDGKEMEMDDHWRQEFNNAYLELGGMGERVLGFCDYRLDENNFPRGFDFNPDEVNFPLDGLRFVGLMSMIXXXXXXXXXXXXKCRSAGIKVIMVTGDHPITAKAIAKGVGIISEGNKTVDDIAAERGISPSEVNPRDARACVIHGSDLRDMSSEQLDEVLKHHDEIVFARTSPQQKLIIVEGCQRQGAIVAVTGDGVNDSPALKKADIGVAMGIAGSDVSKQAADMILLDDNFASIVTGVEEGRIIFDNLKKSIAYTLTSNIPEITPFLVFILADVPLPLGTITILCIDLGTDMVPAISLAYEEAESDIMKRKPRDPKHDKLVNERLISMAYGQIGMIQASGGFFVYFVIMAEQGFWPSRLLGLRKEWDSAAVNDLADSYGQEWTFDQRKKLEYTCHTAFFVSIVIVQWTDLMICKTRRNSIFQQGMWNHQMTFGLFFETTLAAFLTYCPGLDVALKMQPLRFTWWLPAIPFSASIFIYDEIRKFLLRKWKNGSWLENETYY 3138
            EL +D H+IS+ +LY RL T+P+ GL+ E+AK RL RDGPNALTPPKTTPEWVKFC+ +FGGFSLLLWIGA LCF+A+ IL+G  E+P  DNLYLGIVL AVVVITGCFSYYQE+KSSKIMESF K+VPQ A VIR G+ ++  AE LV GDIIDVKFGDRVPADIRVI+ASSFKVDNSALTGESE Q R++E+TN+NPLETKN+AFFSTNAVEGTC+GVV++TGD TVMGRIANLASGLEMG TPIA+EI HFIHIITGVAVFLGV+FF+IAFILGY+WLDAVIFLIGIIVANVPEGLLATVTVCLTLTAK+MA KNCLVKNLEAVETLGSTSTICSDKTGTLTQNRMTVAHMWFDNKI E+DTS++Q T++  ++S TW  L+R+AMLCNRA+FK GEE KPVLKREC GDASESALLKCVELSIGGVTKYR +N K+ EIPFNSTNKYQVS+H+TSDG++ YL+ MKGAPERIL+RCSTIL++G+E+ MDD WR+ FNNAYLELGG+GERVLGFCD RL  + FPRGF F+ DE NFP++G+RFVGLMSMIDPPRAAVPDAV+KCRSAGIKV+MVTGDHPITAKAIAKGVGIIS+GNKTV+DIAAERG+  ++VNPR+A ACV+HGSDLRDM+  Q+DE+L++H EIVFARTSPQQKLIIVEG QR GAIVAVTGDGVNDSPALKKADIGVAMGI GSDVSKQAADMILLDDNFASIVTGVEEGRIIFDNLKKSIAYTLTSNIPEITPFL+FILADVPLPLGTITILCIDLGTDMVPAISLAYEEAESDIMKR PRDP  DKLVNERLISMAYGQIGMIQASGGFFVYFVIMAE GFWPSRLLGLRK+WDS A+ND+ADSYGQEWT+ QRK+LEYTCHTAFF SIVIVQWTDL+ICKTR+NSIFQQGMWNH +TFGLFFETTLA FL+YCPGL+  L+M PLR+TWWLPA+PFS SIFI+DE+RK LLR    G+W+E ETYY
Sbjct:   29 ELAMDEHQISLDELYARLGTNPDTGLTSEQAKTRLDRDGPNALTPPKTTPEWVKFCKNMFGGFSLLLWIGAVLCFIAHGILAGVQENPTNDNLYLGIVLAAVVVITGCFSYYQESKSSKIMESFAKLVPQYAVVIRGGQRIDAPAEALVVGDIIDVKFGDRVPADIRVIKASSFKVDNSALTGESEPQTRTAEYTNENPLETKNLAFFSTNAVEGTCRGVVVATGDRTVMGRIANLASGLEMGATPIAREIAHFIHIITGVAVFLGVTFFIIAFILGYYWLDAVIFLIGIIVANVPEGLLATVTVCLTLTAKRMASKNCLVKNLEAVETLGSTSTICSDKTGTLTQNRMTVAHMWFDNKIFEADTSDDQSTANYSRDSSTWMALSRIAMLCNRAEFKPGEENKPVLKRECNGDASESALLKCVELSIGGVTKYRADNPKVAEIPFNSTNKYQVSVHQTSDGDERYLVVMKGAPERILDRCSTILMEGQELHMDDQWRESFNNAYLELGGIGERVLGFCDLRLPADKFPRGFKFDVDEQNFPIEGMRFVGLMSMIDPPRAAVPDAVSKCRSAGIKVVMVTGDHPITAKAIAKGVGIISDGNKTVEDIAAERGVPVNQVNPREASACVVHGSDLRDMTPAQIDEILENHSEIVFARTSPQQKLIIVEGFQRMGAIVAVTGDGVNDSPALKKADIGVAMGITGSDVSKQAADMILLDDNFASIVTGVEEGRIIFDNLKKSIAYTLTSNIPEITPFLIFILADVPLPLGTITILCIDLGTDMVPAISLAYEEAESDIMKRMPRDPFRDKLVNERLISMAYGQIGMIQASGGFFVYFVIMAENGFWPSRLLGLRKQWDSPAINDVADSYGQEWTYTQRKRLEYTCHTAFFASIVIVQWTDLLICKTRKNSIFQQGMWNHHLTFGLFFETTLAIFLSYCPGLEHGLRMMPLRWTWWLPALPFSVSIFIFDEVRKKLLRTLPPGNWVERETYY 1014          
BLAST of non-gastric H ,K -ATPase alpha subunit vs. TrEMBL
Match: A0A068WQ07 (Sodium/potassium-transporting ATPase subunit alpha OS=Echinococcus granulosus OX=6210 GN=EgrG_000342600 PE=3 SV=1)

HSP 1 Score: 1658.66 bits (4294), Expect = 0.000e+0
Identity = 807/986 (81.85%), Postives = 901/986 (91.38%), Query Frame = 1
Query:  181 ELDIDSHKISIKDLYIRLQTDPEKGLSIEEAKIRLARDGPNALTPPKTTPEWVKFCRQLFGGFSLLLWIGAALCFLAYAILSGAYEDPPKDNLYLGIVLTAVVVITGCFSYYQEAKSSKIMESFGKMVPQKANVIRDGKILEIAAENLVTGDIIDVKFGDRVPADIRVIQASSFKVDNSALTGESEAQVRSSEFTNDNPLETKNIAFFSTNAVEGTCKGVVISTGDNTVMGRIANLASGLEMGMTPIAKEINHFIHIITGVAVFLGVSFFVIAFILGYFWLDAVIFLIGIIVANVPEGXXXXXXXXXXXXXKKMAKKNCLVKNLEAVETLGSTSTICSDKTGTLTQNRMTVAHMWFDNKIQESDTSENQITSSTKQESETWKMLARVAMLCNRAQFKSGEEEKPVLKRECTGDASESALLKCVELSIGGVTKYRGENKKIVEIPFNSTNKYQVSIHETSDGNQGYLLAMKGAPERILERCSTILIDGKEMEMDDHWRQEFNNAYLELGGMGERVLGFCDYRLDENNFPRGFDFNPDEVNFPLDGLRFVGLMSMIXXXXXXXXXXXXKCRSAGIKVIMVTGDHPITAKAIAKGVGIISEGNKTVDDIAAERGISPSEVNPRDARACVIHGSDLRDMSSEQLDEVLKHHDEIVFARTSPQQKLIIVEGCQRQGAIVAVTGDGVNDSPALKKADIGVAMGIAGSDVSKQAADMILLDDNFASIVTGVEEGRIIFDNLKKSIAYTLTSNIPEITPFLVFILADVPLPLGTITILCIDLGTDMVPAISLAYEEAESDIMKRKPRDPKHDKLVNERLISMAYGQIGMIQASGGFFVYFVIMAEQGFWPSRLLGLRKEWDSAAVNDLADSYGQEWTFDQRKKLEYTCHTAFFVSIVIVQWTDLMICKTRRNSIFQQGMWNHQMTFGLFFETTLAAFLTYCPGLDVALKMQPLRFTWWLPAIPFSASIFIYDEIRKFLLRKWKNGSWLENETYY 3138
            EL +D H+IS+ +LY RL T+P+ GL+ E+AK RL RDGPNALTPPKTTPEWVKFC+ +FGGFSLLLWIGA LCF+A+ IL+G  E+P  DNLYLGIVL AVVVITGCFSYYQE+KSSKIMESF K+VPQ A VIR G+ ++  AE LV GDIIDVKFGDRVPADIRVI+ASSFKVDNSALTGESE Q R++E+TN+NPLETKN+AFFSTNAVEGTC+GVV++TGD TVMGRIANLASGLEMG TPIA+EI HFIHIITGVAVFLGV+FF+IAFILGY+WLDAVIFLIGIIVANVPEGLLATVTVCLTLTAK+MA KNCLVKNLEAVETLGSTSTICSDKTGTLTQNRMTVAHMWFDNKI E+DTS++Q T++  ++S TW  L+R+AMLCNRA+FK GEE KPVLKREC GDASESALLKCVELSIGGVTKYR +N K+ EIPFNSTNKYQVS+H+TSDG++ YL+ MKGAPERIL+RCSTIL++G+E+ MDD WR+ FNNAYLELGG+GERVLGFCD RL  + FPRGF F+ DE NFP++G+RFVGLMSMIDPPRAAVPDAV+KCRSAGIKV+MVTGDHPITAKAIAKGVGIIS+GNKTV+DIAAERG+  ++VNPR+A ACV+HGSDLRDM+  Q+DE+L++H EIVFARTSPQQKLIIVEG QR GAIVAVTGDGVNDSPALKKADIGVAMGI GSDVSKQAADMILLDDNFASIVTGVEEGRIIFDNLKKSIAYTLTSNIPEITPFL+FILADVPLPLGTITILCIDLGTDMVPAISLAYEEAESDIMKR PRDP  DKLVNERLISMAYGQIGMIQASGGFFVYFVIMAE GFWPSRLLGLRK+WDS A+ND+ADSYGQEWT+ QRK+LEYTCHTAFF SIVIVQWTDL+ICKTR+NSIFQQGMWNH +TFGLFFETTLA FL+YCPGL+  L+M PLR+TWWLPA+PFS SIFI+DE+RK LLR    G+W+E ETYY
Sbjct:   41 ELAMDEHQISLDELYARLGTNPDTGLTSEQAKTRLDRDGPNALTPPKTTPEWVKFCKNMFGGFSLLLWIGAVLCFIAHGILAGVQENPTNDNLYLGIVLAAVVVITGCFSYYQESKSSKIMESFAKLVPQYAVVIRGGQRIDAPAEALVVGDIIDVKFGDRVPADIRVIKASSFKVDNSALTGESEPQTRTAEYTNENPLETKNLAFFSTNAVEGTCRGVVVATGDRTVMGRIANLASGLEMGATPIAREIAHFIHIITGVAVFLGVTFFIIAFILGYYWLDAVIFLIGIIVANVPEGLLATVTVCLTLTAKRMASKNCLVKNLEAVETLGSTSTICSDKTGTLTQNRMTVAHMWFDNKIFEADTSDDQSTANYSRDSSTWMALSRIAMLCNRAEFKPGEENKPVLKRECNGDASESALLKCVELSIGGVTKYRADNPKVAEIPFNSTNKYQVSVHQTSDGDERYLVVMKGAPERILDRCSTILMEGQELHMDDQWRESFNNAYLELGGIGERVLGFCDLRLPADKFPRGFKFDVDEQNFPIEGMRFVGLMSMIDPPRAAVPDAVSKCRSAGIKVVMVTGDHPITAKAIAKGVGIISDGNKTVEDIAAERGVPVNQVNPREASACVVHGSDLRDMTPAQIDEILENHSEIVFARTSPQQKLIIVEGFQRMGAIVAVTGDGVNDSPALKKADIGVAMGITGSDVSKQAADMILLDDNFASIVTGVEEGRIIFDNLKKSIAYTLTSNIPEITPFLIFILADVPLPLGTITILCIDLGTDMVPAISLAYEEAESDIMKRMPRDPFRDKLVNERLISMAYGQIGMIQASGGFFVYFVIMAENGFWPSRLLGLRKQWDSPAINDVADSYGQEWTYTQRKRLEYTCHTAFFASIVIVQWTDLLICKTRKNSIFQQGMWNHHLTFGLFFETTLAIFLSYCPGLEHGLRMMPLRWTWWLPALPFSVSIFIFDEVRKKLLRTLPPGNWVERETYY 1026          
BLAST of non-gastric H ,K -ATPase alpha subunit vs. TrEMBL
Match: A0A068Y2K7 (Sodium/potassium-transporting ATPase subunit alpha OS=Echinococcus multilocularis OX=6211 GN=EmuJ_000342600 PE=3 SV=1)

HSP 1 Score: 1658.27 bits (4293), Expect = 0.000e+0
Identity = 806/986 (81.74%), Postives = 901/986 (91.38%), Query Frame = 1
Query:  181 ELDIDSHKISIKDLYIRLQTDPEKGLSIEEAKIRLARDGPNALTPPKTTPEWVKFCRQLFGGFSLLLWIGAALCFLAYAILSGAYEDPPKDNLYLGIVLTAVVVITGCFSYYQEAKSSKIMESFGKMVPQKANVIRDGKILEIAAENLVTGDIIDVKFGDRVPADIRVIQASSFKVDNSALTGESEAQVRSSEFTNDNPLETKNIAFFSTNAVEGTCKGVVISTGDNTVMGRIANLASGLEMGMTPIAKEINHFIHIITGVAVFLGVSFFVIAFILGYFWLDAVIFLIGIIVANVPEGXXXXXXXXXXXXXKKMAKKNCLVKNLEAVETLGSTSTICSDKTGTLTQNRMTVAHMWFDNKIQESDTSENQITSSTKQESETWKMLARVAMLCNRAQFKSGEEEKPVLKRECTGDASESALLKCVELSIGGVTKYRGENKKIVEIPFNSTNKYQVSIHETSDGNQGYLLAMKGAPERILERCSTILIDGKEMEMDDHWRQEFNNAYLELGGMGERVLGFCDYRLDENNFPRGFDFNPDEVNFPLDGLRFVGLMSMIXXXXXXXXXXXXKCRSAGIKVIMVTGDHPITAKAIAKGVGIISEGNKTVDDIAAERGISPSEVNPRDARACVIHGSDLRDMSSEQLDEVLKHHDEIVFARTSPQQKLIIVEGCQRQGAIVAVTGDGVNDSPALKKADIGVAMGIAGSDVSKQAADMILLDDNFASIVTGVEEGRIIFDNLKKSIAYTLTSNIPEITPFLVFILADVPLPLGTITILCIDLGTDMVPAISLAYEEAESDIMKRKPRDPKHDKLVNERLISMAYGQIGMIQASGGFFVYFVIMAEQGFWPSRLLGLRKEWDSAAVNDLADSYGQEWTFDQRKKLEYTCHTAFFVSIVIVQWTDLMICKTRRNSIFQQGMWNHQMTFGLFFETTLAAFLTYCPGLDVALKMQPLRFTWWLPAIPFSASIFIYDEIRKFLLRKWKNGSWLENETYY 3138
            EL +D H+IS+ +LY RL T+P+ GL+ E+AK RL RDGPNALTPPKTTPEWVKFC+ +FGGFSLLLWIGA LCF+A+ IL+G  E+P  DNLYLGIVL AVVVITGCFSYYQE+KSSKIMESF K+VPQ A VIR G+ ++  AE LV GD+IDVKFGDRVPADIRVI+ASSFKVDNSALTGESE Q R++E+TN+NPLETKN+AFFSTNAVEGTC+GVV++TGD TVMGRIANLASGLEMG TPIA+EI HFIHIITGVAVFLGV+FF+IAFILGY+WLDAVIFLIGIIVANVPEGLLATVTVCLTLTAK+MA KNCLVKNLEAVETLGSTSTICSDKTGTLTQNRMTVAHMWFDNKI E+DTS++Q T++  ++S TW  L+R+AMLCNRA+FK GEE KPVLKREC GDASESALLKCVELSIGGVTKYR +N K+ EIPFNSTNKYQVS+H+TSDG++ YL+ MKGAPERIL+RCSTIL++G+E+ MDD WR+ FNNAYLELGG+GERVLGFCD RL  + FPRGF F+ DE NFP++G+RFVGLMSMIDPPRAAVPDAV+KCRSAGIKV+MVTGDHPITAKAIAKGVGIIS+GNKTV+DIAAERG+  ++VNPR+A ACV+HGSDLRDM+  Q+DE+L++H EIVFARTSPQQKLIIVEG QR GAIVAVTGDGVNDSPALKKADIGVAMGI GSDVSKQAADMILLDDNFASIVTGVEEGRIIFDNLKKSIAYTLTSNIPEITPFL+FILADVPLPLGTITILCIDLGTDMVPAISLAYEEAESDIMKR PRDP  DKLVNERLISMAYGQIGMIQASGGFFVYFVIMAE GFWPSRLLGLRK+WDS A+ND+ADSYGQEWT+ QRK+LEYTCHTAFF SIVIVQWTDL+ICKTR+NSIFQQGMWNH +TFGLFFETTLA FL+YCPGL+  L+M PLR+TWWLPA+PFS SIFI+DE+RK LLR    G+W+E ETYY
Sbjct:   41 ELAMDEHQISLDELYARLGTNPDTGLTSEQAKTRLDRDGPNALTPPKTTPEWVKFCKNMFGGFSLLLWIGAVLCFIAHGILAGVQENPTNDNLYLGIVLAAVVVITGCFSYYQESKSSKIMESFAKLVPQYAVVIRGGQRIDAPAEALVVGDVIDVKFGDRVPADIRVIKASSFKVDNSALTGESEPQTRTAEYTNENPLETKNLAFFSTNAVEGTCRGVVVATGDRTVMGRIANLASGLEMGATPIAREIAHFIHIITGVAVFLGVTFFIIAFILGYYWLDAVIFLIGIIVANVPEGLLATVTVCLTLTAKRMASKNCLVKNLEAVETLGSTSTICSDKTGTLTQNRMTVAHMWFDNKIFEADTSDDQSTANYSRDSSTWMALSRIAMLCNRAEFKPGEENKPVLKRECNGDASESALLKCVELSIGGVTKYRADNPKVAEIPFNSTNKYQVSVHQTSDGDERYLVVMKGAPERILDRCSTILMEGQELHMDDQWRESFNNAYLELGGIGERVLGFCDLRLPADKFPRGFKFDVDEQNFPIEGMRFVGLMSMIDPPRAAVPDAVSKCRSAGIKVVMVTGDHPITAKAIAKGVGIISDGNKTVEDIAAERGVPVNQVNPREASACVVHGSDLRDMTPAQIDEILENHSEIVFARTSPQQKLIIVEGFQRMGAIVAVTGDGVNDSPALKKADIGVAMGITGSDVSKQAADMILLDDNFASIVTGVEEGRIIFDNLKKSIAYTLTSNIPEITPFLIFILADVPLPLGTITILCIDLGTDMVPAISLAYEEAESDIMKRMPRDPFRDKLVNERLISMAYGQIGMIQASGGFFVYFVIMAENGFWPSRLLGLRKQWDSPAINDVADSYGQEWTYTQRKRLEYTCHTAFFASIVIVQWTDLLICKTRKNSIFQQGMWNHHLTFGLFFETTLAIFLSYCPGLEHGLRMMPLRWTWWLPALPFSVSIFIFDEVRKKLLRTLPPGNWVERETYY 1026          
BLAST of non-gastric H ,K -ATPase alpha subunit vs. Ensembl Cavefish
Match: atp1a3a (sodium/potassium-transporting ATPase subunit alpha-3-like [Source:NCBI gene;Acc:103030580])

HSP 1 Score: 1474.53 bits (3816), Expect = 0.000e+0
Identity = 731/987 (74.06%), Postives = 847/987 (85.82%), Query Frame = 1
Query:  181 ELDIDSHKISIKDLYIRLQTDPEKGLSIEEAKIRLARDGPNALTPPKTTPEWVKFCRQLFGGFSLLLWIGAALCFLAYAILSGAYEDPPKDNLYLGIVLTAVVVITGCFSYYQEAKSSKIMESFGKMVPQKANVIRDGKILEIAAENLVTGDIIDVKFGDRVPADIRVIQASSFKVDNSALTGESEAQVRSSEFTNDNPLETKNIAFFSTNAVEGTCKGVVISTGDNTVMGRIANLASGLEMGMTPIAKEINHFIHIITGVAVFLGVSFFVIAFILGYFWLDAVIFLIGIIVANVPEGXXXXXXXXXXXXXKKMAKKNCLVKNLEAVETLGSTSTICSDKTGTLTQNRMTVAHMWFDNKIQESDTSENQITSSTKQESETWKMLARVAMLCNRAQFKSGEEEKPVLKRECTGDASESALLKCVELSIGGVTKYRGENKKIVEIPFNSTNKYQVSIHETSD-GNQGYLLAMKGAPERILERCSTILIDGKEMEMDDHWRQEFNNAYLELGGMGERVLGFCDYRLDENNFPRGFDFNPDEVNFPLDGLRFVGLMSMIXXXXXXXXXXXXKCRSAGIKVIMVTGDHPITAKAIAKGVGIISEGNKTVDDIAAERGISPSEVNPRDARACVIHGSDLRDMSSEQLDEVLKHHDEIVFARTSPQQKLIIVEGCQRQGAIVAVTGDGVNDSPALKKADIGVAMGIAGSDVSKQAADMILLDDNFASIVTGVEEGRIIFDNLKKSIAYTLTSNIPEITPFLVFILADVPLPLGTITILCIDLGTDMVPAISLAYEEAESDIMKRKPRDPKHDKLVNERLISMAYGQIGMIQASGGFFVYFVIMAEQGFWPSRLLGLRKEWDSAAVNDLADSYGQEWTFDQRKKLEYTCHTAFFVSIVIVQWTDLMICKTRRNSIFQQGMWNHQMTFGLFFETTLAAFLTYCPGLDVALKMQPLRFTWWLPAIPFSASIFIYDEIRKFLLRKWKNGSWLENETYY 3138
            E+ +  H++SI+++  +  TD  +GL+  +A   LARDGPNALTPP TTPEW+KFCRQLFGGFS+LLWIGA LCFLAYAI +   ++P  DNLYLGIVL+AVV+ITGCFSY+QEAKSSKIMESF  MVPQ+A VIR+G+ L+I AE +V GD+++VK GDR+PAD+R+I A   KVDNS+LTGESE Q RS + T+DNPLET+NIAFFSTN VEGT +G+V+ TGD TVMGRIA L SGLE G TPIAKEI HFI IITGVAVFLGV+FF+++ ILGY WL+AVIFLIGIIVANVPEGLLATVTVCLTLTAK+MA+KNCLVKNLEAVETLGSTSTICSDKTGTLTQNRMTVAHMWFDN+I E+DT+E+Q  +S  + S TW  LARVA LCNRA FK+G+E  P+LKR+  GDASESALLKC+ELS G V   R +NKK+ EIPFNSTNKYQ+S+HET +  +  YLL MKGAPERIL+RCSTI++ GKE  MD+  ++ F NAYLELGG+GERVLGFC   + E+ +P+GF F+ D+VNF  D + FVGLMSMIDPPRAAVPDAV KCRSAGIKVIMVTGDHPITAKAIAKGVGIISEGN+TV+DIAA   I  S+VNPRDA+ACVIHGSDL++++ EQ+D+VLK+H EIVFARTSPQQKLIIVEGCQRQGAIVAVTGDGVNDSPALKKADIGVAMGI+GSDVSKQAADMILLDDNFASIVTGVEEGR+IFDNLKKSIAYTLTSNIPEITPFL FIL ++PLPLGTITILCIDLGTDMVPAISLAYE AESDIMKR+PR+P  DKLVNERLIS+AYGQIGMIQA GGFF YFVIMAE GF PSRL+G+R  WD  + NDL DSYGQ+WT++QRK +E+TCHTAFFVSIV+VQW D++ICKTRRNS+FQQGM N  + FGLF ET LAAFL+YCPG+DVAL+M PL+ +WW  A P+S  IF+YDEIRK +LR+   G W+E ETYY
Sbjct:   37 EVPLTEHRMSIEEVCRKYNTDIVQGLTNAKAAEYLARDGPNALTPPPTTPEWIKFCRQLFGGFSILLWIGAILCFLAYAIQAATEDEPAGDNLYLGIVLSAVVIITGCFSYFQEAKSSKIMESFKNMVPQQALVIREGEKLQINAEEVVAGDLVEVKGGDRIPADLRIISAHGCKVDNSSLTGESEPQTRSPDCTHDNPLETRNIAFFSTNCVEGTARGIVVCTGDRTVMGRIATLTSGLETGKTPIAKEIEHFIQIITGVAVFLGVTFFILSIILGYSWLEAVIFLIGIIVANVPEGLLATVTVCLTLTAKRMARKNCLVKNLEAVETLGSTSTICSDKTGTLTQNRMTVAHMWFDNQIHEADTTEDQSGTSFDKTSVTWVSLARVAALCNRAVFKAGQESLPILKRDVAGDASESALLKCIELSCGSVKAMRDKNKKVAEIPFNSTNKYQLSVHETEEPSDNHYLLVMKGAPERILDRCSTIMVQGKEQPMDEEMKEAFQNAYLELGGLGERVLGFCHLFMPEDQYPKGFAFDTDDVNFKTDNMCFVGLMSMIDPPRAAVPDAVGKCRSAGIKVIMVTGDHPITAKAIAKGVGIISEGNETVEDIAARLNIPVSQVNPRDAKACVIHGSDLKELTQEQMDDVLKNHTEIVFARTSPQQKLIIVEGCQRQGAIVAVTGDGVNDSPALKKADIGVAMGISGSDVSKQAADMILLDDNFASIVTGVEEGRLIFDNLKKSIAYTLTSNIPEITPFLFFILVNIPLPLGTITILCIDLGTDMVPAISLAYEAAESDIMKRQPRNPLRDKLVNERLISIAYGQIGMIQALGGFFAYFVIMAENGFLPSRLVGIRLNWDDRSNNDLEDSYGQQWTYEQRKIVEFTCHTAFFVSIVVVQWADVIICKTRRNSVFQQGMKNKILIFGLFEETALAAFLSYCPGMDVALRMYPLKPSWWFCAFPYSFLIFVYDEIRKLILRR-NPGGWVEKETYY 1022          
BLAST of non-gastric H ,K -ATPase alpha subunit vs. Ensembl Cavefish
Match: atp1a3b (ATPase Na+/K+ transporting subunit alpha 3 [Source:NCBI gene;Acc:103034051])

HSP 1 Score: 1473.37 bits (3813), Expect = 0.000e+0
Identity = 730/987 (73.96%), Postives = 845/987 (85.61%), Query Frame = 1
Query:  181 ELDIDSHKISIKDLYIRLQTDPEKGLSIEEAKIRLARDGPNALTPPKTTPEWVKFCRQLFGGFSLLLWIGAALCFLAYAILSGAYEDPPKDNLYLGIVLTAVVVITGCFSYYQEAKSSKIMESFGKMVPQKANVIRDGKILEIAAENLVTGDIIDVKFGDRVPADIRVIQASSFKVDNSALTGESEAQVRSSEFTNDNPLETKNIAFFSTNAVEGTCKGVVISTGDNTVMGRIANLASGLEMGMTPIAKEINHFIHIITGVAVFLGVSFFVIAFILGYFWLDAVIFLIGIIVANVPEGXXXXXXXXXXXXXKKMAKKNCLVKNLEAVETLGSTSTICSDKTGTLTQNRMTVAHMWFDNKIQESDTSENQITSSTKQESETWKMLARVAMLCNRAQFKSGEEEKPVLKRECTGDASESALLKCVELSIGGVTKYRGENKKIVEIPFNSTNKYQVSIHETSDGNQG-YLLAMKGAPERILERCSTILIDGKEMEMDDHWRQEFNNAYLELGGMGERVLGFCDYRLDENNFPRGFDFNPDEVNFPLDGLRFVGLMSMIXXXXXXXXXXXXKCRSAGIKVIMVTGDHPITAKAIAKGVGIISEGNKTVDDIAAERGISPSEVNPRDARACVIHGSDLRDMSSEQLDEVLKHHDEIVFARTSPQQKLIIVEGCQRQGAIVAVTGDGVNDSPALKKADIGVAMGIAGSDVSKQAADMILLDDNFASIVTGVEEGRIIFDNLKKSIAYTLTSNIPEITPFLVFILADVPLPLGTITILCIDLGTDMVPAISLAYEEAESDIMKRKPRDPKHDKLVNERLISMAYGQIGMIQASGGFFVYFVIMAEQGFWPSRLLGLRKEWDSAAVNDLADSYGQEWTFDQRKKLEYTCHTAFFVSIVIVQWTDLMICKTRRNSIFQQGMWNHQMTFGLFFETTLAAFLTYCPGLDVALKMQPLRFTWWLPAIPFSASIFIYDEIRKFLLRKWKNGSWLENETYY 3138
            E+ +  HK+S++++  + QTD  +GL+  +A   L RDGPNALTPP TTPEWVKFCRQLFGGFS+LLW GA LCFLAYAI +   ++P  DNLYLGIVL+AVV+ITGCFSY+QEAKSSKIMESF  MVPQ+A VIR+G+ ++I AE +V GD+++VK GDR+PAD+R+I +   KVDNS+LTGESE Q RS + T+DNPLET+NIAFFSTN VEGT +G+V+ TGD TVMGRIA L SGLE G TPIAKEI HFIHIITGVAVFLG+SFF+++ ILGY WL+AVIFLIGIIVANVPEGLLATVTVCLTLTAK+MA+KNCLVKNLEAVETLGSTSTICSDKTGTLTQNRMTVAHMWFDN+I E+DT+E+Q  +S  + S TW  LARVA LCNRA FK+G++  P+LKR+  GDASESALLKC+ELS G V + R  NKK+ EIPFNSTNKYQ+SIHET + N   YLL MKGAPERIL+RCSTI+I GKE  MD+  ++ F NAYLELGG+GERVLGFC   + E+ +P+GF F+ D+VNF  D + FVGLMSMIDPPRAAVPDAV KCRSAGIKVIMVTGDHPITAKAIAKGVGIISEGN+TV+DIAA   I  S+VNPRDA+ACVIHG++L+DMS +Q+DE+L++H EIVFARTSPQQKLIIVEGCQRQGAIVAVTGDGVNDSPALKKADIGVAMGI+GSDVSKQAADMILLDDNFASIVTGVEEGR+IFDNLKKSIAYTLTSNIPEITPFL FI+ ++PLPLGTITILCIDLGTDMVPAISLAYE AESDIMKR+PR+P  DKLVNERLIS+AYGQIGMIQA GGFF YFVI+AE GF PS L+G+R  WD    NDL DSYGQ+WT++QRK +E+TCHTAFFVSIV+VQW DL+ICKTRRNS+FQQGM N  + FGLF ET LAAFL+YCPG+DVAL+M PL+ +WW  A P+S  IF+YDEIRK LLR+   G W+E ETYY
Sbjct:   39 EVPLTEHKMSVEEVCRKFQTDIVQGLTNAKAAEFLQRDGPNALTPPPTTPEWVKFCRQLFGGFSILLWTGAILCFLAYAIQAATEDEPAGDNLYLGIVLSAVVIITGCFSYFQEAKSSKIMESFKNMVPQQALVIREGEKMQINAEEVVAGDLVEVKGGDRIPADLRIISSHGCKVDNSSLTGESEPQTRSPDCTHDNPLETRNIAFFSTNCVEGTARGIVVCTGDRTVMGRIATLTSGLETGKTPIAKEIEHFIHIITGVAVFLGLSFFILSIILGYSWLEAVIFLIGIIVANVPEGLLATVTVCLTLTAKRMARKNCLVKNLEAVETLGSTSTICSDKTGTLTQNRMTVAHMWFDNQIHEADTTEDQSGASFDKTSVTWVSLARVASLCNRAVFKAGQDSLPILKRDVAGDASESALLKCIELSCGSVKQMRERNKKVAEIPFNSTNKYQLSIHETEEPNDNRYLLVMKGAPERILDRCSTIMIQGKEQPMDEEMKEAFQNAYLELGGLGERVLGFCHLLMPEDQYPKGFAFDTDDVNFQTDNMCFVGLMSMIDPPRAAVPDAVGKCRSAGIKVIMVTGDHPITAKAIAKGVGIISEGNETVEDIAARLNIPVSQVNPRDAKACVIHGTELKDMSQDQIDEILRNHTEIVFARTSPQQKLIIVEGCQRQGAIVAVTGDGVNDSPALKKADIGVAMGISGSDVSKQAADMILLDDNFASIVTGVEEGRLIFDNLKKSIAYTLTSNIPEITPFLFFIIVNIPLPLGTITILCIDLGTDMVPAISLAYEAAESDIMKRQPRNPMRDKLVNERLISIAYGQIGMIQALGGFFSYFVILAENGFLPSLLVGIRLSWDDRTANDLEDSYGQQWTYEQRKIVEFTCHTAFFVSIVVVQWADLIICKTRRNSVFQQGMKNKILIFGLFEETALAAFLSYCPGMDVALRMYPLKPSWWFCAFPYSFLIFVYDEIRKLLLRR-NPGGWVEKETYY 1024          
BLAST of non-gastric H ,K -ATPase alpha subunit vs. Ensembl Cavefish
Match: atp1a3a (sodium/potassium-transporting ATPase subunit alpha-3-like [Source:NCBI gene;Acc:103030580])

HSP 1 Score: 1462.97 bits (3786), Expect = 0.000e+0
Identity = 725/965 (75.13%), Postives = 833/965 (86.32%), Query Frame = 1
Query:  247 EKGLSIEEAKIRLARDGPNALTPPKTTPEWVKFCRQLFGGFSLLLWIGAALCFLAYAILSGAYEDPPKDNLYLGIVLTAVVVITGCFSYYQEAKSSKIMESFGKMVPQKANVIRDGKILEIAAENLVTGDIIDVKFGDRVPADIRVIQASSFKVDNSALTGESEAQVRSSEFTNDNPLETKNIAFFSTNAVEGTCKGVVISTGDNTVMGRIANLASGLEMGMTPIAKEINHFIHIITGVAVFLGVSFFVIAFILGYFWLDAVIFLIGIIVANVPEGXXXXXXXXXXXXXKKMAKKNCLVKNLEAVETLGSTSTICSDKTGTLTQNRMTVAHMWFDNKIQESDTSENQITSSTKQESETWKMLARVAMLCNRAQFKSGEEEKPVLKRECTGDASESALLKCVELSIGGVTKYRGENKKIVEIPFNSTNKYQVSIHETSD-GNQGYLLAMKGAPERILERCSTILIDGKEMEMDDHWRQEFNNAYLELGGMGERVLGFCDYRLDENNFPRGFDFNPDEVNFPLDGLRFVGLMSMIXXXXXXXXXXXXKCRSAGIKVIMVTGDHPITAKAIAKGVGIISEGNKTVDDIAAERGISPSEVNPRDARACVIHGSDLRDMSSEQLDEVLKHHDEIVFARTSPQQKLIIVEGCQRQGAIVAVTGDGVNDSPALKKADIGVAMGIAGSDVSKQAADMILLDDNFASIVTGVEEGRIIFDNLKKSIAYTLTSNIPEITPFLVFILADVPLPLGTITILCIDLGTDMVPAISLAYEEAESDIMKRKPRDPKHDKLVNERLISMAYGQIGMIQASGGFFVYFVIMAEQGFWPSRLLGLRKEWDSAAVNDLADSYGQEWTFDQRKKLEYTCHTAFFVSIVIVQWTDLMICKTRRNSIFQQGMWNHQMTFGLFFETTLAAFLTYCPGLDVALKMQPLRFTWWLPAIPFSASIFIYDEIRKFLLRKWKNGSWLENETYY 3138
            + GL+  +A   LARDGPNALTPP TTPEW+KFCRQLFGGFS+LLWIGA LCFLAYAI +   ++P  DNLYLGIVL+AVV+ITGCFSY+QEAKSSKIMESF  MVPQ+A VIR+G+ L+I AE +V GD+++VK GDR+PAD+R+I A   KVDNS+LTGESE Q RS + T+DNPLET+NIAFFSTN VEGT +G+V+ TGD TVMGRIA L SGLE G TPIAKEI HFI IITGVAVFLGV+FF+++ ILGY WL+AVIFLIGIIVANVPEGLLATVTVCLTLTAK+MA+KNCLVKNLEAVETLGSTSTICSDKTGTLTQNRMTVAHMWFDN+I E+DT+E+Q  +S  + S TW  LARVA LCNRA FK+G+E  P+LKR+  GDASESALLKC+ELS G V   R +NKK+ EIPFNSTNKYQ+S+HET +  +  YLL MKGAPERIL+RCSTI++ GKE  MD+  ++ F NAYLELGG+GERVLGFC   + E+ +P+GF F+ D+VNF  D + FVGLMSMIDPPRAAVPDAV KCRSAGIKVIMVTGDHPITAKAIAKGVGIISEGN+TV+DIAA   I  S+VNPRDA+ACVIHGSDL++++ EQ+D+VLK+H EIVFARTSPQQKLIIVEGCQRQGAIVAVTGDGVNDSPALKKADIGVAMGI+GSDVSKQAADMILLDDNFASIVTGVEEGR+IFDNLKKSIAYTLTSNIPEITPFL FIL ++PLPLGTITILCIDLGTDMVPAISLAYE AESDIMKR+PR+P  DKLVNERLIS+AYGQIGMIQA GGFF YFVIMAE GF PSRL+G+R  WD  + NDL DSYGQ+WT++QRK +E+TCHTAFFVSIV+VQW D++ICKTRRNS+FQQGM N  + FGLF ET LAAFL+YCPG+DVAL+M PL+ +WW  A P+S  IF+YDEIRK +LR+   G W+E ETYY
Sbjct:   53 KHGLTNAKAAEYLARDGPNALTPPPTTPEWIKFCRQLFGGFSILLWIGAILCFLAYAIQAATEDEPAGDNLYLGIVLSAVVIITGCFSYFQEAKSSKIMESFKNMVPQQALVIREGEKLQINAEEVVAGDLVEVKGGDRIPADLRIISAHGCKVDNSSLTGESEPQTRSPDCTHDNPLETRNIAFFSTNCVEGTARGIVVCTGDRTVMGRIATLTSGLETGKTPIAKEIEHFIQIITGVAVFLGVTFFILSIILGYSWLEAVIFLIGIIVANVPEGLLATVTVCLTLTAKRMARKNCLVKNLEAVETLGSTSTICSDKTGTLTQNRMTVAHMWFDNQIHEADTTEDQSGTSFDKTSVTWVSLARVAALCNRAVFKAGQESLPILKRDVAGDASESALLKCIELSCGSVKAMRDKNKKVAEIPFNSTNKYQLSVHETEEPSDNHYLLVMKGAPERILDRCSTIMVQGKEQPMDEEMKEAFQNAYLELGGLGERVLGFCHLFMPEDQYPKGFAFDTDDVNFKTDNMCFVGLMSMIDPPRAAVPDAVGKCRSAGIKVIMVTGDHPITAKAIAKGVGIISEGNETVEDIAARLNIPVSQVNPRDAKACVIHGSDLKELTQEQMDDVLKNHTEIVFARTSPQQKLIIVEGCQRQGAIVAVTGDGVNDSPALKKADIGVAMGISGSDVSKQAADMILLDDNFASIVTGVEEGRLIFDNLKKSIAYTLTSNIPEITPFLFFILVNIPLPLGTITILCIDLGTDMVPAISLAYEAAESDIMKRQPRNPLRDKLVNERLISIAYGQIGMIQALGGFFAYFVIMAENGFLPSRLVGIRLNWDDRSNNDLEDSYGQQWTYEQRKIVEFTCHTAFFVSIVVVQWADVIICKTRRNSVFQQGMKNKILIFGLFEETALAAFLSYCPGMDVALRMYPLKPSWWFCAFPYSFLIFVYDEIRKLILRR-NPGGWVEKETYY 1016          
BLAST of non-gastric H ,K -ATPase alpha subunit vs. Ensembl Cavefish
Match: atp1a3b (ATPase Na+/K+ transporting subunit alpha 3 [Source:NCBI gene;Acc:103034051])

HSP 1 Score: 1457.58 bits (3772), Expect = 0.000e+0
Identity = 723/963 (75.08%), Postives = 829/963 (86.09%), Query Frame = 1
Query:  253 GLSIEEAKIRLARDGPNALTPPKTTPEWVKFCRQLFGGFSLLLWIGAALCFLAYAILSGAYEDPPKDNLYLGIVLTAVVVITGCFSYYQEAKSSKIMESFGKMVPQKANVIRDGKILEIAAENLVTGDIIDVKFGDRVPADIRVIQASSFKVDNSALTGESEAQVRSSEFTNDNPLETKNIAFFSTNAVEGTCKGVVISTGDNTVMGRIANLASGLEMGMTPIAKEINHFIHIITGVAVFLGVSFFVIAFILGYFWLDAVIFLIGIIVANVPEGXXXXXXXXXXXXXKKMAKKNCLVKNLEAVETLGSTSTICSDKTGTLTQNRMTVAHMWFDNKIQESDTSENQITSSTKQESETWKMLARVAMLCNRAQFKSGEEEKPVLKRECTGDASESALLKCVELSIGGVTKYRGENKKIVEIPFNSTNKYQVSIHETSDGNQG-YLLAMKGAPERILERCSTILIDGKEMEMDDHWRQEFNNAYLELGGMGERVLGFCDYRLDENNFPRGFDFNPDEVNFPLDGLRFVGLMSMIXXXXXXXXXXXXKCRSAGIKVIMVTGDHPITAKAIAKGVGIISEGNKTVDDIAAERGISPSEVNPRDARACVIHGSDLRDMSSEQLDEVLKHHDEIVFARTSPQQKLIIVEGCQRQGAIVAVTGDGVNDSPALKKADIGVAMGIAGSDVSKQAADMILLDDNFASIVTGVEEGRIIFDNLKKSIAYTLTSNIPEITPFLVFILADVPLPLGTITILCIDLGTDMVPAISLAYEEAESDIMKRKPRDPKHDKLVNERLISMAYGQIGMIQASGGFFVYFVIMAEQGFWPSRLLGLRKEWDSAAVNDLADSYGQEWTFDQRKKLEYTCHTAFFVSIVIVQWTDLMICKTRRNSIFQQGMWNHQMTFGLFFETTLAAFLTYCPGLDVALKMQPLRFTWWLPAIPFSASIFIYDEIRKFLLRKWKNGSWLENETYY 3138
            GL+  +A   L RDGPNALTPP TTPEWVKFCRQLFGGFS+LLW GA LCFLAYAI +   ++P  DNLYLGIVL+AVV+ITGCFSY+QEAKSSKIMESF  MVPQ+A VIR+G+ ++I AE +V GD+++VK GDR+PAD+R+I +   KVDNS+LTGESE Q RS + T+DNPLET+NIAFFSTN VEGT +G+V+ TGD TVMGRIA L SGLE G TPIAKEI HFIHIITGVAVFLG+SFF+++ ILGY WL+AVIFLIGIIVANVPEGLLATVTVCLTLTAK+MA+KNCLVKNLEAVETLGSTSTICSDKTGTLTQNRMTVAHMWFDN+I E+DT+E+Q  +S  + S TW  LARVA LCNRA FK+G++  P+LKR+  GDASESALLKC+ELS G V + R  NKK+ EIPFNSTNKYQ+SIHET + N   YLL MKGAPERIL+RCSTI+I GKE  MD+  ++ F NAYLELGG+GERVLGFC   + E+ +P+GF F+ D+VNF  D + FVGLMSMIDPPRAAVPDAV KCRSAGIKVIMVTGDHPITAKAIAKGVGIISEGN+TV+DIAA   I  S+VNPRDA+ACVIHG++L+DMS +Q+DE+L++H EIVFARTSPQQKLIIVEGCQRQGAIVAVTGDGVNDSPALKKADIGVAMGI+GSDVSKQAADMILLDDNFASIVTGVEEGR+IFDNLKKSIAYTLTSNIPEITPFL FI+ ++PLPLGTITILCIDLGTDMVPAISLAYE AESDIMKR+PR+P  DKLVNERLIS+AYGQIGMIQA GGFF YFVI+AE GF PS L+G+R  WD    NDL DSYGQ+WT++QRK +E+TCHTAFFVSIV+VQW DL+ICKTRRNS+FQQGM N  + FGLF ET LAAFL+YCPG+DVAL+M PL+ +WW  A P+S  IF+YDEIRK LLR+   G W+E ETYY
Sbjct:   33 GLTNAKAAEFLQRDGPNALTPPPTTPEWVKFCRQLFGGFSILLWTGAILCFLAYAIQAATEDEPAGDNLYLGIVLSAVVIITGCFSYFQEAKSSKIMESFKNMVPQQALVIREGEKMQINAEEVVAGDLVEVKGGDRIPADLRIISSHGCKVDNSSLTGESEPQTRSPDCTHDNPLETRNIAFFSTNCVEGTARGIVVCTGDRTVMGRIATLTSGLETGKTPIAKEIEHFIHIITGVAVFLGLSFFILSIILGYSWLEAVIFLIGIIVANVPEGLLATVTVCLTLTAKRMARKNCLVKNLEAVETLGSTSTICSDKTGTLTQNRMTVAHMWFDNQIHEADTTEDQSGASFDKTSVTWVSLARVASLCNRAVFKAGQDSLPILKRDVAGDASESALLKCIELSCGSVKQMRERNKKVAEIPFNSTNKYQLSIHETEEPNDNRYLLVMKGAPERILDRCSTIMIQGKEQPMDEEMKEAFQNAYLELGGLGERVLGFCHLLMPEDQYPKGFAFDTDDVNFQTDNMCFVGLMSMIDPPRAAVPDAVGKCRSAGIKVIMVTGDHPITAKAIAKGVGIISEGNETVEDIAARLNIPVSQVNPRDAKACVIHGTELKDMSQDQIDEILRNHTEIVFARTSPQQKLIIVEGCQRQGAIVAVTGDGVNDSPALKKADIGVAMGISGSDVSKQAADMILLDDNFASIVTGVEEGRLIFDNLKKSIAYTLTSNIPEITPFLFFIIVNIPLPLGTITILCIDLGTDMVPAISLAYEAAESDIMKRQPRNPMRDKLVNERLISIAYGQIGMIQALGGFFSYFVILAENGFLPSLLVGIRLSWDDRTANDLEDSYGQQWTYEQRKIVEFTCHTAFFVSIVVVQWADLIICKTRRNSVFQQGMKNKILIFGLFEETALAAFLSYCPGMDVALRMYPLKPSWWFCAFPYSFLIFVYDEIRKLLLRR-NPGGWVEKETYY 994          
BLAST of non-gastric H ,K -ATPase alpha subunit vs. Ensembl Cavefish
Match: atp1a1b (sodium/potassium-transporting ATPase subunit alpha-1 [Source:NCBI gene;Acc:103024756])

HSP 1 Score: 1453.73 bits (3762), Expect = 0.000e+0
Identity = 731/988 (73.99%), Postives = 838/988 (84.82%), Query Frame = 1
Query:  181 ELDIDSHKISIKDLYIRLQTDPEKGLSIEEAKIRLARDGPNALTPPKTTPEWVKFCRQLFGGFSLLLWIGAALCFLAYAILSGAYEDPPKDNLYLGIVLTAVVVITGCFSYYQEAKSSKIMESFGKMVPQKANVIRDGKILEIAAENLVTGDIIDVKFGDRVPADIRVIQASSFKVDNSALTGESEAQVRSSEFTNDNPLETKNIAFFSTNAVEGTCKGVVISTGDNTVMGRIANLASGLEMGMTPIAKEINHFIHIITGVAVFLGVSFFVIAFILGYFWLDAVIFLIGIIVANVPEGXXXXXXXXXXXXXKKMAKKNCLVKNLEAVETLGSTSTICSDKTGTLTQNRMTVAHMWFDNKIQESDTSENQITSSTKQESETWKMLARVAMLCNRAQFKSGEEEKPVLKRECTGDASESALLKCVELSIGGVTKYRGENKKIVEIPFNSTNKYQVSIHETSDGN--QGYLLAMKGAPERILERCSTILIDGKEMEMDDHWRQEFNNAYLELGGMGERVLGFCDYRLDENNFPRGFDFNPDEVNFPLDGLRFVGLMSMIXXXXXXXXXXXXKCRSAGIKVIMVTGDHPITAKAIAKGVGIISEGNKTVDDIAAERGISPSEVNPRDARACVIHGSDLRDMSSEQLDEVLKHHDEIVFARTSPQQKLIIVEGCQRQGAIVAVTGDGVNDSPALKKADIGVAMGIAGSDVSKQAADMILLDDNFASIVTGVEEGRIIFDNLKKSIAYTLTSNIPEITPFLVFILADVPLPLGTITILCIDLGTDMVPAISLAYEEAESDIMKRKPRDPKHDKLVNERLISMAYGQIGMIQASGGFFVYFVIMAEQGFWPSRLLGLRKEWDSAAVNDLADSYGQEWTFDQRKKLEYTCHTAFFVSIVIVQWTDLMICKTRRNSIFQQGMWNHQMTFGLFFETTLAAFLTYCPGLDVALKMQPLRFTWWLPAIPFSASIFIYDEIRKFLLRKWKNGSWLENETYY 3138
            E+D+D HK+S+ +L+ +  TD  +GLS   A+  LARDGPNALTPP TTPEWVKFC+Q+FGGFS+LLW GA LCFLAY I +   ++P  DNLYLG+VL+AVV+ITGCFSYYQEAKSSKIM+SF  +VPQ+A VIRDG+   I AE++V GD+++VK GDR+PAD+R+I A   KVDNS+LTGESE Q RS +F+NDNPLET+NIAFFSTN VEGT +G+VISTGD TVMGRIA LASGLE+G TPI+ EI HFIHIITGVAVFLG+SFF+++ +LGY WL+AVIFLIGIIVANVPEGLLATVTVCLTLTAK+MAKKNCLVKNLEAVETLGSTSTICSDKTGTLTQNRMTVAHMWFDN+I E+DT+ENQ  ++  + S TW  LARVA LCNRA F + + + P+LKR+  GDASESALLKC+EL  G V + R +  K  EIPFNSTNKYQ+S+H+  +      YLL MKGAPERIL+RCSTI+  GKE  +DD  R  F NAYLELGG+GERVLGFC Y L E  FP GF F+ D+VNFP + L FVGLMSMIDPPRAAVPDAV KCRSAGIKVIMVTGDHPITAKAIAKGVGIISEGN+TV+DIAA   I  +EVNPRDA+ACV+HG DL+D+S+EQLD++LKHH EIVFARTSPQQKLIIVEGCQRQGAIVAVTGDGVNDSPALKKADIGVAMGIAGSDVSKQAADMILLDDNFASIVTGVEEGR+IFDNLKKSIAYTLTSNIPEITPFL FI+A++PLPLGT+TILCIDLGTDMVPAISLAYE AESDIMKR+PR+PK DKLVNERLIS+AYGQIGMIQA  GFF YFVI+AE GF PSRLLG+R  WD    NDL DSYGQ+WT++QRK +E+TCHTAFF SIV+VQW DL+ICKTRRNS+FQQGM N  + FGLF ET LAAFL+YCPG+ VAL+M PL+  WW  A P+S  IFIYDEIRK +LR+   G W+E ETYY
Sbjct:   39 EVDLDDHKLSLDELHRKYGTDLSRGLSSSRAQEILARDGPNALTPPPTTPEWVKFCKQMFGGFSMLLWTGAVLCFLAYGIQAAMEDEPANDNLYLGVVLSAVVIITGCFSYYQEAKSSKIMDSFKNLVPQQALVIRDGEKNHINAEDVVLGDLVEVKGGDRIPADLRIISAHGCKVDNSSLTGESEPQTRSPDFSNDNPLETRNIAFFSTNCVEGTARGIVISTGDRTVMGRIATLASGLEVGRTPISIEIEHFIHIITGVAVFLGLSFFILSLVLGYSWLEAVIFLIGIIVANVPEGLLATVTVCLTLTAKRMAKKNCLVKNLEAVETLGSTSTICSDKTGTLTQNRMTVAHMWFDNQIHEADTTENQSGTTFDRSSTTWACLARVAGLCNRAVFLAEQTDVPILKRDVAGDASESALLKCIELCCGSVKEMREKYSKAAEIPFNSTNKYQLSVHKNPNATPESKYLLVMKGAPERILDRCSTIMFQGKEQPLDDEMRDAFQNAYLELGGLGERVLGFCHYNLPEEQFPEGFQFDTDDVNFPTENLCFVGLMSMIDPPRAAVPDAVGKCRSAGIKVIMVTGDHPITAKAIAKGVGIISEGNETVEDIAARLNIPINEVNPRDAKACVVHGGDLKDLSAEQLDDILKHHTEIVFARTSPQQKLIIVEGCQRQGAIVAVTGDGVNDSPALKKADIGVAMGIAGSDVSKQAADMILLDDNFASIVTGVEEGRLIFDNLKKSIAYTLTSNIPEITPFLFFIIANIPLPLGTVTILCIDLGTDMVPAISLAYEAAESDIMKRQPRNPKTDKLVNERLISIAYGQIGMIQALAGFFTYFVILAENGFLPSRLLGIRVHWDDKYTNDLEDSYGQQWTYEQRKIVEFTCHTAFFTSIVVVQWADLIICKTRRNSVFQQGMKNKILIFGLFEETALAAFLSYCPGMGVALRMYPLKPNWWFCAFPYSLLIFIYDEIRKLILRR-NPGGWVERETYY 1025          
BLAST of non-gastric H ,K -ATPase alpha subunit vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002888.1 (pep scaffold:Pmarinus_7.0:GL478641:194938:205936:1 gene:ENSPMAG00000002641.1 transcript:ENSPMAT00000002888.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 861.677 bits (2225), Expect = 0.000e+0
Identity = 422/581 (72.63%), Postives = 496/581 (85.37%), Query Frame = 1
Query: 1399 KRECTGDASESALLKCVELSIGGVTKYRGENKKIVEIPFNSTNKYQVSIHETSDGNQG-YLLAMKGAPERILERCSTILIDGKEMEMDDHWRQEFNNAYLELGGMGERVLGFCDYRLDENNFPRGFDFNPDEVNFPLDGLRFVGLMSMIXXXXXXXXXXXXKCRSAGIKVIMVTGDHPITAKAIAKGVGIISEGNKTVDDIAAERGISPSEVNPRDARACVIHGSDLRDMSSEQLDEVLKHHDEIVFARTSPQQKLIIVEGCQRQGAIVAVTGDGVNDSPALKKADIGVAMGIAGSDVSKQAADMILLDDNFASIVTGVEEGRIIFDNLKKSIAYTLTSNIPEITPFLVFILADVPLPLGTITILCIDLGTDMVPAISLAYEEAESDIMKRKPRDPKHDKLVNERLISMAYGQIGMIQASGGFFVYFVIMAEQGFWPSRLLGLRKEWDSAAVNDLADSYGQEWTFDQRKKLEYTCHTAFFVSIVIVQWTDLMICKTRRNSIFQQGMWNHQMTFGLFFETTLAAFLTYCPGLDVALKMQPLRFTWWLPAIPFSASIFIYDEIRKFLLRKWKNGSWLENETYY 3138
            +R   GDASESALL+CVEL +G V   R  N+K+ EIPF+ST KYQ+SIHE+ + N   YLL MKGAPERIL+RCS+I+I+G+E  +D+   + F NAYLELGG+GERVLG C  RL  + FPRG+ F+ + +NFP++ L  VGLMSMIDPPRA VPDAV KCRSAGIKVIM TGDHPITAKAIAK VGIISEGN+TV+DIAA   I  ++V+PRDA+ACV+HGSDL++M+  QLD++LK++ EIVFARTSPQQKLIIVEGCQRQGAIVAVTGDGVNDS ALKKADIG+AMGI GSDVSKQAADMILLDDNFASIVTGVEEGR+IFDNLKKSIAYTLTSNIPEITPFL FIL ++PLPLGT+TILCIDLGTDMVPAISLAYE AESDIMKR+PR+ + DKLVNERLIS+AYGQIGMIQA GGFF YFVIMAE GF PS+L+GLR EW++ + N+L DSYGQEWT++QRK +EYTCHT+FFVSIV+VQW DL+ICKTRRNS+FQQGM N  + FGLF ET LAAFL+YCPG+DVAL+M PL+ +WW  A P+S  IF+YDE+RK ++R+   G W+E ETYY
Sbjct:    1 QRNVVGDASESALLRCVELCVGNVRDMRSRNQKVAEIPFDSTIKYQLSIHESDEPNDPRYLLVMKGAPERILDRCSSIIIEGQEESLDEELEEAFQNAYLELGGLGERVLGLCQLRLPVDQFPRGYAFDTENINFPMEDLCLVGLMSMIDPPRATVPDAVGKCRSAGIKVIMATGDHPITAKAIAKSVGIISEGNETVEDIAARLNIPVNQVDPRDAKACVVHGSDLKNMTETQLDDILKNYTEIVFARTSPQQKLIIVEGCQRQGAIVAVTGDGVNDSLALKKADIGIAMGIVGSDVSKQAADMILLDDNFASIVTGVEEGRLIFDNLKKSIAYTLTSNIPEITPFLFFILCNIPLPLGTVTILCIDLGTDMVPAISLAYEAAESDIMKRQPRNVRVDKLVNERLISIAYGQIGMIQALGGFFTYFVIMAENGFLPSKLMGLRIEWNTRSQNELEDSYGQEWTYEQRKIVEYTCHTSFFVSIVVVQWADLIICKTRRNSVFQQGMKNKVLIFGLFEETALAAFLSYCPGMDVALRMYPLKLSWWFCAFPYSILIFVYDEVRKLIIRR-NPGGWVEKETYY 580          
BLAST of non-gastric H ,K -ATPase alpha subunit vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002145.1 (pep scaffold:Pmarinus_7.0:GL482157:124:4919:1 gene:ENSPMAG00000001949.1 transcript:ENSPMAT00000002145.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 684.485 bits (1765), Expect = 0.000e+0
Identity = 325/413 (78.69%), Postives = 369/413 (89.35%), Query Frame = 1
Query: 1900 KVIMVTGDHPITAKAIAKGVGIISEGNKTVDDIAAERGISPSEVNPRDARACVIHGSDLRDMSSEQLDEVLKHHDEIVFARTSPQQKLIIVEGCQRQGAIVAVTGDGVNDSPALKKADIGVAMGIAGSDVSKQAADMILLDDNFASIVTGVEEGRIIFDNLKKSIAYTLTSNIPEITPFLVFILADVPLPLGTITILCIDLGTDMVPAISLAYEEAESDIMKRKPRDPKHDKLVNERLISMAYGQIGMIQASGGFFVYFVIMAEQGFWPSRLLGLRKEWDSAAVNDLADSYGQEWTFDQRKKLEYTCHTAFFVSIVIVQWTDLMICKTRRNSIFQQGMWNHQMTFGLFFETTLAAFLTYCPGLDVALKMQPLRFTWWLPAIPFSASIFIYDEIRKFLLRKWKNGSWLENETYY 3138
            +VIMVTGDHPITAKAIAKGVGIISEGN+TV+DIAA   I  S+VNPRDA+ACV+HGSDL+DM+  QLD++LK+H EIVFARTSPQQKLIIVEGCQRQGAIVAVTGDGVNDSPALKKADIG+AMGIAGSDVSKQAADMILLDDNFASIVTGVEEGR+IFDNLKKSIAYTLTSNIPEITPFL FIL ++PLPLGT+TILCIDLGTDMVPAISLAYE AESDIMKR+PR+ + DKLVNERLIS+AYGQIGMIQA GGFF YFVI+AE GF P  L+G+R  WD  ++NDL DSYGQEWT++QRK +EYTCHT+FFVSIV+VQW DL+ICKTRRNS+FQQGM N  + FGLF ET LAAFL+YCPG+DVAL+M PL+ +WW  A P+S  IF+YDE+RKF+LR+   G W+E ETYY
Sbjct:    1 QVIMVTGDHPITAKAIAKGVGIISEGNETVEDIAARLNIPVSQVNPRDAKACVVHGSDLKDMTEIQLDDILKNHTEIVFARTSPQQKLIIVEGCQRQGAIVAVTGDGVNDSPALKKADIGIAMGIAGSDVSKQAADMILLDDNFASIVTGVEEGRLIFDNLKKSIAYTLTSNIPEITPFLFFILCNIPLPLGTVTILCIDLGTDMVPAISLAYEAAESDIMKRQPRNARVDKLVNERLISIAYGQIGMIQALGGFFSYFVILAENGFLPWNLIGIRINWDDKSLNDLEDSYGQEWTYEQRKIVEYTCHTSFFVSIVVVQWADLIICKTRRNSVFQQGMKNKVLIFGLFEETALAAFLSYCPGMDVALRMYPLKPSWWFCAFPYSLLIFVYDEVRKFILRR-HPGGWVERETYY 412          
BLAST of non-gastric H ,K -ATPase alpha subunit vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009058.1 (pep scaffold:Pmarinus_7.0:GL480374:1:11062:-1 gene:ENSPMAG00000008154.1 transcript:ENSPMAT00000009058.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 568.155 bits (1463), Expect = 0.000e+0
Identity = 292/415 (70.36%), Postives = 351/415 (84.58%), Query Frame = 1
Query:  181 ELDIDSHKISIKDLYIRLQTDPEKGLSIEEAKIRLARDGPNALTPPKTTPEWVKFCRQLFGGFSLLLWIGAALCFLAYAILSGAYEDPPKDNLYLGIVLTAVVVITGCFSYYQEAKSSKIMESFGKMVPQKANVIRDGKILEIAAENLVTGDIIDVKFGDRVPADIRVIQASSFKVDNSALTGESEAQVRSSEFTNDNPLETKNIAFFSTNAVEGTCKGVVISTGDNTVMGRIANLASGLEMGMTPIAKEINHFIHIITGVAVFLGVSFFVIAFILGYFWLDAVIFLIGIIVANVPEGXXXXXXXXXXXXXKKMAKKNCLVKNLEAVETLGSTSTICSDKTGTLTQNRMTVAHMWFDNKIQESDTSENQITSSTKQESETWKMLARVAMLCNRAQFKSGEEEKPVLKRECTGDAS 1425
            E+ +D HK+S+ +L+ +  TD  +GL+   A   LARDGPNALTPP TTPEWVKFC+QLFGGFSLLLW+GA LCFLAY I +   ++P  DNLYLG+VL+AVV+ITGCFSYYQE+KSS+IM+SF  MVPQ+A VIR+G+  ++ AE +V GD++++K GDR+PAD+R++ +   KVDNS+LTGESE Q RS +FT+DNPLET+NIAFFSTN VEGT +G+VI+TGD+TVMGRIA LASGLE G TPI  EI HFIHIITGVAVFLGVSFF+++ ILGY WL+AVIFLIGIIVANVPEGLLATVTVCLTLTAK+MAKKNCLVKNLEAVETLGSTSTICSDKTGTLTQNRMTVAHMWFDN+I E+DT+E+Q  ++  + S TW  LARVA LCNRA F++G+E  PVLKR+  GDAS
Sbjct:   36 EVSLDDHKLSLDELHRKYGTDLSRGLTNVRAAEILARDGPNALTPPPTTPEWVKFCKQLFGGFSLLLWVGAILCFLAYGIQAATEDEPSNDNLYLGVVLSAVVIITGCFSYYQESKSSRIMDSFRNMVPQQALVIREGEKTQLNAELVVLGDLVEIKGGDRIPADLRIVSSHGCKVDNSSLTGESEPQSRSPDFTHDNPLETRNIAFFSTNCVEGTARGIVINTGDHTVMGRIATLASGLEGGRTPINIEIEHFIHIITGVAVFLGVSFFILSLILGYSWLEAVIFLIGIIVANVPEGLLATVTVCLTLTAKRMAKKNCLVKNLEAVETLGSTSTICSDKTGTLTQNRMTVAHMWFDNQIHEADTTEDQSGTAFDKSSPTWTALARVASLCNRAVFQAGQENVPVLKRDVAGDAS 450          
BLAST of non-gastric H ,K -ATPase alpha subunit vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001612.1 (pep scaffold:Pmarinus_7.0:GL478157:83838:93675:1 gene:ENSPMAG00000001454.1 transcript:ENSPMAT00000001612.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 309.301 bits (791), Expect = 1.142e-97
Identity = 142/260 (54.62%), Postives = 192/260 (73.85%), Query Frame = 1
Query: 2359 GRIIFDNLKKSIAYTLTSNIPEITPFLVFILADVPLPLGTITILCIDLGTDMVPAISLAYEEAESDIMKRKPRDPKHDKLVNERLISMAYGQIGMIQASGGFFVYFVIMAEQGFWPSRLLGLRKEWDSAAVNDLADSYGQEWTFDQRKKLEYTCHTAFFVSIVIVQWTDLMICKTRRNSIFQQGMW-NHQMTFGLFFETTLAAFLTYCPGLDVALKMQPLRFTWWLPAIPFSASIFIYDEIRKFLLRKWKNGSWLENETY 3135
            GR+IFDNLKKSIAYTLT NI E+ PFL++I+A +PLP+GT+TIL IDLGTD++P+I+LAYE+ ESDIM R+PR+ + D LVN +L + +Y QIG+ QA G F  YF +MAE+G+ P   +GLRK W+     +L DSYGQEWTF QR++ E+ C+TAFFV+IVI Q  DL+I KTRRNS+F QG++ N  +  G+  +  +AAFL+YCPG+D  L   PLR  WW  AI ++  I++YDE+RKF +R++    W +N  Y
Sbjct:    1 GRLIFDNLKKSIAYTLTKNIAELCPFLIYIIASIPLPIGTVTILFIDLGTDIIPSIALAYEKPESDIMNRRPRNARIDHLVNSKLATYSYLQIGVTQAVGAFLSYFTVMAEEGWLPITCIGLRKHWEQVDEQELEDSYGQEWTFVQRQQQEFVCYTAFFVAIVIQQLADLVIRKTRRNSVFTQGLFRNKVVLLGMLSQLVIAAFLSYCPGMDEGLHFMPLRVGWWFVAISYAIFIWLYDEMRKFFIRRYPESWWAQNMYY 260          
BLAST of non-gastric H ,K -ATPase alpha subunit vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010373.1 (pep scaffold:Pmarinus_7.0:GL481096:3909:20014:1 gene:ENSPMAG00000009373.1 transcript:ENSPMAT00000010373.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 290.812 bits (743), Expect = 1.028e-83
Identity = 279/935 (29.84%), Postives = 442/935 (47.27%), Query Frame = 1
Query:  655 GDRVPADIRV--IQASSFKVDNSALTGESEAQVRSSEFTNDNPL---ETKNIAFFSTNAVEGTCKGVVISTGDNTVMGRIANLASGLEMGMTPIAKEINHFIHIITGVAVFLGVSFFVIAFILGYF--------WLDAVIFLI----GIIVANVPEGXXXXXXXXXXXXXKKMAKKNCLVKNLEAVETLGSTSTICSDKTGTLTQNRMTVAHMWFDNKIQESDTSENQIT---SSTKQESETWK--------------MLARVAMLCNRAQFKSGEEEKPVLKRECTGDASESALLKCVE------LSIGGVTKYRGEN------KKIVEIPFN---STNKYQVSIHET----SDGNQGYLLAMKGAPERILERCSTILIDGKEMEMDDHWRQEFNNAYLELGGMGE--RVLGFCDY----RLDENNFPRGFDFNPDEVNFPLDGLRFVGLMSMIXXXXXXXXXXXXKCRSAGIKVIMVTGDHPITAKAIAKGVGIISEGNKTVDDIAAERGISPSEVNPRDARACVIHGSDLRDMSSEQLDEVLKHHDEIVFARTSPQQKLIIVEGCQRQGAIVAVTGDGVNDSPALKKADIGVAMGIAGSDVSKQAADMILLDDNFASIVTGVEEGRIIFDNLKKSIAYTLTSNIPEITPFLVFILADVPLPLGTITILCIDLGTDMVPAISLAYEEAESDIMKRKPRDPKHDKLVNERLISMAYGQIGMIQASGGFFVYFVI--MAEQGFWPSRLLGLRKEWDSAAVNDLADSYGQEWTFDQRKKLEYTCH--------TAFFVSIVIVQWTDLMICKTRRNSIFQQGMWNHQMTFG-LFFETTLAAFLTYCPGLDVALKMQPLRFTWWLPAIPFSASIFIYDEIRKFLLRKWKNGSWLENETYY*K--------------YWIFLCIITNIIIYNLFWTFS 3207
            GD+VPADIR+  I++++ +VD S LTGES + ++ ++   D      + KN+ F  TN   G   GVV++TG NT +G+I +  +  E   TP+ ++++ F   ++ V   + ++ ++I   +G+F        W+   I+       + VA +PEGL A +T CL L  ++MAKKN +V++L +VETLG TS ICSDKTGTLT N+M+V  M+  ++    + S N+ T   S+   E E +K               LA +  LCN +     E  K V ++   G+A+E+AL   VE        + G++K    N      K++++  F    S ++  +S++ T    S  + G  + +KGAPE +++RCS + +   ++ M    +++      E G   +  R L         R ++ N      F   EV+    G   VG   M+DPPR  V  ++  CR AGI+VI   GD+  TA AI + +GI  E                      D +     G +  D+  E+  + L       FAR  P  K  IVE  Q    I A+TGDGVND+PALKKA+IG+AMG +G+ V+K A++M+L DDNF+SIV  VEEGR I++N+K+ I Y ++SN+ E+    +      P  L  + +L ++L TD +PA +L +   + DIM+R PR+PK      E LIS      G +     FF Y  I          +         D   V     S+  + T +        CH        T     +V ++  + +   +   S+ +   W++    G +    +L   + Y   L +  ++ PL    WL  +  S  + + DE  KF+ R +  G  LE+  +  K               W FL I T +I+    W +S
Sbjct:    4 GDKVPADIRLTSIKSTTLRVDQSILTGESVSVIKHTDPVPDPRAVNQDKKNMLFSGTNIAAGKAVGVVVATGVNTEIGKIRDEMAATEQDKTPLQQKLDEFGEQLSKVISLICIAVWIIN--IGHFNDPVHGGSWMRGAIYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMSVCRMFIIDRADGENCSLNEFTITGSTYAPEGEVYKNDKLVRCGEYDGLIELATICALCNDSSLDFNEA-KGVYEK--VGEATETALTCQVEKMNVFDTHLVGLSKVERANACNNVIKQLMKKEFTLEFSRDRKSMSVYCTPVKPSRSSVGNKMFVKGAPEGVIDRCSHVRVGTTKLPMTAGMKEKILATIREYGTGRDTLRCLALATRDMPPRREDMNLIDSTKFASYEVDLTFVGCVGVG---MLDPPRKEVSSSIILCREAGIRVI---GDNKGTAVAICRRIGIFGED--------------------EDVKDKAYTGREFDDLPLEE--QRLACQRARCFARVEPSHKSKIVEFLQSCDEITAMTGDGVNDAPALKKAEIGIAMG-SGTAVAKSASEMVLADDNFSSIVAAVEEGRAIYNNMKQFIRYLISSNVGEVVCIFLTAALGFPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMERPPRNPK------EPLIS------GWL-----FFRYLAIGCYVGAATVGAAAWWFMAADDGPGVTFYQLSHFMQCTPEHPDFEGLDCHVFESPYPMTMALSVLVTIEMCNALNSLSENQSLLRMPPWDNIWLLGAICLSMSLHFLILYVEPLPIIFQITPLNLEQWLVVLKISLPVILLDETLKFIARNYLEGKELESPHFPGKAGGPVYLGSHAHGISWPFLLIFTPLIV----WLYS 883          
BLAST of non-gastric H ,K -ATPase alpha subunit vs. Ensembl Yeast
Match: PMR1 (High affinity Ca2+/Mn2+ P-type ATPase; required for Ca2+ and Mn2+ transport into Golgi; involved in Ca2+ dependent protein sorting, processing; D53A mutant (Mn2+ transporting) is rapamycin sensitive, Q783A mutant (Ca2+ transporting) is rapamycin resistant; Mn2+ transport into Golgi lumen required for rapamycin sensitivity; mutations in human homolog ATP2C1 cause acantholytic skin condition Hailey-Hailey disease; human ATP2C1 can complement yeast null mutant [Source:SGD;Acc:S000003135])

HSP 1 Score: 374.785 bits (961), Expect = 9.638e-114
Identity = 316/1016 (31.10%), Postives = 497/1016 (48.92%), Query Frame = 1
Query:  205 ISIKDLYIRLQTDPEKGL-SIEEAKIRLARDGPNALTPPKTTPEWVKFCRQLFGGFSLLLWIGAALCFLAYAILSGAYEDPPKDNLYLGIVLTAVVVITGCFSYYQEAKSSKIMESFGKMVPQKANVIRDGKILEIAAENLVTGDIIDVKFGDRVPADIRVIQASSFKVDNSALTGESEAQVRSSEFT-----NDNP------LETKNIAFFSTNAVEGTCKGVVISTGDNTVMGRIANLASGLEMGMTPI-------AKEINHFIHIITGVAVFLGVSFFVIAFILGYFWLDAVIFLIGIIVANVPEGXXXXXXXXXXXXXKKMAKKNCLVKNLEAVETLGSTSTICSDKTGTLTQNRMTVAHMW----FDNKIQESDTSENQITSSTKQE-----SETWKMLARVAMLCNRAQFKSGEEEKPVLKRECTGDASESALLKCVELSIGGVTKYRGENKKIVEIPFNSTNKYQVSIHETSDGNQGYLLAMKGAPERILERCSTILID-GKEME-MDDHWRQEFNNAYLELGGMGERVLGFCDYRLDENNFPRGFDFNPDEVNFPLDGLRFVGLMSMIXXXXXXXXXXXXKCRSAGIKVIMVTGDHPITAKAIAKGVGIISEGNKTVDDIAAERGISPSEVNPR-DARACVIHGSDLRDMSSEQLDEVLKHHDEIVFARTSPQQKLIIVEGCQRQGAIVAVTGDGVNDSPALKKADIGVAMGIAGSDVSKQAADMILLDDNFASIVTGVEEGRIIFDNLKKSIAYTLTSNIPEITPFLVFILADVPLPLGTITILCIDLGTDMVPAISLAYEEAESDIMKRKPRDPKHDKL----VNERLISMAYGQIGMIQASGGFFVYFVIMAEQGFWPSRLLGLRKEWDSAAVNDLADSYGQEWTFDQRKKLEYTCHTAFFVSIVIVQWTDLMICKTRRNSIFQQGMWNHQM---TFGLFFETTLAAFLTYCPGLDVALKMQPLRFTWWLPAIPFSASIFIYDEIRKFLLRKWKNGSWLENETYY 3138
            +S+ +   +L TD   GL S  EA  R +  GPN +T       + KF         +LL IG+A+     ++  G  +D       + I L   +V+T    + QE +S K +E+  K+VP + +++R G+   + A  LV GD++  + GDR+PADIR+I+A    +D S LTGE+E   ++S+       ND P       E   IA+  T   EG  KG+V+ TG NT  G +  + + +E   TP+        K+++    I+ G+   +G+       I G  WL+     + + VA +PEGL   VTV L L   +MAK+  +V+ L +VETLGS + ICSDKTGTLT N MTV+ +W      NK+      +N+ T ++        +E  +    +  LCN A F    +E  +      G+ ++ ALL+  +L+   +   R   +K+ E+PFNS  K   +       N+  +  +KGA ERILE  ++ L   GK+ E + +  +   N     +   G RV GF    L +++ P   D   D        L F GL+ M DPPR  V  A+ +    G+ +IM+TGD   TA  IAK +GI                       P  D +  V+ G  L +MS +QL  V+ H +  +FAR +P+ KL IV   +++G +VA+TGDGVND+PALK +DIGV+MG  G+DV+K+A+DM+L DD+F++I+T +EEG+ IF+N++  + + L++++  ++   +     +P PL  + IL I++  D  PA SL  E  + ++MK+ PR  + DK+    V +RL++ A   I      G  +++   MAE G   +R                               + +TC   F          + + C+    SIF+ G + ++M     GL     + A   Y P      K + L  +  L  +  S+S+FI DE+RK   RK KN    E+ TY+
Sbjct:   41 LSVDEALEKLDTDKNGGLRSSNEANNRRSLYGPNEITVEDDESLFKKFLSNFIEDRMILLLIGSAVV----SLFMGNIDDA------VSITLAIFIVVT--VGFVQEYRSEKSLEALNKLVPAECHLMRCGQESHVLASTLVPGDLVHFRIGDRIPADIRIIEAIDLSIDESNLTGENEPVHKTSQTIEKSSFNDQPNSIVPISERSCIAYMGTLVKEGHGKGIVVGTGTNTSFGAVFEMMNNIEKPKTPLQLTMDKLGKDLSLVSFIVIGMICLVGI-------IQGRSWLEMFQISVSLAVAAIPEGLPIIVTVTLALGVLRMAKRKAIVRRLPSVETLGSVNVICSDKTGTLTSNHMTVSKLWCLDSMSNKLNVLSLDKNKKTKNSNGNLKNYLTEDVRETLTIGNLCNNASF---SQEHAIF----LGNPTDVALLE--QLANFEMPDIRNTVQKVQELPFNSKRKLMATKILNPVDNKCTVY-VKGAFERILEYSTSYLKSKGKKTEKLTEAQKATINECANSMASEGLRVFGFAKLTLSDSSTPLTEDLIKD--------LTFTGLIGMNDPPRPNVKFAIEQLLQGGVHIIMITGDSENTAVNIAKQIGI-----------------------PVIDPKLSVLSGDKLDEMSDDQLANVIDHVN--IFARATPEHKLNIVRALRKRGDVVAMTGDGVNDAPALKLSDIGVSMGRIGTDVAKEASDMVLTDDDFSTILTAIEEGKGIFNNIQNFLTFQLSTSVAALSLVALSTAFKLPNPLNAMQILWINILMDGPPAQSLGVEPVDHEVMKKPPRK-RTDKILTHDVMKRLLTTAACII-----VGTVYIFVKEMAEDGKVTAR----------------------------DTTMTFTCFVFF-------DMFNALACRHNTKSIFEIGFFTNKMFNYAVGLSLLGQMCAI--YIPFFQSIFKTEKLGISDILLLLLISSSVFIVDELRKLWTRK-KNE---EDSTYF 947          
BLAST of non-gastric H ,K -ATPase alpha subunit vs. Ensembl Yeast
Match: PMA1 (Plasma membrane P2-type H+-ATPase; pumps protons out of cell; major regulator of cytoplasmic pH and plasma membrane potential; long-lived protein asymmetrically distributed at plasma membrane between mother cells and buds; accumulates at high levels in mother cells during aging, buds emerge with very low levels of Pma1p, newborn cells have low levels of Pma1p; Hsp30p plays a role in Pma1p regulation; interactions with Std1p appear to propagate [GAR+] [Source:SGD;Acc:S000002976])

HSP 1 Score: 199.134 bits (505), Expect = 6.935e-53
Identity = 217/836 (25.96%), Postives = 372/836 (44.50%), Query Frame = 1
Query:  232 LQTDPEKGLSIEEAKIRLARDGPNALTPPKTTPEWVKFCRQLFGGFSLLLWIGAALCFLAYAILSGAYEDPPKDNLYLGIVLTAVVVITGCFSYYQEAKSSKIMESFGKMVPQKANVIRDGKILEIAAENLVTGDIIDVKFGDRVPADIRVIQASSF-KVDNSALTGESEAQVRSSEFTNDNPLETKNIAFFSTNAVEGTCKGVVISTGDNTVMGRIANLASGLEMGMTPIAKEINHFIHIITGVAVFLGVSFFVIAFIL-----GYFWLDAVI----FLIGIIVANVPEGXXXXXXXXXXXXXKKMAKKNCLVKNLEAVETLGSTSTICSDKTGTLTQNRMTVAHMWFDNKIQESDTSENQITSSTKQESETWKMLARVAMLCNRAQFKSGEEEKPVLKRECTGDASESALLKCVEL---SIGGVTKYRGENKKIVEI-PFNSTNKYQVSIHETSDGNQGYLLAMKGAPERILERCSTILIDGKEMEMDDHWRQEFNNAYLELGGMGERVLGFCDYRLDENNFPRGFDFNPDEVNFPLDGLRFVGLMSMIXXXXXXXXXXXXKCRSAGIKVIMVTGDHPITAKAIAKGVGIISEGNKTVDDIAAERGISPSEVNPRDARACVIHGSDLRDMSSEQLDEVLKHHDEIVFARTSPQQKLIIVEGCQRQGAIVAVTGDGVNDSPALKKADIGVAMGIAGSDVSKQAADMILLDDNFASIVTGVEEGRIIFDNLKKSIAYTLTSNIPEITPFLVFILADVPLPLGTITILCIDLGTDMVPAISLAYEEAESDIMKRKPRDPKHDKLVNERLISMAYGQIGMIQASGGFFVYFVIMAEQG 2697
            LQTDP  GL+ +E   R  + G N +   K +   VKF     G    ++         A AIL+    D     +  G+++     +     + QE ++  I++   K +   A VIRDG+++EI A  +V GDI+ ++ G  +P D R++    F ++D SA+TGES A  +             +  F S+    G    VV +TGDNT +GR A L +    G         HF  ++ G+ + L V   VIA +L      ++  + ++    + +GI +  VP GL A VT  + + A  +AKK  +V+ L A+E+L     +CSDKTGTLT+N++++   +    +   D       ++++++                                   DA + A LK ++    +   +TKY     K++E  PF+  +K   ++ E+ +G +  ++ +KGAP  +L+         ++  + +   + + N   EL   G R LG    R  E ++                    +G+M  +DPPR      V++ R  G++V M+TGD    AK   + +G+   G    +   AER                       DM   +L + +++ D   FA   PQ K  +VE  Q +G +VA+TGDGVND+P+LKKAD G+A+    +D ++ AAD++ L    ++I+  ++  R IF  +   + Y +  ++  +  FL   +A +   L    I+ I +  D V  +++AY+ A        P  PK  K    RL  M+   +G++ A G +     +   +G
Sbjct:   80 LQTDPSYGLTSDEVLKRRKKYGLNQMADEKESLV-VKFVMFFVGPIQFVM--------EAAAILAAGLSDWVDFGVICGLLM-----LNAGVGFVQEFQAGSIVDELKKTLANTAVVIRDGQLVEIPANEVVPGDILQLEDGTVIPTDGRIVTEDCFLQIDQSAITGESLAVDK----------HYGDQTFSSSTVKRGEGFMVVTATGDNTFVGRAAALVNKAAGGQ-------GHFTEVLNGIGIILLV--LVIATLLLVWTACFYRTNGIVRILRYTLGITIIGVPVGLPAVVTTTMAVGAAYLAKKQAIVQKLSAIESLAGVEILCSDKTGTLTKNKLSLHEPYTVEGVSPDDLMLTACLAASRKKKGL--------------------------------DAIDKAFLKSLKQYPKAKDALTKY-----KVLEFHPFDPVSKKVTAVVESPEGER--IVCVKGAPLFVLKTVE------EDHPIPEDVHENYENKVAELASRGFRALGVARKR-GEGHW------------------EILGVMPCMDPPRDDTAQTVSEARHLGLRVKMLTGDAVGIAKETCRQLGL---GTNIYN---AERLGL----------------GGGGDMPGSELADFVENADG--FAEVFPQHKYRVVEILQNRGYLVAMTGDGVNDAPSLKKADTGIAVE-GATDAARSAADIVFLAPGLSAIIDALKTSRQIFHRMYSYVVYRIALSL-HLEIFLGLWIAILDNSLDIDLIVFIAIFAD-VATLAIAYDNA--------PYSPKPVKWNLPRLWGMSI-ILGIVLAIGSWITLTTMFLPKG 782          
BLAST of non-gastric H ,K -ATPase alpha subunit vs. Ensembl Yeast
Match: PMA2 (Plasma membrane H+-ATPase; isoform of Pma1p, involved in pumping protons out of the cell; regulator of cytoplasmic pH and plasma membrane potential [Source:SGD;Acc:S000005957])

HSP 1 Score: 196.052 bits (497), Expect = 7.662e-52
Identity = 219/838 (26.13%), Postives = 373/838 (44.51%), Query Frame = 1
Query:  232 LQTDPEKGLSIEEAKIRLARDGPNALTPPKTTPEWVKFCRQLFGGFSLLLWIGAALCFLAYAILSGAYEDPPKDNLYLGI-VLTAVVVITGCFSYYQEAKSSKIMESFGKMVPQKANVIRDGKILEIAAENLVTGDIIDVKFGDRVPADIRVIQASSF-KVDNSALTGESEAQVRSSEFTNDNPLETKNIAFFSTNAVEGTCKGVVISTGDNTVMGRIANL---ASGLEMGMTPIAKEINHFIHIITGVAVFLGVSFFVIAFILGYFW----------LDAVIFLIGIIVANVPEGXXXXXXXXXXXXXKKMAKKNCLVKNLEAVETLGSTSTICSDKTGTLTQNRMTVAHMWFDNKIQESDTSENQITSSTKQESETWKMLARVAMLCNRAQFKSGEEEKPVLKRECTGDASESALLKCVELSIGGVTKYRGENKKIVEI-PFNSTNKYQVSIHETSDGNQGYLLAMKGAPERILERCSTILIDGKEMEMDDHWRQEFNNAYLELGGMGERVLGFCDYRLDENNFPRGFDFNPDEVNFPLDGLRFVGLMSMIXXXXXXXXXXXXKCRSAGIKVIMVTGDHPITAKAIAKGVGIISEGNKTVDDIAAERGISPSEVNPRDARACVIHGSDLRDMSSEQLDEVLKHHDEIVFARTSPQQKLIIVEGCQRQGAIVAVTGDGVNDSPALKKADIGVAMGIAGSDVSKQAADMILLDDNFASIVTGVEEGRIIFDNLKKSIAYTLTSNIPEITPFLVFILADVPLPLGTITILCIDLGTDMVPAISLAYEEAESDIMKRKPRDPKHDKLVNERLISMAYGQIGMIQASGGFFVYFVIMAEQG 2697
            L TDP  GL+ +E   R  + G N +     +   VKF     G    ++         A AIL+    D      ++ + V+ A++++     + QE ++  I++   K +   A VIRDG+++EI A  +V G+I+ ++ G   PAD R++    F ++D SA+TGES A   + +   D         F S+    G    VV +TGDNT +GR A L   ASG+E           HF  ++ G+ + L V   VIA +L   W          +  + + +GI +  VP GL A VT  + + A  +AKK  +V+ L A+E+L     +CSDKTGTLT+N++++   +    +   D                  ++    +  +R +      +K  LK       ++ AL           TKY     K++E  PF+  +K   ++ E+ +G +  ++ +KGAP  +L+         ++  + +   + + N   EL   G R LG    R  E ++                    +G+M  +DPPR      + + R+ G+++ M+TGD    AK   + +G+   G    +   AER                       DM   +L + +++ D   FA   PQ K  +VE  Q +G +VA+TGDGVND+P+LKKAD G+A+    +D ++ AAD++ L    ++I+  ++  R IF  +   + Y +  ++  +  FL   +A +   L    I+ I +  D V  +++AY+ A        P  P+  K    RL  M+   +G++ A G +     +    G
Sbjct:  109 LSTDPAYGLTSDEVARRRKKYGLNQMAEENES-LIVKFLMFFVGPIQFVM--------EAAAILAAGLSD------WVDVGVICALLLLNASVGFIQEFQAGSIVDELKKTLANTATVIRDGQLIEIPANEVVPGEILQLESGTIAPADGRIVTEDCFLQIDQSAITGESLA---AEKHYGDE-------VFSSSTVKTGEAFMVVTATGDNTFVGRAAALVGQASGVE----------GHFTEVLNGIGIILLV--LVIATLL-LVWTACFYRTVGIVSILRYTLGITIIGVPVGLPAVVTTTMAVGAAYLAKKQAIVQKLSAIESLAGVEILCSDKTGTLTKNKLSLHEPYTVEGVSPDD------------------LMLTACLAASRKKKGLDAIDKAFLKSLIEYPKAKDAL-----------TKY-----KVLEFHPFDPVSKKVTAVVESPEGER--IVCVKGAPLFVLKTVE------EDHPIPEDVHENYENKVAELASRGFRALGVARKR-GEGHW------------------EILGVMPCMDPPRDDTAQTINEARNLGLRIKMLTGDAVGIAKETCRQLGL---GTNIYN---AERLGL----------------GGGGDMPGSELADFVENADG--FAEVFPQHKYRVVEILQNRGYLVAMTGDGVNDAPSLKKADTGIAVE-GATDAARSAADIVFLAPGLSAIIDALKTSRQIFHRMYSYVVYRIALSL-HLEIFLGLWIAILNNSLDINLIVFIAIFAD-VATLTIAYDNA--------PYAPEPVKWNLPRLWGMSI-ILGIVLAIGSWITLTTMFLPNG 811          
BLAST of non-gastric H ,K -ATPase alpha subunit vs. Ensembl Yeast
Match: ENA2 (P-type ATPase sodium pump; involved in Na+ efflux to allow salt tolerance; likely not involved in Li+ efflux [Source:SGD;Acc:S000002446])

HSP 1 Score: 176.792 bits (447), Expect = 1.667e-45
Identity = 175/569 (30.76%), Postives = 268/569 (47.10%), Query Frame = 1
Query: 1492 KKIVEIPFNSTNKYQVSIHETSDGNQGYLLAMKGAPERILERCSTIL-IDG-KEMEMDDHWRQEFNNAYLELGGMGERVLGFCD--YRLDENNFPRGFDFNPDEVNFPLDGLRFVGLMSMIXXXXXXXXXXXXKCRSAGIKVIMVTGDHPITAKAIAKGVGIISEGNKTVDDIAAERGISPSEVNPRDARACVIHGSDLRDMSSEQLDE--VLKHHDEIVFARTSPQQKLIIVEGCQRQGAIVAVTGDGVNDSPALKKADIGVAMGIAGSDVSKQAADMILLDDNFASIVTGVEEGRIIFDNLKKSIAYTLTSNIPEITPFLVFIL-----ADVPLPLGTITILCIDLGTDMVPAISLAYEEAESDIMKRKPRDPKHDKLVNERLI-SMAYGQI--GMIQASGGFFVYFVIMAEQGFWPSRLLGLRKEWDSAAVNDLADSYGQEWTFDQRKKLEYTCHTAFFVSI----VIVQWTDLMICKTRRNSI------------FQQGMWNHQMTFGLFFETTLAAF-LTYCPGL-DVALKMQPLRFTWWLPAIPFSASIFIYDEIRKFLLRKW 3102
            + I E PF+ST K   S++  ++ N+ Y +  KGA E I+  CS+    DG K   + D   +        L   G RVLGF    +  D+ N  +  +   +      D L F+GL+ + DPPR     AV K   AGI V M+TGD   TAKAIA+ VGI+                +    +     + V+ GS    +S E++D+  VL     +V AR SPQ K+ ++E   R+    A+TGDGVNDSP+LK A++G+AMGI GSDVSK+A+D++L DDNFASI+  VEEGR + DN++K +   L  N+ +    ++ ++          PL  + +L I + T   PA+ L  E+A  D+M R P D +      E +I + AYG I  G   AS    +Y       G    RL                  +  + T++   +  Y   +A F ++    +I+ W    +   RR+              F + +W +Q  F       ++AF + Y P + D     +P+   W L AI F+ + +I  E+ K   R++
Sbjct:  530 EHIAEFPFDSTVKRMSSVY-YNNHNETYNIYGKGAFESIISCCSSWYGKDGVKITPLTDCDVETIRKNVYSLSNEGLRVLGFASKSFTKDQVNDDQLKNITSNRATAESD-LVFLGLIGIYDPPRNETAGAVKKFHQAGINVHMLTGDFVGTAKAIAQEVGILP--------------TNLYHYSQEIVDSMVMTGSQFDGLSEEEVDDLPVLP----LVIARCSPQTKVRMIEALHRRKKFCAMTGDGVNDSPSLKMANVGIAMGINGSDVSKEASDIVLSDDNFASILNAVEEGRRMTDNIQKFVLQLLAENVAQALYLIIGLVFRDENGKSVFPLSPVEVLWIIVVTSCFPAMGLGLEKAAPDLMDRPPHDSEVGIFTWEVIIDTFAYGIIMTGSCMASFTGSLY-------GINSGRL-----------------GHDCDGTYNSSCRDVYRSRSAAFATMTWCALILAWE---VVDMRRSFFRMHPDTDSPVKEFFRSIWGNQFLFWSIIFGFVSAFPVVYIPVINDKVFLHKPIGAEWGL-AIAFTIAFWIGAELYKCGKRRY 1050          

HSP 2 Score: 129.413 bits (324), Expect = 8.780e-31
Identity = 105/386 (27.20%), Postives = 180/386 (46.63%), Query Frame = 1
Query:  199 HKISIKDLYIRLQTDPEKGLSIEEAKIRLARDGPNALTPPKTTPEWVKFCRQLFGGFSLLLWIGAALCFLAYAILSGAYEDPPKDNLYLGIVLTAVVVITGCFSYYQEAKSSKIMESFGKMVPQKANVIRDGKILEIAAENLVTGDIIDVKFGDRVPADIRVIQASSFKVDNSALTGESEAQVRSSEFTNDNPLETK-----NIAFFSTNAVEGTCKGVVISTGDNTVMGRIANLASGLEMGM------------------------------TPIAKEINHFIHIITGVAVFLGVSFFVIAFILGYFWLD--AVIFLIGIIVANVPEGXXXXXXXXXXXXXKKMAKKNCLVKNLEAVETLGSTSTICSDKTGTLTQNRMTVAHMW 1245
            H ++ ++    + T   +GL+ +E+  RL   G N L              Q+     ++L I  A+ F     ++G              V++ V+ +       QE K++K M S   +    A+VIR+GK   I ++++V GDI  VK GD +PAD+R+I+  +F  D S LTGES    + +        ET      N+AF S+  V+G  KG+VI T  N+ +G+IA    G + G+                              TP+ ++++    ++  +AV     F +I      F +D    I+ I + ++ +P  L+  +T+ +++ A  M  +N +V+ L+++E LG+ + ICSDKTGTLTQ +M    +W
Sbjct:   18 HTLTTEEAAEFIGTSLTEGLTQDESLRRLKAVGENTLGDDTKIDYKAMVLHQVCNAMIMVLVISMAISFAVRDWITGG-------------VISFVIAVNVLIGLVQEYKATKTMNSLKNLSSPNAHVIRNGKSETINSKDVVPGDICLVKVGDTIPADLRLIETKNFDTDESLLTGESLPVSKDANLVFGKEEETSVGDRLNLAFSSSAVVKGRAKGIVIKTALNSEIGKIAKSLQG-DSGLISRDPSKSWLQNTWISTKKVTGAFLGTNVGTPLHRKLSKLAVLLFWIAVL----FAIIVMASQKFDVDKRVAIYAICVALSMIPSSLVVVLTITMSVGAAVMVSRNVIVRKLDSLEALGAVNDICSDKTGTLTQGKMLARQIW 385          
BLAST of non-gastric H ,K -ATPase alpha subunit vs. Ensembl Yeast
Match: ENA5 (Protein with similarity to P-type ATPase sodium pumps; member of the Na+ efflux ATPase family [Source:SGD;Acc:S000002445])

HSP 1 Score: 176.792 bits (447), Expect = 1.883e-45
Identity = 175/569 (30.76%), Postives = 268/569 (47.10%), Query Frame = 1
Query: 1492 KKIVEIPFNSTNKYQVSIHETSDGNQGYLLAMKGAPERILERCSTIL-IDG-KEMEMDDHWRQEFNNAYLELGGMGERVLGFCD--YRLDENNFPRGFDFNPDEVNFPLDGLRFVGLMSMIXXXXXXXXXXXXKCRSAGIKVIMVTGDHPITAKAIAKGVGIISEGNKTVDDIAAERGISPSEVNPRDARACVIHGSDLRDMSSEQLDE--VLKHHDEIVFARTSPQQKLIIVEGCQRQGAIVAVTGDGVNDSPALKKADIGVAMGIAGSDVSKQAADMILLDDNFASIVTGVEEGRIIFDNLKKSIAYTLTSNIPEITPFLVFIL-----ADVPLPLGTITILCIDLGTDMVPAISLAYEEAESDIMKRKPRDPKHDKLVNERLI-SMAYGQI--GMIQASGGFFVYFVIMAEQGFWPSRLLGLRKEWDSAAVNDLADSYGQEWTFDQRKKLEYTCHTAFFVSI----VIVQWTDLMICKTRRNSI------------FQQGMWNHQMTFGLFFETTLAAF-LTYCPGL-DVALKMQPLRFTWWLPAIPFSASIFIYDEIRKFLLRKW 3102
            + I E PF+ST K   S++  ++ N+ Y +  KGA E I+  CS+    DG K   + D   +        L   G RVLGF    +  D+ N  +  +   +      D L F+GL+ + DPPR     AV K   AGI V M+TGD   TAKAIA+ VGI+                +    +     + V+ GS    +S E++D+  VL     +V AR SPQ K+ ++E   R+    A+TGDGVNDSP+LK A++G+AMGI GSDVSK+A+D++L DDNFASI+  VEEGR + DN++K +   L  N+ +    ++ ++          PL  + +L I + T   PA+ L  E+A  D+M R P D +      E +I + AYG I  G   AS    +Y       G    RL                  +  + T++   +  Y   +A F ++    +I+ W    +   RR+              F + +W +Q  F       ++AF + Y P + D     +P+   W L AI F+ + +I  E+ K   R++
Sbjct:  530 EHIAEFPFDSTVKRMSSVY-YNNHNETYNIYGKGAFESIISCCSSWYGKDGVKITPLTDCDVETIRKNVYSLSNEGLRVLGFASKSFTKDQVNDDQLKNITSNRATAESD-LVFLGLIGIYDPPRNETAGAVKKFHQAGINVHMLTGDFVGTAKAIAQEVGILP--------------TNLYHYSQEIVDSMVMTGSQFDGLSEEEVDDLPVLP----LVIARCSPQTKVRMIEALHRRKKFCAMTGDGVNDSPSLKMANVGIAMGINGSDVSKEASDIVLSDDNFASILNAVEEGRRMTDNIQKFVLQLLAENVAQALYLIIGLVFRDENGKSVFPLSPVEVLWIIVVTSCFPAMGLGLEKAAPDLMDRPPNDSEVGIFTWEVIIDTFAYGIIMTGSCMASFTGSLY-------GINSGRL-----------------GHDCDGTYNSSCRDVYRSRSAAFATMTWCALILAWE---VVDMRRSFFRMHPDTDSPVKEFFRSIWGNQFLFWSIIFGFVSAFPVVYIPVINDKVFLHKPIGAEWGL-AIAFTIAFWIGAELYKCGKRRY 1050          

HSP 2 Score: 129.798 bits (325), Expect = 7.273e-31
Identity = 105/386 (27.20%), Postives = 180/386 (46.63%), Query Frame = 1
Query:  199 HKISIKDLYIRLQTDPEKGLSIEEAKIRLARDGPNALTPPKTTPEWVKFCRQLFGGFSLLLWIGAALCFLAYAILSGAYEDPPKDNLYLGIVLTAVVVITGCFSYYQEAKSSKIMESFGKMVPQKANVIRDGKILEIAAENLVTGDIIDVKFGDRVPADIRVIQASSFKVDNSALTGESEAQVRSSEFTNDNPLETK-----NIAFFSTNAVEGTCKGVVISTGDNTVMGRIANLASGLEMGM------------------------------TPIAKEINHFIHIITGVAVFLGVSFFVIAFILGYFWLD--AVIFLIGIIVANVPEGXXXXXXXXXXXXXKKMAKKNCLVKNLEAVETLGSTSTICSDKTGTLTQNRMTVAHMW 1245
            H ++ ++    + T   +GL+ +E+  RL   G N L              Q+     ++L I  A+ F     ++G              V++ V+ +       QE K++K M S   +    A+VIR+GK   I ++++V GDI  VK GD +PAD+R+I+  +F  D S LTGES    + +        ET      N+AF S+  V+G  KG+VI T  N+ +G+IA    G + G+                              TP+ ++++    ++  +AV     F +I      F +D    I+ I + ++ +P  L+  +T+ +++ A  M  +N +V+ L+++E LG+ + ICSDKTGTLTQ +M    +W
Sbjct:   18 HTLTTEEAAEFIGTSLTEGLTQDESLRRLKAVGENTLGDDTKIDYKAMVLHQVCNAMIMVLVISMAISFAVRDWITGG-------------VISFVIAVNVLIGLVQEYKATKTMNSLKNLSSPNAHVIRNGKSETINSKDVVPGDICLVKVGDTIPADLRLIETKNFDTDESLLTGESLPVSKDANLVFGKEEETSVGDRLNLAFSSSAVVKGRAKGIVIKTALNSEIGKIAKSLQG-DSGLISRDPSKSWLQNTWISTKKVTGAFLGTNVGTPLHRKLSKLAVLLFWIAVL----FAIIVMASQKFDVDKRVAIYAICVALSMIPSSLVVVLTITMSVGAAVMVSRNVIVRKLDSLEALGAVNDICSDKTGTLTQGKMLARQIW 385          
BLAST of non-gastric H ,K -ATPase alpha subunit vs. Ensembl Nematostella
Match: EDO40680 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S6M1])

HSP 1 Score: 1427.54 bits (3694), Expect = 0.000e+0
Identity = 718/1003 (71.59%), Postives = 832/1003 (82.95%), Query Frame = 1
Query:  181 ELDIDSHKISIKDLYIRLQTDPEKGLSIEEAKIRLARDGPNALTPPKTTPEWVKFCRQLFGGFSLLLWIGAALCFLAYAILSGAYEDPPKDNLYLGIVLTAVVVITGCFSYYQEAKSSKIMESFGKMVPQKANVIRDGKILEIAAENLVTGDIIDVKFGDRVPADIRVIQASSFKVDNSALTGESEAQVRSSEFTNDNPLETKNIAFFSTNAVEGTCKGVVISTGDNTVMGRIANLASGLEMGMTPIAKEINHFIHIITGVAVFLGVSFFVIAFILGYFWLDAVIFLIGIIVANVPEGXXXXXXXXXXXXXKKMAKKNCLVKNLEAVETLGSTSTICSDKTGTLTQNRMTVAHMWFDNKIQESDTSENQITSSTKQESETWKMLARVAMLCNRAQFKSGEEEKPVLKRECTGDASESALLKCVELSIGGVTKYRGENKKIVEIPFNSTNKYQVSIHETSD----------------GNQGYLLAMKGAPERILERCSTILIDGKEMEMDDHWRQEFNNAYLELGGMGERVLGFCDYRLDENNFPRGFDFNP-DEVNFPLDGLRFVGLMSMIXXXXXXXXXXXXKCRSAGIKVIMVTGDHPITAKAIAKGVGIISEGNKTVDDIAAERGISPSEVNPRDARACVIHGSDLRDMSSEQLDEVLKHHDEIVFARTSPQQKLIIVEGCQRQGAIVAVTGDGVNDSPALKKADIGVAMGIAGSDVSKQAADMILLDDNFASIVTGVEEGRIIFDNLKKSIAYTLTSNIPEITPFLVFILADVPLPLGTITILCIDLGTDMVPAISLAYEEAESDIMKRKPRDPKHDKLVNERLISMAYGQIGMIQASGGFFVYFVIMAEQGFWPSRLLGLRKEWDSAAVNDLADSYGQEWTFDQRKKLEYTCHTAFFVSIVIVQWTDLMICKTRRNSIFQQGMWNHQMTFGLFFETTLAAFLTYCPGLDVALKMQPLRFTWWLPAIPFSASIFIYDEIRKFLLRKWKNGSWLENETYY 3138
            ELD+D H+I++++L  RL T+ + GL+ EEA IRL RDGPNALTPP TTPEWVKF +Q+FGGF++LLWIGA LCF+A  I+    E+P +DNLYLGIVL  VV++TG FSYYQE+KSSKIMESF  +VPQ+ANV+R G    + AENLV GD++ VK GDR+P DIR+++  SFKVDNS+LTGESE Q R  + T++NPLET+N+AFFST A+EG   GVV+ TGDNTVMGRIANLASGL  G TPIA EI HFIHIITGVAVFLGV+FF+IAFIL Y WL+AVIFLIGIIVANVPEGLLATVTVCLTLTAK+MA KNCLVKNLEAVETLGSTSTICSDKTGTLTQNRMTVAH+W+DN I E+DTSE+Q  +S +++S TW  L+RVA LCNRA+FK+ +E+KPVLKRECTGDASESALLK VEL+IG V  +R  +KK+ EIPFNSTNKYQVSIHE  D                 N  ++L MKGAPERIL+RCSTIL++GKE  +DD  ++ FN AYL+LGG+GERVLGFC + L    FP GF+F+P D  NFPL+GL FVGLMSMIDPPRAAVPDAV+KCRSAGIKVIMVTGDHPITAKAIAKGVGIISEG +TV+DIA    I   EV+   A+A V+HGS L+D   E++D +L +H EIVFARTSPQQKLIIVEGCQR GAIVAVTGDGVNDSPALKKADIGVAMGIAGSDVSKQAADMILLDDNFASIVTGVEEGR+IFDNLKKSIAYTLTSNIPEI+PFL+FI+ D+PLPLGT+TILCIDLGTDMVPAISLAYE AE+DIMKR+PRDP +DKLVNERLI+MAYGQIGMIQAS GFF YFVIMAE GF PS L GLR++WD    + + DSYGQEW + QRK LEYTCHTAFFVSIVIVQW DL+ICKTRRNS+F QGM N  + FGLFFET LAAF +Y PG+   L+M PL + WW PA+PFS  I+IYDE R+++LR++  G WL+ ETYY
Sbjct:   66 ELDVDWHRITVEELMTRLDTNVQTGLTDEEAAIRLKRDGPNALTPPPTTPEWVKFMKQMFGGFAMLLWIGAILCFIAQGIMEATEEEPLRDNLYLGIVLAFVVIVTGIFSYYQESKSSKIMESFKNLVPQEANVLRSGGRKTVGAENLVIGDVVSVKGGDRLPGDIRILECKSFKVDNSSLTGESEPQSRGPDCTHENPLETRNLAFFSTYALEGNATGVVVQTGDNTVMGRIANLASGLGSGKTPIAVEIEHFIHIITGVAVFLGVTFFIIAFILKYKWLEAVIFLIGIIVANVPEGLLATVTVCLTLTAKRMASKNCLVKNLEAVETLGSTSTICSDKTGTLTQNRMTVAHLWYDNNIVEADTSEDQKQASGEKKSTTWYALSRVATLCNRAEFKADQEDKPVLKRECTGDASESALLKYVELAIGNVISFRKNHKKVCEIPFNSTNKYQVSIHEIPDEPEHDIEEGSDVDEREKNSKHILVMKGAPERILDRCSTILVNGKEQALDDKEKENFNQAYLDLGGLGERVLGFCHFYLPTEQFPLGFEFDPEDNPNFPLEGLCFVGLMSMIDPPRAAVPDAVSKCRSAGIKVIMVTGDHPITAKAIAKGVGIISEGTETVEDIAERLNIPVEEVDETKAKAIVVHGSQLKDYDQEKIDGILCNHTEIVFARTSPQQKLIIVEGCQRMGAIVAVTGDGVNDSPALKKADIGVAMGIAGSDVSKQAADMILLDDNFASIVTGVEEGRLIFDNLKKSIAYTLTSNIPEISPFLMFIILDIPLPLGTVTILCIDLGTDMVPAISLAYEHAENDIMKRQPRDPINDKLVNERLIAMAYGQIGMIQASAGFFTYFVIMAENGFRPSLLFGLRRQWDDKYNHSVVDSYGQEWGYSQRKILEYTCHTAFFVSIVIVQWADLIICKTRRNSLFTQGMTNKFLNFGLFFETALAAFFSYTPGMSNGLRMYPLNWQWWFPAMPFSLIIWIYDECRRWILRRYP-GCWLDKETYY 1067          
BLAST of non-gastric H ,K -ATPase alpha subunit vs. Ensembl Nematostella
Match: EDO36455 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SII2])

HSP 1 Score: 1343.18 bits (3475), Expect = 0.000e+0
Identity = 697/989 (70.48%), Postives = 808/989 (81.70%), Query Frame = 1
Query:  181 ELDIDSHKISIKDLYIRLQTDPEKGLSIEEAKIRLARDGPNALTPPKTTPEWVKFCRQLFGGFSLLLWIGAALCFLAYAILSGAYEDPPKDNLYLGIVLTAVVVITGCFSYYQEAKSSKIMESFGKMVPQKANVIRDGKILEIAAENLVTGDIIDVKFGDRVPADIRVIQASSFKVDNSALTGESEAQVRSSEFTNDNPLETKNIAFFSTNAVEGTCKGVVISTGDNTVMGRIANLASGLEMGMTPIAKEINHFIHIITGVAVFLGVSFFVIAFILGYFWLDAVIFLIGIIVANVPEGXXXXXXXXXXXXXKKMAKKNCLVKNLEAVETLGSTSTICSDKTGTLTQNRMTVAHMWFDNKIQESDTSENQITSSTKQESETWKMLARVAMLCNRAQFKSGEEEKPVLKRECTG-DASESALLKCVELSIGGVTKYRGENKKIVEIPFNSTNKYQVSIHETSDGNQGY--LLAMKGAPERILERCSTILIDGKEMEMDDHWRQEFNNAYLELGGMGERVLGFCDYRLDENNFPRGFDFNPDEVNFPLDGLRFVGLMSMIXXXXXXXXXXXXKCRSAGIKVIMVTGDHPITAKAIAKGVGIISEGNKTVDDIAAERGISPSEVNPRDARACVIHGSDLRDMSSEQLDEVLKHHDEIVFARTSPQQKLIIVEGCQRQGAIVAVTGDGVNDSPALKKADIGVAMGIAGSDVSKQAADMILLDDNFASIVTGVEEGRIIFDNLKKSIAYTLTSNIPEITPFLVFILADVPLPLGTITILCIDLGTDMVPAISLAYEEAESDIMKRKPRDPKHDKLVNERLISMAYGQIGMIQASGGFFVYFVIMAEQGFWPSRLLGLRKEWDSAAVNDLADSYGQEWTFDQRKKLEYTCHTAFFVSIVIVQWTDLMICKTRRNSIFQQGMWNHQMTFGLFFETTLAAFLTYCPGLDVALKMQPLRFTWWLPAIPFSASIFIYDEIRKFLLRKWKNGSWLENETYY 3138
            EL++D HK+ ++ L  RL +  EKGLS EEA++RL RDGPN LTPP TTPEWVKF + LFGGFSLLLW+GA  C++ Y+I     E+PP+D+LYLG+ LT VVV+T CFSYYQE+KSSKIM+SF  MVPQ+A ++RDGK +   AE +V GDII V  GDRVPADIRVI++  FKVDNS+LTGESE Q R  EFT++NPLETKN+AFFSTNAVEGTC G+V+ TGDNTVMGRIA LASGL  G TPIA EI HFIHIITGVAV LGV+FF+I+ +LGY  L AVIFLIGIIVANVPEGLLATVTVCLTLTAK+MA KNCLVKNLEAVETLGSTSTICSDKTGTLTQNRMTVAHMWFDNK  E+DT+E+Q + +  +++ETW  L R+A LCNRA+F SG++   VL+R+  G +ASE+ALLKCVEL +G VTK R E  ++ EIPFNSTNKY VSIHE +D N  Y   L MKGAPER+L+RCSTILI G+   +DD  +Q F  AYL+LGGMGERVLGF  + LD+ NFP GF+F  DE NFP++GL FVGLMSMIDPPRAAVPDAVAKCRSAGIKV MVTGDHPITAKAIA+GVGIISEG +TV+DI+    I   EV+   A A V+HG +L+DM+ + +D++LK+H EIVFARTSPQQKLIIVEGCQR GAIVAVTGDGVNDSPALKKADIG+AMGI+GSDVSKQAADMILLDDNFASIVTGVEEGR+IFDNLKKSIAYTLTSNIPEITPFL+FI+A +P PLGTITILCIDLGTDMVPAISLAYEEAESDIMKR PRDP+ +KLVNERLISM YGQIG +QAS GF  YFVIMAE GF P  L  +R  W+    N L DSYGQEW + QRK LE+TCH+AFFVSIV+VQW DL+ICKTRRNSI  Q M NH +  GL FET LAAFL Y PGL  AL +  L  +WW   +P+S  IF+YDE+R+++LRK+  G W+E ETYY
Sbjct:   73 ELEVDWHKVPLEALVNRLDSSVEKGLSQEEAEVRLERDGPNCLTPPPTTPEWVKFLKLLFGGFSLLLWVGAIFCYIVYSIKMSVEEEPPQDDLYLGVTLTFVVVVTACFSYYQESKSSKIMDSFKNMVPQEATILRDGKKVVKNAEQVVIGDIIFVAIGDRVPADIRVIESKGFKVDNSSLTGESEPQARGPEFTHENPLETKNLAFFSTNAVEGTCTGIVVQTGDNTVMGRIAGLASGLGSGKTPIAIEIGHFIHIITGVAVALGVTFFIISLVLGYTILQAVIFLIGIIVANVPEGLLATVTVCLTLTAKRMAAKNCLVKNLEAVETLGSTSTICSDKTGTLTQNRMTVAHMWFDNKTFEADTTEDQ-SGTAMEKTETWTALGRIAGLCNRAEFVSGQDNVAVLRRDTMGGNASEAALLKCVELQVGSVTKMREEFHRVAEIPFNSTNKYHVSIHEINDENSTYSHHLLMKGAPERVLDRCSTILIKGELKPLDDDMKQAFEMAYLDLGGMGERVLGFAQHYLDKENFPIGFEFETDEPNFPVEGLCFVGLMSMIDPPRAAVPDAVAKCRSAGIKVFMVTGDHPITAKAIAQGVGIISEGTETVEDISLRLEIPVEEVDKSQADAIVVHGGELKDMTDKDIDDILKNHKEIVFARTSPQQKLIIVEGCQRNGAIVAVTGDGVNDSPALKKADIGIAMGISGSDVSKQAADMILLDDNFASIVTGVEEGRLIFDNLKKSIAYTLTSNIPEITPFLMFIVAGIPQPLGTITILCIDLGTDMVPAISLAYEEAESDIMKRMPRDPRTEKLVNERLISMTYGQIGFMQASAGFLTYFVIMAENGFLPGDLFNIRGLWEDKTNNTLLDSYGQEWGYAQRKVLEFTCHSAFFVSIVVVQWADLIICKTRRNSIITQKMNNHILIIGLIFETALAAFLLYTPGLSTALSLYGLNASWWFIGVPYSILIFVYDEVRRYILRKYPGG-WVEQETYY 1059          
BLAST of non-gastric H ,K -ATPase alpha subunit vs. Ensembl Nematostella
Match: EDO35616 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SL15])

HSP 1 Score: 345.895 bits (886), Expect = 3.985e-103
Identity = 291/994 (29.28%), Postives = 471/994 (47.38%), Query Frame = 1
Query:  196 SHKISIKDLYIRLQTDPEKGLSIEEAKIRLARDGPNALTPPKTTPEWVKFCRQLFGGFSLLLWIGAALCFLAYAILSGAYEDPPKDNLYLGIVLTAVVVITGCFSYYQEAKSSKIMESFGKMVPQKANVIRDGKILEIAAENLVTGDIIDVKFGDRVPADIRVIQASSFKVDNSALTGESEAQVRSS-----EFTNDNPLETKNIAFFSTNAVEGTCKGVVISTGDNTVMGRIANLASGLEMGMTPIAKEINHFIHIITGVAVFLGVSFFVIAFILGYFWLDAVI--FLIGI--IVANVPEGXXXXXXXXXXXXXKKMAKKNCLVKNLEAVETLGSTSTICSDKTGTLTQNRMTVAHMWFDNKIQESDT------------SENQITSSTKQESETWKMLARVAMLCNRAQFKSGEEEKPVLKRECTGDASESALLKCVELSIGGVTKYRGENKKIVEIPFNSTNKYQV----SIHETSDGNQGY--LLAMKGAPERILERCSTILIDGKEMEMDDHWRQEFNNAYLELGGMGERVLGFCDYRLDENNFPRGFDFNPDEVNFPLDGLRFVGLMSMIXXXXXXXXXXXXKCRSAGIKVIMVTGDHPITAKAIAKGVGIISEGNKTVDDIAAERGISPSEVNPRDARACVIHGSDLRDMSSEQLDEVLKHHDEI-VFARTSPQQKLIIVEGCQRQGAIVAVTGDGVNDSPALKKADIGVAMGIAGSDVSKQAADMILLDDNFASIVTGVEEGRIIFDNLKKSIAYTLTSNIPEITPFLVFILADVPLPLGTITILCIDLGTDMVPAISLAYEEAESDIMKRKPRDPKHDKLVNERLISMAYGQIGMIQASGGFFVYFVIMAEQGFWPSRLLGLRKEWDSAAVNDLADSYGQEWTFDQRKKLEYTCHTAFFVSIVIVQWTDLMICKTRRNSIFQQGMWNHQMTFGLFFETTLAAFLT-YCPGLDVALKMQPLRFTWWLPAIPFSASIFIYDEIRKFL 3090
            +  ++++++  +  TD  +GLS +E + R    G N     +    W K+  Q      LLL     +     +I  G ++D           +T  ++I    ++ QE +S K +E+  K+VP + + +R GK+    A  LV GD++ +  GDRVPADIR+ +A   ++D S+ TGE E   +++       +       +NIAF  T    G  KGVVI TG+N+  G I  L    E   TP+ K ++     ++    F  +    +  +LG+    A++  F IG+   VA +PEGL   VTV L L   +MAK+N +VK L  VETLG +S ICSDKTGTLT+N MTV+ ++  +      T            +E+ IT ++   + +         LCN A  ++G     VL  + T  A  +   K    + G       +  ++ E PF+S  K         H +S   +    +  +KGAPE ++ +C++   +G  + M     +   +A L +   G RV+ F            G D         L  L ++G+M ++DPPR  V +AV     +G++V M+TGD   TA  IA+ +GI  +G  T                        + G +L  +   QL  ++   D++ VF R SP+ K+ IV+  Q+ G +VA+TGDGVND+ ALK+ADIG+AMG +G+DVSK+AA+MIL+DD+F +I+  +EEG+ IF N+K  + + L+++I  I+   +     +P PL  + IL I++  D  PA SL  E  +SD+M+R PR+ K   ++ + LI+       ++   G  +V++  M +    P                             +   + +TC   F          + + C+++  SIFQ G   ++M       + +  FL  Y   L    + + L  T  L  +  S+S+FI DEIRKF+
Sbjct:   11 ASAMAVEEVLKQFNTDQSRGLSNDEIERRRMLHGWNEFDVVEEKALWKKYLDQFKEPMILLLLASGFV-----SICMGQFDD--------AFSITVAILIVVTVAFVQEYRSDKSVEAITKLVPPQCHCVRAGKMFNFLARCLVPGDLVCISIGDRVPADIRLTEAVDLEIDESSFTGEMEPASKTTLPIPAVNSGSGVSARRNIAFMGTLVRSGRGKGVVIGTGENSEFGEIFKLMKAEETPKTPLQKSMDSLGKQLS----FYSLCIIGLIVLLGWIQKRAILEMFTIGVSLAVAAIPEGLPIVVTVTLALGVMRMAKRNAIVKKLPIVETLGCSSVICSDKTGTLTKNEMTVSQIFTADGFYAEATGVGYSPLGEVILNEDPITYTS---NSSIAKTVEAGYLCNNASIRNG-----VLYGQPTEGAIVTVAQKASTFTCGI------DFVRVDERPFSSEKKLMAVKCRRKHRSSAMAEIARDIYYVKGAPENVMRQCTSYYKNGSAVPMTAKDVERIGDAVLAMSSRGLRVIAFA----------HGED---------LQQLTYLGIMGLLDPPRNGVREAVRTLLDSGVQVKMITGDSRETAITIAELLGIHFKGRPT------------------------LSGEELEALDGLQLSTII---DQVSVFYRVSPRHKVAIVKALQQHGHVVAMTGDGVNDAVALKRADIGIAMGKSGTDVSKEAAEMILVDDDFNTIMAAIEEGKGIFYNIKNFVRFQLSTSIAAISLITISTFLKLPNPLNAMQILWINIIMDGPPAQSLGVEPVDSDVMRRPPRNVK-SPMITKTLIAKVISA-ALLIVCGTLWVFWREMRDNIITP-----------------------------RDTTMTFTCFVFF-------DMFNALSCRSQEKSIFQVGFLTNRMFLYAVGGSLIGQFLVIYFAPLQAVFQTEALHITDILLLLAVSSSVFIVDEIRKFI 889          
BLAST of non-gastric H ,K -ATPase alpha subunit vs. Ensembl Nematostella
Match: EDO47465 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RM93])

HSP 1 Score: 334.724 bits (857), Expect = 2.786e-98
Identity = 305/1047 (29.13%), Postives = 490/1047 (46.80%), Query Frame = 1
Query:  196 SHKISIKDLYIRLQTDPEKGLSIEEAKIRLARDGPNALTPPKTTPEWVKFCRQLFGGFSLLLWIGAALCFLAYAILSG-----AYEDPPKDNLYLGIVLTAVVVITGCFSYYQEAKSSKIMESFGKMVPQKANVIRDGK--ILEIAAENLVTGDIIDVKFGDRVPADIRV--IQASSFKVDNSALTGESEAQVRSSEFTNDNPL---ETKNIAFFSTNAVEGTCKGVVISTGDNTVMGRIANLASGLEMGMTPIAKEINHFIHIITGVAVFLGVSFFVIAF------ILGYFWLDAVIFLIGIIVANV----PEGXXXXXXXXXXXXXKKMAKKNCLVKNLEAVETLGSTSTICSDKTGTLTQNRMTVAHMWFDNK-----------IQESDTSENQITSSTKQ----ESETWKMLARVAMLCNRAQFKSGEEEKPVLKRECTGDASESALLKCVE------LSIGGVTKYRGEN--KKIVEIPFN-------STNKYQVSIH--ETSDGNQGYL-----LAMKGAPERILERCSTILIDGKEMEMDDHWRQEFNNAYLELGGMGERVLGFCDYRLDENNFPRGFDFNPDE--VNFPLDGLRFVGLMSMIXXXXXXXXXXXXKCRSAGIKVIMVTGDHPITAKAIAKGVGIISEGNKTVDDIAAERGISPSEVNPRDARACVIHGSDLRDMS-SEQLDEVLKHHDEIVFARTSPQQKLIIVEGCQRQGAIVAVTGDGVNDSPALKKADIGVAMGIAGSDVSKQAADMILLDDNFASIVTGVEEGRIIFDNLKKSIAYTLTSNIPEITPFLVFILADVPLPLGTITILCIDLGTDMVPAISLAYEEAESDIMKRKPRDPKHDK----LVNERLISMAYGQIGMIQASGGFFVYFVIMAEQGFW-----------PSRLLGLRKEWDSAAVNDLADSYGQEWTFDQRKKLEYTCHTAFFVSIVIVQWTDLMICKTRRNSIFQQGMWNHQMTFGLFFETTLAAFLT-YCPGLDVALKMQPLRFTWWLPAIPFSASIFIYDEIRKFLLRKW 3102
            +H   + ++         KGL   + K    + GPN L      P W     Q       +L + A + F+      G     A+ +P        IV+  ++++      +QE  +   +E+  +  P+ A V R  K  I  I A +LV GDI++V  GD+VPADIR+  I++++ +VD S LTGES + V+ ++   D      +  N+ F  TN   G C GVV+ TG +T +G+I +     +   TP+ ++++ F   ++ V   + ++ + I        I G  WL   I+   I VA      PEGL A VT+CL L  ++MAKKN +V++L +VETLG TS ICSDKTGTLT N+M+V H +F  K            +   T+ + +   TK      +  +++L   A +C+     S +        E  G+++E+AL+  VE      + + G TK +      + ++  FN       S ++  +S++     DG   +L     + +KGAPE IL+RC  + +  K+  M    + +  +     G   + +       +D+   P   D    E  VN+    + FVG+  M+DPPR  V DA+  C  AGI+VI++TGD+  TA+AI + + +  +   T        G+S S             G +  D++ SEQ +  L+     +F+R  P  K  IV   Q +G I A+TGDGVND+PALKKA+IGVAMG +G+ V+K A++MIL DDNF++IV  VEEGR I+DN K+ I Y ++SNI E+    +     +P  L  + +L ++L TD  PA +L++   +SDIM + PR P+       L    L    Y     + AS  +F+++    +  ++           PS   GL    D A   DL                     T     +V ++  + +       S+     W +         + L  FL  Y P  +   ++ PL +  W+  + FS  + + DE+ KF+ R +
Sbjct:    4 AHTKPVPEILKYFNVSESKGLDPAQVKQFQKKFGPNELPAEDGKPLWKLVLEQFDDLLVKILLVAAVISFVLALFEEGEDQTTAFVEP--------IVILVILILNAIIGVWQERNAESAIEALKEYEPEIAKVQRQDKSGIQMIKARDLVPGDIVEVAVGDKVPADIRITTIKSTTLRVDQSILTGESISVVKHTDAIPDERAVNQDKTNMLFSGTNIASGKCSGVVVGTGLSTQIGKIRDQMIPSDDERTPLQQKLDEFGEQLSKVITIICIAVWAINIGHFNDPIHGGSWLKGAIYYFKIAVALAVAAIPEGLPAVVTICLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMSV-HKFFVMKDISRGRAEFHEFEVEGTTYDPVGDITKDGRNVTTSDYEVLPEFATICSLCNDSSVDYNNVRDSYEKVGESTETALIVLVEKLNVLNVDLEGKTKAQLATICNESIKNHFNKEFTLEFSRDRKSMSVYCVPQKDGPNSFLDGKPKMFVKGAPEGILDRCDFVRVGNKKHPMTPKMKAQILDLIKAYGTGADTLRCLALATVDDPIAPSKMDLEASEKFVNYE-SHMTFVGVAGMLDPPRPEVTDAIKLCAKAGIRVIVITGDNKATAEAICRRIEVFGQDEDTT-------GLSYS-------------GREFDDLTPSEQREACLRAR---LFSRVEPSHKSKIVTYLQEEGEISAMTGDGVNDAPALKKAEIGVAMG-SGTAVAKTASEMILADDNFSTIVAAVEEGRSIYDNTKQFIRYLISSNIGEVVSIFLTAALGMPEALIPVQLLWVNLMTDGPPATALSFNPPDSDIMSKPPRSPRQPLISGWLFFRYLAIGVYVGCATVGASAWWFMFYENGPKVSYYQLTHHMQCGTDPS--FGL----DCAVFGDLHP------------------MTMALSVLVTIEMFNALNSLAENESLLTMPPWRNPSLLTAIAASFLMHFLILYFPITNTIFRITPLNWVEWMAVLKFSFPVILLDEVLKFISRTF 992          
BLAST of non-gastric H ,K -ATPase alpha subunit vs. Ensembl Nematostella
Match: EDO41774 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S3H9])

HSP 1 Score: 206.453 bits (524), Expect = 2.097e-54
Identity = 220/787 (27.95%), Postives = 375/787 (47.65%), Query Frame = 1
Query:  469 IVLTAVVVITGCFSYYQEAKSSKIMESFGKMVPQKANVIRD-GKILEIAAENLVTGDIIDVKFGDRVPADIRVIQASSFKVDNSALTGESEAQVRSSEFTNDNPLETKNIAFFSTNAVEGTCKGVVISTGDNT---VMGRIANLAS-GLEMGMTPIA----------------KEINHFIH-IITGVAVFLG-----VSFFVIAFILGYF-------------------WLDAVIFLIGIIVANVPEGXXXXXXXXXXXXXKKMAKKNCLVKNLEAVETLGSTSTICSDKTGTLTQNRMTVAHMWFDNKIQESDTSENQITSSTKQESETWKMLARVAMLCNRAQFKSGEEEKPVLKRECTGDASESALLKCVELSIGGVTKY----RGENKKIVEIPFNSTNKYQVSIHETSDGNQGYLLAMKGAPERILERC-STILIDGKEMEMDDHWRQEFNNAYL-ELGGMGERVLGFCDYRLDENNFPRGFDFNPDEVNFPLDGLRFVGLMSMIXXXXXXXXXXXXKCRSAGIKVIMVTGDHPITAKAIAKGVGIISEGNKTVDDIAAERGISPSEVNPRDARACVIHGSDLRD----MSSEQLDEVLKHHDEIVFARTSPQQKLIIVE-----GCQRQGAIVAVTGDGVNDSPALKKADIGVAMGIAGSDVSKQAADMILLDDNFASIVTGVEEGRIIFDNLKKSIAYTLTSNIPEITPFLVFILADVPL---PLGTITILCIDLGTDMVPAISLAYEEAESDIMKRKPRDPKHDKLVNERLISMAYGQI 2637
            +V+  ++++    S Y      +  +    M  ++  VIRD G + +I    LV GD+  +K G  V AD  V+Q+S   VD + L   SE   R     +  PL      F  T+ V+GT K +V++ G +T   +  R+ + AS G+E+   P                  KE N  +   +  VAV LG     V+   +  I+ +F                   ++ A I  + ++V +VPEGL   VT  L    K M  K  LVK+++ +ET+G+ S I  +KTG LT++RM V  M+  +++ + D    +    ++   + +K ++      ++ Q  +G +  PV      G+ ++ +LL+ + L +G   +Y      E++ +    F S  K   ++ E      G+ +  KGA E +L RC STI  DGK     D  R+      + E+     ++L      L +++  +G   +  +V   L+ L  + ++ + DP R  VP+A+ KC  AGI+V MV+GD   TA+A+A  VGI+    K  +DI    G    E N           S +RD    +++++ + +       V AR + + K  +V+     G  RQG +VAVTG GV+D P L+KAD+G  MG++GSDV+K +AD++LLDDNF SIV  ++ GR +++ + K + +  T      + F+V ++        PLG   +L ++L  D + +++L  +    D+++ +P   +H  L+   LI    G +
Sbjct:  135 LVMVVLMILISALSDYLRDADFRCQQKRVHM-EERVTVIRDSGAVKDILKSELVVGDLCLLKAGSLVAADGVVVQSSDLVVDET-LFSRSE---RHKSVVD--PL-----VFAGTHVVKGTGKFIVLAVGASTQAMMQLRLGDPASPGIELQPAPAGPINNKGSQNLLEFKRHKEENATLEGKVNRVAVALGYIGIAVALITMIVIMVHFSVTNYYTNEKPAKPEDVNMYVRAFIMGMVVLVVSVPEGLPLAVTFALAFCTKMMYNKQSLVKHMDIIETMGNVSNIYCNKTGVLTEHRMRVDRMFIADQLLDGDPKVYKHKIPSELLDDLFKAISLNTSYSSQIQ-PAGRDHLPVQ----VGNKTDCSLLQLM-LEMGETYQYWRDDHPEDRFVKVFAFTSERKSMTTVLEKE--KDGFYVYTKGAAEILLPRCTSTITTDGKMRPFTDEDRERLRKEVMEEMHKQALKILVLACRSLSDSD--KGLLEDEAKV---LEDLTLMAVVGIEDPIREKVPEAIWKCDRAGIRVCMVSGDSIQTARAVAARVGIL----KPDEDILMYTG---QEFN-----------SYIRDPDGKVNTDRFNSMWPKLK--VLARATARDKYTLVKHVMGSGVNRQGEMVAVTGAGVHDGPVLRKADVGFTMGVSGSDVAKDSADVVLLDDNFGSIVWAIKWGRNVYNTVVKFLMFQFTVT---WSAFIVVVIGACVTGRSPLGATQLLWVNLIMDSLASLALTRDFPTDDLLRHQPYG-RHKALIGRTLIRNVVGHV 872          
BLAST of non-gastric H ,K -ATPase alpha subunit vs. Ensembl Medaka
Match: ENSORLT00000046641.1 (sodium/potassium-transporting ATPase subunit alpha-3 [Source:NCBI gene;Acc:101159291])

HSP 1 Score: 1483.77 bits (3840), Expect = 0.000e+0
Identity = 737/987 (74.67%), Postives = 849/987 (86.02%), Query Frame = 1
Query:  181 ELDIDSHKISIKDLYIRLQTDPEKGLSIEEAKIRLARDGPNALTPPKTTPEWVKFCRQLFGGFSLLLWIGAALCFLAYAILSGAYEDPPKDNLYLGIVLTAVVVITGCFSYYQEAKSSKIMESFGKMVPQKANVIRDGKILEIAAENLVTGDIIDVKFGDRVPADIRVIQASSFKVDNSALTGESEAQVRSSEFTNDNPLETKNIAFFSTNAVEGTCKGVVISTGDNTVMGRIANLASGLEMGMTPIAKEINHFIHIITGVAVFLGVSFFVIAFILGYFWLDAVIFLIGIIVANVPEGXXXXXXXXXXXXXKKMAKKNCLVKNLEAVETLGSTSTICSDKTGTLTQNRMTVAHMWFDNKIQESDTSENQITSSTKQESETWKMLARVAMLCNRAQFKSGEEEKPVLKRECTGDASESALLKCVELSIGGVTKYRGENKKIVEIPFNSTNKYQVSIHETSDGNQG-YLLAMKGAPERILERCSTILIDGKEMEMDDHWRQEFNNAYLELGGMGERVLGFCDYRLDENNFPRGFDFNPDEVNFPLDGLRFVGLMSMIXXXXXXXXXXXXKCRSAGIKVIMVTGDHPITAKAIAKGVGIISEGNKTVDDIAAERGISPSEVNPRDARACVIHGSDLRDMSSEQLDEVLKHHDEIVFARTSPQQKLIIVEGCQRQGAIVAVTGDGVNDSPALKKADIGVAMGIAGSDVSKQAADMILLDDNFASIVTGVEEGRIIFDNLKKSIAYTLTSNIPEITPFLVFILADVPLPLGTITILCIDLGTDMVPAISLAYEEAESDIMKRKPRDPKHDKLVNERLISMAYGQIGMIQASGGFFVYFVIMAEQGFWPSRLLGLRKEWDSAAVNDLADSYGQEWTFDQRKKLEYTCHTAFFVSIVIVQWTDLMICKTRRNSIFQQGMWNHQMTFGLFFETTLAAFLTYCPGLDVALKMQPLRFTWWLPAIPFSASIFIYDEIRKFLLRKWKNGSWLENETYY 3138
            E+ I  HK+SI+++  +L TD  +GL+  +A   L RDGPNALTPP TTPEWVKFCRQLFGGFS+LLW GA LCFLAYAI +   ++P  DNLYLGIVLTAVVVITGCFSY+QEAKSSKIMESF  MVPQ+A VIR+G+ ++I AE +V GD+I+VK GDR+PADIR++ A   KVDNS+LTGESE Q RS + T+DNPLET+NIAFFSTN VEGT +G+VI TGD T MGRIA LASGL+ G TPIAKEI HFIHIITGVAVFLG+SFF++A ILGY WL+AVIFLIGIIVANVPEGLLATVTVCLTLTAK+MAKKNCLVKNLEAVETLGSTSTICSDKTGTLTQNRMTVAHMWFDN+I E+DT+E+Q  +S  + S TW+ L+R+A LCNRAQFK+G++  P+LKR+  GDASESALLKC+ELS G V   R  NKK+ EIPFNSTNKYQ+S+HET D N   YLL MKGAPERIL+RCSTI++ GKE  MD+  ++ FNNAY+ELGG+GERVLGFC   L E+ +P+GF F+ D+VNF    L FVGLMSMIDPPRAAVPDAV KCRSAGIKVIMVTGDHPITAKAIAKGVGIISEGN+TV+DIAA   I  S+VNPRDA+ACVIHG+DL+D+S EQ+D++L++H EIVFARTSPQQKLIIVEGCQRQGAIVAVTGDGVNDSPALK ADIGVAMGIAGSDVSKQAADMILLDDNFASIVTGVEEGR+IFDNLKKSIAYTLTSNIPEITPFL FI+ ++PLPLGTITILCIDLGTDMVPAISLAYE AESDIMKR+PR+P  DKLVNERLIS+AYGQIGMIQA GGFF YFVI+AE GF PSRL+G+R +WD  A NDL DSYGQ+WT++QRK +E+TCHTAFFVSIV+VQW D++ICKTRRNS+FQQGM N  + FGLF ET LAAFL+YCPG+DVAL+M PL+ TWW  A+P+S  IF+YDE+RK L+R+   G W+E ETYY
Sbjct:   25 EVPITEHKMSIEEICRKLNTDIVQGLTNAKAAEFLIRDGPNALTPPPTTPEWVKFCRQLFGGFSILLWTGAILCFLAYAIQAATEDEPAGDNLYLGIVLTAVVVITGCFSYFQEAKSSKIMESFKNMVPQQALVIREGEKVQINAEEVVAGDLIEVKGGDRIPADIRIVSAHGCKVDNSSLTGESEPQNRSPDCTHDNPLETRNIAFFSTNCVEGTARGIVIYTGDRTAMGRIATLASGLDTGKTPIAKEIEHFIHIITGVAVFLGISFFILAIILGYTWLEAVIFLIGIIVANVPEGLLATVTVCLTLTAKRMAKKNCLVKNLEAVETLGSTSTICSDKTGTLTQNRMTVAHMWFDNQIHEADTTEDQSGASFDKSSLTWQALSRIAALCNRAQFKAGQDPIPILKRDVAGDASESALLKCIELSCGSVRAMRDRNKKVAEIPFNSTNKYQLSVHETEDPNDNRYLLVMKGAPERILDRCSTIMLQGKEQPMDEEMKEAFNNAYMELGGLGERVLGFCHILLPEDQYPKGFAFDTDDVNFQTSNLCFVGLMSMIDPPRAAVPDAVGKCRSAGIKVIMVTGDHPITAKAIAKGVGIISEGNETVEDIAARLNIPVSQVNPRDAKACVIHGTDLKDLSQEQIDDILRNHTEIVFARTSPQQKLIIVEGCQRQGAIVAVTGDGVNDSPALKMADIGVAMGIAGSDVSKQAADMILLDDNFASIVTGVEEGRLIFDNLKKSIAYTLTSNIPEITPFLFFIIVNIPLPLGTITILCIDLGTDMVPAISLAYEAAESDIMKRQPRNPFRDKLVNERLISIAYGQIGMIQALGGFFTYFVILAENGFLPSRLVGIRIDWDDRAQNDLEDSYGQQWTYEQRKIVEFTCHTAFFVSIVVVQWADVIICKTRRNSVFQQGMKNKILVFGLFEETALAAFLSYCPGMDVALRMYPLKPTWWFCAVPYSFLIFVYDEVRKLLIRR-NPGGWVERETYY 1010          
BLAST of non-gastric H ,K -ATPase alpha subunit vs. Ensembl Medaka
Match: atp1a3a (sodium/potassium-transporting ATPase subunit alpha-3 [Source:NCBI gene;Acc:101168472])

HSP 1 Score: 1470.68 bits (3806), Expect = 0.000e+0
Identity = 731/987 (74.06%), Postives = 844/987 (85.51%), Query Frame = 1
Query:  181 ELDIDSHKISIKDLYIRLQTDPEKGLSIEEAKIRLARDGPNALTPPKTTPEWVKFCRQLFGGFSLLLWIGAALCFLAYAILSGAYEDPPKDNLYLGIVLTAVVVITGCFSYYQEAKSSKIMESFGKMVPQKANVIRDGKILEIAAENLVTGDIIDVKFGDRVPADIRVIQASSFKVDNSALTGESEAQVRSSEFTNDNPLETKNIAFFSTNAVEGTCKGVVISTGDNTVMGRIANLASGLEMGMTPIAKEINHFIHIITGVAVFLGVSFFVIAFILGYFWLDAVIFLIGIIVANVPEGXXXXXXXXXXXXXKKMAKKNCLVKNLEAVETLGSTSTICSDKTGTLTQNRMTVAHMWFDNKIQESDTSENQITSSTKQESETWKMLARVAMLCNRAQFKSGEEEKPVLKRECTGDASESALLKCVELSIGGVTKYRGENKKIVEIPFNSTNKYQVSIHETSDGNQG-YLLAMKGAPERILERCSTILIDGKEMEMDDHWRQEFNNAYLELGGMGERVLGFCDYRLDENNFPRGFDFNPDEVNFPLDGLRFVGLMSMIXXXXXXXXXXXXKCRSAGIKVIMVTGDHPITAKAIAKGVGIISEGNKTVDDIAAERGISPSEVNPRDARACVIHGSDLRDMSSEQLDEVLKHHDEIVFARTSPQQKLIIVEGCQRQGAIVAVTGDGVNDSPALKKADIGVAMGIAGSDVSKQAADMILLDDNFASIVTGVEEGRIIFDNLKKSIAYTLTSNIPEITPFLVFILADVPLPLGTITILCIDLGTDMVPAISLAYEEAESDIMKRKPRDPKHDKLVNERLISMAYGQIGMIQASGGFFVYFVIMAEQGFWPSRLLGLRKEWDSAAVNDLADSYGQEWTFDQRKKLEYTCHTAFFVSIVIVQWTDLMICKTRRNSIFQQGMWNHQMTFGLFFETTLAAFLTYCPGLDVALKMQPLRFTWWLPAIPFSASIFIYDEIRKFLLRKWKNGSWLENETYY 3138
            E+ I  HK+S++++  +  TD  +GL+   A   LARDGPNALTPP TTPEWVKFCRQLFGGFS+LLWIGA LCFLAYAI +   ++P  DNLYLGIVL+AVV+ITGCFSY+QEAKSSKIMESF  MVPQ+A VIR+G+ ++I AE +V GD+++VK GDR+PAD+RVI +   KVDNS+LTGESE Q RS + T+DNPLET+NIAFFSTN VEGT +G+V+ TGD TVMGRIA L SGLE G TPIAKEI HFI IITGVAVFLGV+FF+++ +LGY WL+AVIFLIGIIVANVPEGLLATVTVCLTLTAK+MA+KNCLVKNLEAVETLGSTSTICSDKTGTLTQNRMTVAHMWFDN+I E+DT+E+Q  SS  + S TW  LAR+A LCNRA FK+G++  P+LKRE  GDASESALLKC+ELS G +   R +NKK+ EIPFNSTNKYQ+SIHE  D N   YLL MKGAPERIL+RCSTI+I GKE  MDD  R+ F NAYLELGG+GERVLGFC   + E+ +P+GF F+ D+VNF  + L FVGL+SMIDPPRAAVPDAV KCRSAGIKVIMVTGDHPITAKAIAKGVGIISEGN+TV+DIAA   I  S+VNPRDA+ACVIHG+DL+D++ EQ+D++L++H EIVFARTSPQQKLIIVEGCQRQGAIVAVTGDGVNDSPALKKADIGVAMGI+GSDVSKQAADMILLDDNFASIVTGVEEGR+IFDNLKKSIAYTLTSNIPEITPFL FIL ++PLPLGTITILCIDLGTDMVPAISLAYE AESDIMKR+PR+P  DKLVNERLIS+AYGQIGMIQA GGFF YFVIMAE GF PS L+G+R  WD  + NDL DSYGQ+WT++QRK +E+TCHTAFFVSIV+VQW D++ICKTRRNS+FQQGM N  + FGLF ET LAAFL+YCPG+DVAL+M PL+ +WW  A P+S  IF+YDEIRK +LR+   G W+E ETYY
Sbjct:   37 EVPITEHKMSVEEVCRKYNTDIVQGLTNALAAEYLARDGPNALTPPPTTPEWVKFCRQLFGGFSILLWIGAILCFLAYAIQAATEDEPAGDNLYLGIVLSAVVIITGCFSYFQEAKSSKIMESFKNMVPQQALVIREGEKMQINAEQVVAGDLVEVKGGDRIPADLRVISSHGCKVDNSSLTGESEPQTRSPDCTHDNPLETRNIAFFSTNCVEGTARGIVVCTGDRTVMGRIATLTSGLETGKTPIAKEIEHFIQIITGVAVFLGVTFFILSIVLGYSWLEAVIFLIGIIVANVPEGLLATVTVCLTLTAKRMARKNCLVKNLEAVETLGSTSTICSDKTGTLTQNRMTVAHMWFDNQIHEADTTEDQSGSSFDKSSTTWVSLARIAALCNRAVFKAGQDALPILKREVAGDASESALLKCIELSCGPIKVIRDKNKKVAEIPFNSTNKYQLSIHENEDENDNRYLLVMKGAPERILDRCSTIMIQGKEQPMDDEMREAFQNAYLELGGLGERVLGFCHLFMPEDKYPKGFAFDTDDVNFSTENLCFVGLISMIDPPRAAVPDAVGKCRSAGIKVIMVTGDHPITAKAIAKGVGIISEGNETVEDIAARLNIPVSQVNPRDAKACVIHGTDLKDLTQEQMDDILRNHTEIVFARTSPQQKLIIVEGCQRQGAIVAVTGDGVNDSPALKKADIGVAMGISGSDVSKQAADMILLDDNFASIVTGVEEGRLIFDNLKKSIAYTLTSNIPEITPFLFFILVNIPLPLGTITILCIDLGTDMVPAISLAYEAAESDIMKRQPRNPLRDKLVNERLISIAYGQIGMIQALGGFFAYFVIMAENGFLPSLLVGIRLNWDDRSNNDLEDSYGQQWTYEQRKIVEFTCHTAFFVSIVVVQWADVIICKTRRNSVFQQGMKNKILIFGLFEETALAAFLSYCPGMDVALRMYPLKPSWWFCAFPYSFLIFVYDEIRKVILRR-SPGGWVEKETYY 1022          
BLAST of non-gastric H ,K -ATPase alpha subunit vs. Ensembl Medaka
Match: ENSORLT00000016540.2 (sodium/potassium-transporting ATPase subunit alpha-3 [Source:NCBI gene;Acc:101159291])

HSP 1 Score: 1467.98 bits (3799), Expect = 0.000e+0
Identity = 728/963 (75.60%), Postives = 833/963 (86.50%), Query Frame = 1
Query:  253 GLSIEEAKIRLARDGPNALTPPKTTPEWVKFCRQLFGGFSLLLWIGAALCFLAYAILSGAYEDPPKDNLYLGIVLTAVVVITGCFSYYQEAKSSKIMESFGKMVPQKANVIRDGKILEIAAENLVTGDIIDVKFGDRVPADIRVIQASSFKVDNSALTGESEAQVRSSEFTNDNPLETKNIAFFSTNAVEGTCKGVVISTGDNTVMGRIANLASGLEMGMTPIAKEINHFIHIITGVAVFLGVSFFVIAFILGYFWLDAVIFLIGIIVANVPEGXXXXXXXXXXXXXKKMAKKNCLVKNLEAVETLGSTSTICSDKTGTLTQNRMTVAHMWFDNKIQESDTSENQITSSTKQESETWKMLARVAMLCNRAQFKSGEEEKPVLKRECTGDASESALLKCVELSIGGVTKYRGENKKIVEIPFNSTNKYQVSIHETSDGNQG-YLLAMKGAPERILERCSTILIDGKEMEMDDHWRQEFNNAYLELGGMGERVLGFCDYRLDENNFPRGFDFNPDEVNFPLDGLRFVGLMSMIXXXXXXXXXXXXKCRSAGIKVIMVTGDHPITAKAIAKGVGIISEGNKTVDDIAAERGISPSEVNPRDARACVIHGSDLRDMSSEQLDEVLKHHDEIVFARTSPQQKLIIVEGCQRQGAIVAVTGDGVNDSPALKKADIGVAMGIAGSDVSKQAADMILLDDNFASIVTGVEEGRIIFDNLKKSIAYTLTSNIPEITPFLVFILADVPLPLGTITILCIDLGTDMVPAISLAYEEAESDIMKRKPRDPKHDKLVNERLISMAYGQIGMIQASGGFFVYFVIMAEQGFWPSRLLGLRKEWDSAAVNDLADSYGQEWTFDQRKKLEYTCHTAFFVSIVIVQWTDLMICKTRRNSIFQQGMWNHQMTFGLFFETTLAAFLTYCPGLDVALKMQPLRFTWWLPAIPFSASIFIYDEIRKFLLRKWKNGSWLENETYY 3138
            GL+  +A   L RDGPNALTPP TTPEWVKFCRQLFGGFS+LLW GA LCFLAYAI +   ++P  DNLYLGIVLTAVVVITGCFSY+QEAKSSKIMESF  MVPQ+A VIR+G+ ++I AE +V GD+I+VK GDR+PADIR++ A   KVDNS+LTGESE Q RS + T+DNPLET+NIAFFSTN VEGT +G+VI TGD T MGRIA LASGL+ G TPIAKEI HFIHIITGVAVFLG+SFF++A ILGY WL+AVIFLIGIIVANVPEGLLATVTVCLTLTAK+MAKKNCLVKNLEAVETLGSTSTICSDKTGTLTQNRMTVAHMWFDN+I E+DT+E+Q  +S  + S TW+ L+R+A LCNRAQFK+G++  P+LKR+  GDASESALLKC+ELS G V   R  NKK+ EIPFNSTNKYQ+S+HET D N   YLL MKGAPERIL+RCSTI++ GKE  MD+  ++ FNNAY+ELGG+GERVLGFC   L E+ +P+GF F+ D+VNF    L FVGLMSMIDPPRAAVPDAV KCRSAGIKVIMVTGDHPITAKAIAKGVGIISEGN+TV+DIAA   I  S+VNPRDA+ACVIHG+DL+D+S EQ+D++L++H EIVFARTSPQQKLIIVEGCQRQGAIVAVTGDGVNDSPALK ADIGVAMGIAGSDVSKQAADMILLDDNFASIVTGVEEGR+IFDNLKKSIAYTLTSNIPEITPFL FI+ ++PLPLGTITILCIDLGTDMVPAISLAYE AESDIMKR+PR+P  DKLVNERLIS+AYGQIGMIQA GGFF YFVI+AE GF PSRL+G+R +WD  A NDL DSYGQ+WT++QRK +E+TCHTAFFVSIV+VQW D++ICKTRRNS+FQQGM N  + FGLF ET LAAFL+YCPG+DVAL+M PL+ TWW  A+P+S  IF+YDE+RK L+R+   G W+E ETYY
Sbjct:   39 GLTNAKAAEFLIRDGPNALTPPPTTPEWVKFCRQLFGGFSILLWTGAILCFLAYAIQAATEDEPAGDNLYLGIVLTAVVVITGCFSYFQEAKSSKIMESFKNMVPQQALVIREGEKVQINAEEVVAGDLIEVKGGDRIPADIRIVSAHGCKVDNSSLTGESEPQNRSPDCTHDNPLETRNIAFFSTNCVEGTARGIVIYTGDRTAMGRIATLASGLDTGKTPIAKEIEHFIHIITGVAVFLGISFFILAIILGYTWLEAVIFLIGIIVANVPEGLLATVTVCLTLTAKRMAKKNCLVKNLEAVETLGSTSTICSDKTGTLTQNRMTVAHMWFDNQIHEADTTEDQSGASFDKSSLTWQALSRIAALCNRAQFKAGQDPIPILKRDVAGDASESALLKCIELSCGSVRAMRDRNKKVAEIPFNSTNKYQLSVHETEDPNDNRYLLVMKGAPERILDRCSTIMLQGKEQPMDEEMKEAFNNAYMELGGLGERVLGFCHILLPEDQYPKGFAFDTDDVNFQTSNLCFVGLMSMIDPPRAAVPDAVGKCRSAGIKVIMVTGDHPITAKAIAKGVGIISEGNETVEDIAARLNIPVSQVNPRDAKACVIHGTDLKDLSQEQIDDILRNHTEIVFARTSPQQKLIIVEGCQRQGAIVAVTGDGVNDSPALKMADIGVAMGIAGSDVSKQAADMILLDDNFASIVTGVEEGRLIFDNLKKSIAYTLTSNIPEITPFLFFIIVNIPLPLGTITILCIDLGTDMVPAISLAYEAAESDIMKRQPRNPFRDKLVNERLISIAYGQIGMIQALGGFFTYFVILAENGFLPSRLVGIRIDWDDRAQNDLEDSYGQQWTYEQRKIVEFTCHTAFFVSIVVVQWADVIICKTRRNSVFQQGMKNKILVFGLFEETALAAFLSYCPGMDVALRMYPLKPTWWFCAVPYSFLIFVYDEVRKLLIRR-NPGGWVERETYY 1000          
BLAST of non-gastric H ,K -ATPase alpha subunit vs. Ensembl Medaka
Match: atp1a3a (sodium/potassium-transporting ATPase subunit alpha-3 [Source:NCBI gene;Acc:101168472])

HSP 1 Score: 1458.74 bits (3775), Expect = 0.000e+0
Identity = 724/974 (74.33%), Postives = 836/974 (85.83%), Query Frame = 1
Query:  181 ELDIDSHKISIKDLYIRLQTDPEKGLSIEEAKIRLARDGPNALTPPKTTPEWVKFCRQLFGGFSLLLWIGAALCFLAYAILSGAYEDPPKDNLYLGIVLTAVVVITGCFSYYQEAKSSKIMESFGKMVPQKANVIRDGKILEIAAENLVTGDIIDVKFGDRVPADIRVIQASSFKVDNSALTGESEAQVRSSEFTNDNPLETKNIAFFSTNAVEGTCKGVVISTGDNTVMGRIANLASGLEMGMTPIAKEINHFIHIITGVAVFLGVSFFVIAFILGYFWLDAVIFLIGIIVANVPEGXXXXXXXXXXXXXKKMAKKNCLVKNLEAVETLGSTSTICSDKTGTLTQNRMTVAHMWFDNKIQESDTSENQITSSTKQESETWKMLARVAMLCNRAQFKSGEEEKPVLKRECTGDASESALLKCVELSIGGVTKYRGENKKIVEIPFNSTNKYQVSIHETSDGNQG-YLLAMKGAPERILERCSTILIDGKEMEMDDHWRQEFNNAYLELGGMGERVLGFCDYRLDENNFPRGFDFNPDEVNFPLDGLRFVGLMSMIXXXXXXXXXXXXKCRSAGIKVIMVTGDHPITAKAIAKGVGIISEGNKTVDDIAAERGISPSEVNPRDARACVIHGSDLRDMSSEQLDEVLKHHDEIVFARTSPQQKLIIVEGCQRQGAIVAVTGDGVNDSPALKKADIGVAMGIAGSDVSKQAADMILLDDNFASIVTGVEEGRIIFDNLKKSIAYTLTSNIPEITPFLVFILADVPLPLGTITILCIDLGTDMVPAISLAYEEAESDIMKRKPRDPKHDKLVNERLISMAYGQIGMIQASGGFFVYFVIMAEQGFWPSRLLGLRKEWDSAAVNDLADSYGQEWTFDQRKKLEYTCHTAFFVSIVIVQWTDLMICKTRRNSIFQQGMWNHQMTFGLFFETTLAAFLTYCPGLDVALKMQPLRFTWWLPAIPFSASIFIYDEIRKFLLRK 3099
            E+ I  HK+S++++  +  TD  +GL+   A   LARDGPNALTPP TTPEWVKFCRQLFGGFS+LLWIGA LCFLAYAI +   ++P  DNLYLGIVL+AVV+ITGCFSY+QEAKSSKIMESF  MVPQ+A VIR+G+ ++I AE +V GD+++VK GDR+PAD+RVI +   KVDNS+LTGESE Q RS + T+DNPLET+NIAFFSTN VEGT +G+V+ TGD TVMGRIA L SGLE G TPIAKEI HFI IITGVAVFLGV+FF+++ +LGY WL+AVIFLIGIIVANVPEGLLATVTVCLTLTAK+MA+KNCLVKNLEAVETLGSTSTICSDKTGTLTQNRMTVAHMWFDN+I E+DT+E+Q  SS  + S TW  LAR+A LCNRA FK+G++  P+LKRE  GDASESALLKC+ELS G +   R +NKK+ EIPFNSTNKYQ+SIHE  D N   YLL MKGAPERIL+RCSTI+I GKE  MDD  R+ F NAYLELGG+GERVLGFC   + E+ +P+GF F+ D+VNF  + L FVGL+SMIDPPRAAVPDAV KCRSAGIKVIMVTGDHPITAKAIAKGVGIISEGN+TV+DIAA   I  S+VNPRDA+ACVIHG+DL+D++ EQ+D++L++H EIVFARTSPQQKLIIVEGCQRQGAIVAVTGDGVNDSPALKKADIGVAMGI+GSDVSKQAADMILLDDNFASIVTGVEEGR+IFDNLKKSIAYTLTSNIPEITPFL FIL ++PLPLGTITILCIDLGTDMVPAISLAYE AESDIMKR+PR+P  DKLVNERLIS+AYGQIGMIQA GGFF YFVIMAE GF PS L+G+R  WD  + NDL DSYGQ+WT++QRK +E+TCHTAFFVSIV+VQW D++ICKTRRNS+FQQGM N  + FGLF ET LAAFL+YCPG+DVAL+M PL+ +WW  A P+S  IF+YDEIRK +LR+
Sbjct:   37 EVPITEHKMSVEEVCRKYNTDIVQGLTNALAAEYLARDGPNALTPPPTTPEWVKFCRQLFGGFSILLWIGAILCFLAYAIQAATEDEPAGDNLYLGIVLSAVVIITGCFSYFQEAKSSKIMESFKNMVPQQALVIREGEKMQINAEQVVAGDLVEVKGGDRIPADLRVISSHGCKVDNSSLTGESEPQTRSPDCTHDNPLETRNIAFFSTNCVEGTARGIVVCTGDRTVMGRIATLTSGLETGKTPIAKEIEHFIQIITGVAVFLGVTFFILSIVLGYSWLEAVIFLIGIIVANVPEGLLATVTVCLTLTAKRMARKNCLVKNLEAVETLGSTSTICSDKTGTLTQNRMTVAHMWFDNQIHEADTTEDQSGSSFDKSSTTWVSLARIAALCNRAVFKAGQDALPILKREVAGDASESALLKCIELSCGPIKVIRDKNKKVAEIPFNSTNKYQLSIHENEDENDNRYLLVMKGAPERILDRCSTIMIQGKEQPMDDEMREAFQNAYLELGGLGERVLGFCHLFMPEDKYPKGFAFDTDDVNFSTENLCFVGLISMIDPPRAAVPDAVGKCRSAGIKVIMVTGDHPITAKAIAKGVGIISEGNETVEDIAARLNIPVSQVNPRDAKACVIHGTDLKDLTQEQMDDILRNHTEIVFARTSPQQKLIIVEGCQRQGAIVAVTGDGVNDSPALKKADIGVAMGISGSDVSKQAADMILLDDNFASIVTGVEEGRLIFDNLKKSIAYTLTSNIPEITPFLFFILVNIPLPLGTITILCIDLGTDMVPAISLAYEAAESDIMKRQPRNPLRDKLVNERLISIAYGQIGMIQALGGFFAYFVIMAENGFLPSLLVGIRLNWDDRSNNDLEDSYGQQWTYEQRKIVEFTCHTAFFVSIVVVQWADVIICKTRRNSVFQQGMKNKILIFGLFEETALAAFLSYCPGMDVALRMYPLKPSWWFCAFPYSFLIFVYDEIRKVILRR 1010          
BLAST of non-gastric H ,K -ATPase alpha subunit vs. Ensembl Medaka
Match: atp1a2a (sodium/potassium-transporting ATPase subunit alpha-2 [Source:NCBI gene;Acc:101161996])

HSP 1 Score: 1446.03 bits (3742), Expect = 0.000e+0
Identity = 716/986 (72.62%), Postives = 831/986 (84.28%), Query Frame = 1
Query:  181 ELDIDSHKISIKDLYIRLQTDPEKGLSIEEAKIRLARDGPNALTPPKTTPEWVKFCRQLFGGFSLLLWIGAALCFLAYAILSGAYEDPPKDNLYLGIVLTAVVVITGCFSYYQEAKSSKIMESFGKMVPQKANVIRDGKILEIAAENLVTGDIIDVKFGDRVPADIRVIQASSFKVDNSALTGESEAQVRSSEFTNDNPLETKNIAFFSTNAVEGTCKGVVISTGDNTVMGRIANLASGLEMGMTPIAKEINHFIHIITGVAVFLGVSFFVIAFILGYFWLDAVIFLIGIIVANVPEGXXXXXXXXXXXXXKKMAKKNCLVKNLEAVETLGSTSTICSDKTGTLTQNRMTVAHMWFDNKIQESDTSENQITSSTKQESETWKMLARVAMLCNRAQFKSGEEEKPVLKRECTGDASESALLKCVELSIGGVTKYRGENKKIVEIPFNSTNKYQVSIHETSDGNQGYLLAMKGAPERILERCSTILIDGKEMEMDDHWRQEFNNAYLELGGMGERVLGFCDYRLDENNFPRGFDFNPDEVNFPLDGLRFVGLMSMIXXXXXXXXXXXXKCRSAGIKVIMVTGDHPITAKAIAKGVGIISEGNKTVDDIAAERGISPSEVNPRDARACVIHGSDLRDMSSEQLDEVLKHHDEIVFARTSPQQKLIIVEGCQRQGAIVAVTGDGVNDSPALKKADIGVAMGIAGSDVSKQAADMILLDDNFASIVTGVEEGRIIFDNLKKSIAYTLTSNIPEITPFLVFILADVPLPLGTITILCIDLGTDMVPAISLAYEEAESDIMKRKPRDPKHDKLVNERLISMAYGQIGMIQASGGFFVYFVIMAEQGFWPSRLLGLRKEWDSAAVNDLADSYGQEWTFDQRKKLEYTCHTAFFVSIVIVQWTDLMICKTRRNSIFQQGMWNHQMTFGLFFETTLAAFLTYCPGLDVALKMQPLRFTWWLPAIPFSASIFIYDEIRKFLLRKWKNGSWLENETYY 3138
            E+ +D H++S+++L  R   D  +GL+   A   LA+DG NALTPP TTPEWVKFCRQLFGGFS+LLWIGA LCFLAY+I     +DP  DNLYLG+VL AVV+ITGCFSY+QEAKSS+IM+SF KMVPQ+A VIRDG+ L+I AE +V GD+++VK GDR+PAD+RVI ++  KVDNS+LTGESE Q RS EF +DNPLET+NI F+STN VEGT +G+VI+TGD TVMGRIA LAS LE+  TPI  EI HFI +ITGVAVFLG+SFF+++ ILGY WL+AVIFLIGIIVANVPEGLLATVTVCLTLTAK+MAKKNCLVKNLEAVETLGSTSTICSDKTGTLTQNRMTVAHMWFDN+I E+DT+E+Q      + S TW  L+RVA LCNRA FK+G+E  P++ R+  GDASESALLKC+E+  G V   R  N K+ EIPFNSTNKYQ+SIHE  D   G++L MKGAPERIL+RCSTI+I G+E  +D++WR+ F NAY+ELGG+GERVLGFC   L  + FPRGF+F+ ++ NFP + L F+GL+SMIDPPRAAVPDAV KCRSAGIKVIMVTGDHPITAKAIAKGVGIISEGN+TV+DIA    I  S+VNPRDA+ACV+HG DL+DMS E LD++L++H EIVFARTSPQQKLIIVEGCQRQGAIVAVTGDGVNDSPALKKADIGVAMGI GSDVSKQAADMILLDDNFASIVTGVEEGR+IFDNLKKSIAYTLTSNIPEI+PFL FILA VPLPLGT+TILCIDLGTDMVPAISLAYE AESDIMKR+PR+PK DKLVNERLISMAYGQIGM+QA  GFF YFVI+AE GF PS L+G+R  WD    NDL DSYGQ+WT++QRK +E+TCHTAFF SIVIVQW DL+ICKTRRNS+FQQGM N  + FGLF ET LAAFL+YCPG+DVAL+M PL+  WW   IP+S  IF+YDE+RKF+LR+   G W+E ETYY
Sbjct:   26 EVSLDDHRLSLEELGKRYGVDLARGLTSARAAEMLAKDGLNALTPPPTTPEWVKFCRQLFGGFSILLWIGAILCFLAYSIQVATEDDPLNDNLYLGVVLAAVVIITGCFSYFQEAKSSRIMDSFKKMVPQQAMVIRDGEKLQINAEVVVLGDLVEVKGGDRIPADLRVISSNGCKVDNSSLTGESEPQTRSPEFNHDNPLETRNICFYSTNCVEGTARGIVIATGDRTVMGRIATLASELEVRRTPINIEIEHFIRLITGVAVFLGLSFFILSLILGYTWLEAVIFLIGIIVANVPEGLLATVTVCLTLTAKRMAKKNCLVKNLEAVETLGSTSTICSDKTGTLTQNRMTVAHMWFDNQIHEADTTEDQRGCGFDKSSGTWPALSRVAGLCNRADFKAGQEHLPMMMRDTVGDASESALLKCIEVCCGSVHDMRASNPKVAEIPFNSTNKYQLSIHEVEDNPSGHILVMKGAPERILDRCSTIMIHGQEEPLDENWREAFQNAYMELGGLGERVLGFCHLNLSSSQFPRGFEFDCNDTNFPTEQLCFLGLISMIDPPRAAVPDAVGKCRSAGIKVIMVTGDHPITAKAIAKGVGIISEGNETVEDIAERLIIPLSQVNPRDAKACVVHGYDLKDMSPEYLDDLLRNHTEIVFARTSPQQKLIIVEGCQRQGAIVAVTGDGVNDSPALKKADIGVAMGITGSDVSKQAADMILLDDNFASIVTGVEEGRLIFDNLKKSIAYTLTSNIPEISPFLFFILASVPLPLGTVTILCIDLGTDMVPAISLAYETAESDIMKRQPRNPKTDKLVNERLISMAYGQIGMMQAVAGFFTYFVILAENGFLPSHLVGIRIPWDDRETNDLEDSYGQQWTYEQRKIVEFTCHTAFFTSIVIVQWADLIICKTRRNSLFQQGMKNRVLIFGLFVETALAAFLSYCPGMDVALRMYPLKLMWWFCGIPYSILIFVYDEVRKFILRR-SPGGWVELETYY 1010          
BLAST of non-gastric H ,K -ATPase alpha subunit vs. Planmine SMEST
Match: SMESG000041937.1 (SMESG000041937.1)

HSP 1 Score: 1988.77 bits (5151), Expect = 0.000e+0
Identity = 1022/1022 (100.00%), Postives = 1022/1022 (100.00%), Query Frame = 1
Query:   73 MASDEKVNDXXXXXXXXXXXXXXXXXXXXXXXXXXXELDIDSHKISIKDLYIRLQTDPEKGLSIEEAKIRLARDGPNALTPPKTTPEWVKFCRQLFGGFSLLLWIGAALCFLAYAILSGAYEDPPKDNLYLGIVLTAVVVITGCFSYYQEAKSSKIMESFGKMVPQKANVIRDGKILEIAAENLVTGDIIDVKFGDRVPADIRVIQASSFKVDNSALTGESEAQVRSSEFTNDNPLETKNIAFFSTNAVEGTCKGVVISTGDNTVMGRIANLASGLEMGMTPIAKEINHFIHIITGVAVFLGVSFFVIAFILGYFWLDAVIFLIGIIVANVPEGXXXXXXXXXXXXXKKMAKKNCLVKNLEAVETLGSTSTICSDKTGTLTQNRMTVAHMWFDNKIQESDTSENQITSSTKQESETWKMLARVAMLCNRAQFKSGEEEKPVLKRECTGDASESALLKCVELSIGGVTKYRGENKKIVEIPFNSTNKYQVSIHETSDGNQGYLLAMKGAPERILERCSTILIDGKEMEMDDHWRQEFNNAYLELGGMGERVLGFCDYRLDENNFPRGFDFNPDEVNFPLDGLRFVGLMSMIXXXXXXXXXXXXKCRSAGIKVIMVTGDHPITAKAIAKGVGIISEGNKTVDDIAAERGISPSEVNPRDARACVIHGSDLRDMSSEQLDEVLKHHDEIVFARTSPQQKLIIVEGCQRQGAIVAVTGDGVNDSPALKKADIGVAMGIAGSDVSKQAADMILLDDNFASIVTGVEEGRIIFDNLKKSIAYTLTSNIPEITPFLVFILADVPLPLGTITILCIDLGTDMVPAISLAYEEAESDIMKRKPRDPKHDKLVNERLISMAYGQIGMIQASGGFFVYFVIMAEQGFWPSRLLGLRKEWDSAAVNDLADSYGQEWTFDQRKKLEYTCHTAFFVSIVIVQWTDLMICKTRRNSIFQQGMWNHQMTFGLFFETTLAAFLTYCPGLDVALKMQPLRFTWWLPAIPFSASIFIYDEIRKFLLRKWKNGSWLENETYY 3138
            MASDEKVNDKGDKKNLKSSPKKSKKDKKKDLDNLKKELDIDSHKISIKDLYIRLQTDPEKGLSIEEAKIRLARDGPNALTPPKTTPEWVKFCRQLFGGFSLLLWIGAALCFLAYAILSGAYEDPPKDNLYLGIVLTAVVVITGCFSYYQEAKSSKIMESFGKMVPQKANVIRDGKILEIAAENLVTGDIIDVKFGDRVPADIRVIQASSFKVDNSALTGESEAQVRSSEFTNDNPLETKNIAFFSTNAVEGTCKGVVISTGDNTVMGRIANLASGLEMGMTPIAKEINHFIHIITGVAVFLGVSFFVIAFILGYFWLDAVIFLIGIIVANVPEGLLATVTVCLTLTAKKMAKKNCLVKNLEAVETLGSTSTICSDKTGTLTQNRMTVAHMWFDNKIQESDTSENQITSSTKQESETWKMLARVAMLCNRAQFKSGEEEKPVLKRECTGDASESALLKCVELSIGGVTKYRGENKKIVEIPFNSTNKYQVSIHETSDGNQGYLLAMKGAPERILERCSTILIDGKEMEMDDHWRQEFNNAYLELGGMGERVLGFCDYRLDENNFPRGFDFNPDEVNFPLDGLRFVGLMSMIDPPRAAVPDAVAKCRSAGIKVIMVTGDHPITAKAIAKGVGIISEGNKTVDDIAAERGISPSEVNPRDARACVIHGSDLRDMSSEQLDEVLKHHDEIVFARTSPQQKLIIVEGCQRQGAIVAVTGDGVNDSPALKKADIGVAMGIAGSDVSKQAADMILLDDNFASIVTGVEEGRIIFDNLKKSIAYTLTSNIPEITPFLVFILADVPLPLGTITILCIDLGTDMVPAISLAYEEAESDIMKRKPRDPKHDKLVNERLISMAYGQIGMIQASGGFFVYFVIMAEQGFWPSRLLGLRKEWDSAAVNDLADSYGQEWTFDQRKKLEYTCHTAFFVSIVIVQWTDLMICKTRRNSIFQQGMWNHQMTFGLFFETTLAAFLTYCPGLDVALKMQPLRFTWWLPAIPFSASIFIYDEIRKFLLRKWKNGSWLENETYY
Sbjct:    1 MASDEKVNDKGDKKNLKSSPKKSKKDKKKDLDNLKKELDIDSHKISIKDLYIRLQTDPEKGLSIEEAKIRLARDGPNALTPPKTTPEWVKFCRQLFGGFSLLLWIGAALCFLAYAILSGAYEDPPKDNLYLGIVLTAVVVITGCFSYYQEAKSSKIMESFGKMVPQKANVIRDGKILEIAAENLVTGDIIDVKFGDRVPADIRVIQASSFKVDNSALTGESEAQVRSSEFTNDNPLETKNIAFFSTNAVEGTCKGVVISTGDNTVMGRIANLASGLEMGMTPIAKEINHFIHIITGVAVFLGVSFFVIAFILGYFWLDAVIFLIGIIVANVPEGLLATVTVCLTLTAKKMAKKNCLVKNLEAVETLGSTSTICSDKTGTLTQNRMTVAHMWFDNKIQESDTSENQITSSTKQESETWKMLARVAMLCNRAQFKSGEEEKPVLKRECTGDASESALLKCVELSIGGVTKYRGENKKIVEIPFNSTNKYQVSIHETSDGNQGYLLAMKGAPERILERCSTILIDGKEMEMDDHWRQEFNNAYLELGGMGERVLGFCDYRLDENNFPRGFDFNPDEVNFPLDGLRFVGLMSMIDPPRAAVPDAVAKCRSAGIKVIMVTGDHPITAKAIAKGVGIISEGNKTVDDIAAERGISPSEVNPRDARACVIHGSDLRDMSSEQLDEVLKHHDEIVFARTSPQQKLIIVEGCQRQGAIVAVTGDGVNDSPALKKADIGVAMGIAGSDVSKQAADMILLDDNFASIVTGVEEGRIIFDNLKKSIAYTLTSNIPEITPFLVFILADVPLPLGTITILCIDLGTDMVPAISLAYEEAESDIMKRKPRDPKHDKLVNERLISMAYGQIGMIQASGGFFVYFVIMAEQGFWPSRLLGLRKEWDSAAVNDLADSYGQEWTFDQRKKLEYTCHTAFFVSIVIVQWTDLMICKTRRNSIFQQGMWNHQMTFGLFFETTLAAFLTYCPGLDVALKMQPLRFTWWLPAIPFSASIFIYDEIRKFLLRKWKNGSWLENETYY 1022          
BLAST of non-gastric H ,K -ATPase alpha subunit vs. Planmine SMEST
Match: SMESG000032753.1 (SMESG000032753.1)

HSP 1 Score: 1436.01 bits (3716), Expect = 0.000e+0
Identity = 698/983 (71.01%), Postives = 829/983 (84.33%), Query Frame = 1
Query:  181 ELDIDSHKISIKDLYIRLQTDPEKGLSIEEAKIRLARDGPNALTPPKTTPEWVKFCRQLFGGFSLLLWIGAALCFLAYAILSGAYEDPPKDNLYLGIVLTAVVVITGCFSYYQEAKSSKIMESFGKMVPQKANVIRDGKILEIAAENLVTGDIIDVKFGDRVPADIRVIQASSFKVDNSALTGESEAQVRSSEFTNDNPLETKNIAFFSTNAVEGTCKGVVISTGDNTVMGRIANLASGLEMGMTPIAKEINHFIHIITGVAVFLGVSFFVIAFILGYFWLDAVIFLIGIIVANVPEGXXXXXXXXXXXXXKKMAKKNCLVKNLEAVETLGSTSTICSDKTGTLTQNRMTVAHMWFDNKIQESDTSENQITSSTKQESETWKMLARVAMLCNRAQFKSGEEEKPVLKRECTGDASESALLKCVELSIGGVTKYRGENKKIVEIPFNSTNKYQVSIHETSDGNQGYLLAMKGAPERILERCSTILIDGKEMEMDDHWRQEFNNAYLELGGMGERVLGFCDYRLDENNFPRGFDFNPDEVNFPLDGLRFVGLMSMIXXXXXXXXXXXXKCRSAGIKVIMVTGDHPITAKAIAKGVGIISEGNKTVDDIAAERGISPSEVNPRDARACVIHGSDLRDMSSEQLDEVLKHHDEIVFARTSPQQKLIIVEGCQRQGAIVAVTGDGVNDSPALKKADIGVAMGIAGSDVSKQAADMILLDDNFASIVTGVEEGRIIFDNLKKSIAYTLTSNIPEITPFLVFILADVPLPLGTITILCIDLGTDMVPAISLAYEEAESDIMKRKPRDPKHDKLVNERLISMAYGQIGMIQASGGFFVYFVIMAEQGFWPSRLLGLRKEWDSAAVNDLADSYGQEWTFDQRKKLEYTCHTAFFVSIVIVQWTDLMICKTRRNSIFQQGMWNHQMTFGLFFETTLAAFLTYCPGLDVALKMQPLRFTWWLPAIPFSASIFIYDEIRKFLLRKWKNGSWLENE 3129
            +++ DSH I+I++LY R QTDP+KGL+ EEA  RL RDG N+LTP + TPE VKF + L GGFS+LLW+GA LCF+AY I  G  +D P DNLYLGIVL  VVV TGCF YYQ+AKSSKIM SFGKMVPQKA+V R G ++++A E LV GDI++VKFGDR+PAD+R+I++S FKVDN+ALTGESE Q R+ E T++N LET NIAFFSTNAVEGTC+ VV+ TGDNTVMGRIANL S L  G TPI KEI HFIHII+G+ V LG+ FF+IAF+LG FWLDAV+FLIG+IVANVPEG+LATVTV LTLTAKKMA+KNCLVKNLEAVETLGSTS ICSDKTGTLTQN MTVAH W++NKI +S TSENQI  + KQ  E+W +L RVA+LCNRA FK+GEE+K V KREC+GDASESALLK  EL+ G  T+YR EN K++E+PFNSTNKYQVSIHET+DG+  YLL MKGAPERILER  TILIDGKE+E+D+HW+ EFNNAY+E+GGMGERVLGFCDYRLDE  FP+GF F+ DEVNFPL G RFVGL+SMIDPPR +VPDAVAKCRSAGIKVIMVTGDHPITAKAIAK VGI S  NKT++DIA  RG+  SEVNPR+A+ACVIHGSDL++M+S QLDE+L++H EIVFARTSPQQKL IVEGCQRQGAIVAVTGDGVNDSPALKKADIG+AMGI+GSDVSKQAADMILLDDNFASIV G+E+GR IFDNLKKSI Y L   IPEI PFL + +  +PL LGTITILCIDLGTDM+PAI+LAYE AES+IM+RKPR+P  D LV  RLIS+ +GQ+G+IQA G FF +FVIMAE GF P RL+G+R+ W++  +NDL DSYGQEWT+ QRK+LEYTC++A+FVS+++ QW ++++ KTRRNS+FQQGMWNHQ+TF +FFET LA F+ Y PGL+  LK+  LRFTWWL A+PFS  +  +DE+RKF++R+ K+ +W   E
Sbjct:   33 DVESDSHIITIEELYARFQTDPDKGLTSEEAAFRLERDGLNSLTPAEGTPEIVKFIKTLLGGFSILLWVGAILCFIAYGIQVGTTQDAPMDNLYLGIVLVFVVVFTGCFCYYQDAKSSKIMHSFGKMVPQKASVCRSGILIDVATETLVVGDIVEVKFGDRIPADVRIIKSSGFKVDNAALTGESEPQSRTPECTSNNILETSNIAFFSTNAVEGTCRCVVVDTGDNTVMGRIANLTSSLTTGKTPIGKEIEHFIHIISGIGVSLGIIFFIIAFLLGSFWLDAVLFLIGVIVANVPEGMLATVTVMLTLTAKKMARKNCLVKNLEAVETLGSTSIICSDKTGTLTQNVMTVAHTWYNNKIYDSPTSENQIGLTNKQVDESWDLLMRVAILCNRAAFKAGEEDKVVWKRECSGDASESALLKYGELAKGKTTEYREENPKVIEVPFNSTNKYQVSIHETNDGDPRYLLVMKGAPERILERSQTILIDGKEIEIDEHWKDEFNNAYMEMGGMGERVLGFCDYRLDEKLFPKGFPFDADEVNFPLTGFRFVGLISMIDPPRPSVPDAVAKCRSAGIKVIMVTGDHPITAKAIAKAVGIFSPDNKTIEDIALSRGVPISEVNPREAKACVIHGSDLKEMTSVQLDEILEYHLEIVFARTSPQQKLQIVEGCQRQGAIVAVTGDGVNDSPALKKADIGIAMGISGSDVSKQAADMILLDDNFASIVVGIEQGRKIFDNLKKSIIYILVKTIPEIVPFLAYTVISIPLALGTITILCIDLGTDMMPAIALAYEGAESNIMRRKPRNPLKDNLVTSRLISLTHGQLGIIQAFGSFFAFFVIMAENGFLPDRLVGIRESWENPVINDLKDSYGQEWTYKQRKQLEYTCYSAYFVSVMVQQWCNILVVKTRRNSLFQQGMWNHQLTFSMFFETGLAIFIVYTPGLNTVLKLVNLRFTWWLIALPFSFYLLAFDEMRKFIIRRDKDRNWWTRE 1015          
BLAST of non-gastric H ,K -ATPase alpha subunit vs. Planmine SMEST
Match: SMESG000008146.1 (SMESG000008146.1)

HSP 1 Score: 1407.51 bits (3642), Expect = 0.000e+0
Identity = 676/983 (68.77%), Postives = 821/983 (83.52%), Query Frame = 1
Query:  181 ELDIDSHKISIKDLYIRLQTDPEKGLSIEEAKIRLARDGPNALTPPKTTPEWVKFCRQLFGGFSLLLWIGAALCFLAYAILSGAYEDPPKDNLYLGIVLTAVVVITGCFSYYQEAKSSKIMESFGKMVPQKANVIRDGKILEIAAENLVTGDIIDVKFGDRVPADIRVIQASSFKVDNSALTGESEAQVRSSEFTNDNPLETKNIAFFSTNAVEGTCKGVVISTGDNTVMGRIANLASGLEMGMTPIAKEINHFIHIITGVAVFLGVSFFVIAFILGYFWLDAVIFLIGIIVANVPEGXXXXXXXXXXXXXKKMAKKNCLVKNLEAVETLGSTSTICSDKTGTLTQNRMTVAHMWFDNKIQESDTSENQITSSTKQESETWKMLARVAMLCNRAQFKSGEEEKPVLKRECTGDASESALLKCVELSIGGVTKYRGENKKIVEIPFNSTNKYQVSIHETSDGNQGYLLAMKGAPERILERCSTILIDGKEMEMDDHWRQEFNNAYLELGGMGERVLGFCDYRLDENNFPRGFDFNPDEVNFPLDGLRFVGLMSMIXXXXXXXXXXXXKCRSAGIKVIMVTGDHPITAKAIAKGVGIISEGNKTVDDIAAERGISPSEVNPRDARACVIHGSDLRDMSSEQLDEVLKHHDEIVFARTSPQQKLIIVEGCQRQGAIVAVTGDGVNDSPALKKADIGVAMGIAGSDVSKQAADMILLDDNFASIVTGVEEGRIIFDNLKKSIAYTLTSNIPEITPFLVFILADVPLPLGTITILCIDLGTDMVPAISLAYEEAESDIMKRKPRDPKHDKLVNERLISMAYGQIGMIQASGGFFVYFVIMAEQGFWPSRLLGLRKEWDSAAVNDLADSYGQEWTFDQRKKLEYTCHTAFFVSIVIVQWTDLMICKTRRNSIFQQGMWNHQMTFGLFFETTLAAFLTYCPGLDVALKMQPLRFTWWLPAIPFSASIFIYDEIRKFLLRKWKNGSWLENE 3129
            +LD DSHKI I++LY RL++DP  GL+  EA++RL  DGPNAL PPK  PE VKF ++L GGFSLLL  GA LC++AY I      +  +DNLYLG VL  +V+ TGCF YYQEAKSS I++SFGKMVPQK+NVIR+ +I E+   NLV GD+++VKFGDR+PADIR+I+ASSFKVDNSALTGESE Q R+ E TN+N LET NIAFFSTNAVEGTC+G++IS GDNT+MGRIA+L SGL+ G TPI +EINHF++IIT + + LGV FF+IA  LGY+WLD ++FLIGIIVA +P GLLATVTV LTLTAK+MA+KNCLVKNLEAVETLGSTS ICSDKTGTLTQN MTVAH W+ N+I E   SE++I     ++   W++L R+A+LCNRAQFK+ +E+K V KREC+GDASESALLKC E S+G  +KYR  NKKIVEIPFNS NKYQVSIHET+D +  YLL MKGAPERILE+C+TILI   E E+DDHW+ EFNNAY+ELGGMGERVLGFCDYRLD   FP+GF F+ DEVNFPL GLRF GL+SMIDPPR +VPDAV KCRSAGIKVIMVTGDHPITAKAI++ VGII +G+KT++D+A E+ I  SEVNPRDA ACV+HGSDL++M+SEQLDE+LK+H+EIVFARTSPQQKL IV+GCQRQG+IVAVTGDGVNDSPALKKADIG+AMGI+GSDVSKQAADMILLDDNFASIVTG+E+GR+IFDNLKK++ Y     IPE+ PFL++I   +PLPLG +TILCID+GTDM+P+ISLAYE +ES+IMKRKPRDP   KLV ERLIS+ + Q+G+I+A+G  FVYF+IMAEQGF P RL+GLR +W++  +NDL DSY QEWT+ QRKKLEYTC+T+FF++I++ QW +L++ KTRRNSIFQ GMWN+ +TF +FFET LA FL YCPG+D+ LKMQPLRFTWWL A+PF   +FI+DE +K+++ K K  +W+  E
Sbjct:   36 DLDTDSHKIPIEELYERLKSDPITGLTQNEARLRLETDGPNALKPPKELPEIVKFLKELTGGFSLLLIAGAILCWIAYLIQYIPDNNVARDNLYLGFVLLVIVLFTGCFCYYQEAKSSAIIKSFGKMVPQKSNVIRESEISEVDTTNLVVGDVVEVKFGDRIPADIRIIKASSFKVDNSALTGESEPQNRTPECTNENILETSNIAFFSTNAVEGTCRGIIISVGDNTMMGRIAHLTSGLKQGRTPIGREINHFVNIITVIGITLGVVFFIIALSLGYYWLDGILFLIGIIVAVIPVGLLATVTVMLTLTAKRMARKNCLVKNLEAVETLGSTSVICSDKTGTLTQNVMTVAHTWYSNRIHEYPLSESEIDEDQAEDRAAWQVLLRIAILCNRAQFKADQEDKVVWKRECSGDASESALLKCGEHSMGNSSKYRENNKKIVEIPFNSLNKYQVSIHETADDDPRYLLVMKGAPERILEKCATILIGETEYEIDDHWKDEFNNAYMELGGMGERVLGFCDYRLDATEFPKGFQFDTDEVNFPLKGLRFAGLISMIDPPRPSVPDAVEKCRSAGIKVIMVTGDHPITAKAISRAVGIIRKGSKTIEDLAHEKNIPISEVNPRDANACVVHGSDLKEMTSEQLDEILKYHNEIVFARTSPQQKLQIVDGCQRQGSIVAVTGDGVNDSPALKKADIGIAMGISGSDVSKQAADMILLDDNFASIVTGIEQGRMIFDNLKKAVMYNFIKTIPELVPFLLYIAVSIPLPLGAMTILCIDIGTDMLPSISLAYEFSESNIMKRKPRDPVKGKLVTERLISLTHAQMGIIEATGAMFVYFIIMAEQGFLPDRLIGLRIQWETQTINDLKDSYNQEWTYAQRKKLEYTCYTSFFIAIMVQQWWNLLVVKTRRNSIFQSGMWNNHLTFAMFFETCLALFLVYCPGMDLILKMQPLRFTWWLIAMPFGVYLFIFDEFKKYIVSKSKKNTWIVRE 1018          
BLAST of non-gastric H ,K -ATPase alpha subunit vs. Planmine SMEST
Match: SMESG000078146.1 (SMESG000078146.1)

HSP 1 Score: 1331.62 bits (3445), Expect = 0.000e+0
Identity = 667/989 (67.44%), Postives = 812/989 (82.10%), Query Frame = 1
Query:  181 ELDIDSHKISIKDLYIRLQTDPEKGLSIEEAKIRLARDGPNALTPPKTTPEWVKFCRQLFGGFSLLLWIGAALCFLAYAILSG--AYEDPPKDNLYLGIVLTAVVVITGCFSYYQEAKSSKIMESFGKMVPQKANVIRDGKILEIAAENLVTGDIIDVKFGDRVPADIRVIQASSFKVDNSALTGESEAQVRSSEFTNDNPLETKNIAFFSTNAVEGTCKGVVISTGDNTVMGRIANLASGLEMGMTPIAKEINHFIHIITGVAVFLGVSFFVIAFILGYFWLDAVIFLIGIIVANVPEGXXXXXXXXXXXXXKKMAKKNCLVKNLEAVETLGSTSTICSDKTGTLTQNRMTVAHMWFDNKIQESDTSENQITSSTKQESETWKMLARVAMLCNRAQF-KSGEEEKPVLKRECTGDASESALLKCVELSIGGVTKYRGENKKIVEIPFNSTNKYQVSIHETSDGNQGYLLAMKGAPERILERCSTILIDGKEMEMDDHWRQEFNNAYLELGGMGERVLGFCDYRLDENNFPRGFDFNPDEVNFPLDGLRFVGLMSMIXXXXXXXXXXXXKCRSAGIKVIMVTGDHPITAKAIAKGVGIISEGNKTVDDIAAERGISPSEVNPRDARACVIHGSDLRDMSSEQLDEVLKHHDEIVFARTSPQQKLIIVEGCQRQGAIVAVTGDGVNDSPALKKADIGVAMGIAGSDVSKQAADMILLDDNFASIVTGVEEGRIIFDNLKKSIAYTLTSNIPEITPFLVFILADVPLPLGTITILCIDLGTDMVPAISLAYEEAESDIMKRKPRDPKHDKLVNERLISMAYGQIGMIQASGGFFVYFVIMAEQGFWPSRLLGLRKEWDSAAVNDLADSYGQEWTFDQRKKLEYTCHTAFFVSIVIVQWTDLMICKTRRNSIFQQGMWNHQMTFGLFFETTLAAFLTYCPGLDVALKMQPLRFTWWLPAIPFSASIFIYDEIRKFLLRKWKNGSWLENETYY 3138
            ELD++ H+I I DLY +L TDP+ G++ EEA IRL   G N LTP  +TP  + +C+ LFGGF+LLLWIG+ LCF+A+ I +G  AY   P  NL++GIVL  +VV++  FS+YQE KS+KIMESF ++VP KA VIR+G+  EI AENLV GD+I VK GDR+PADIR+I A+SFKVDNS+LTGESEAQVRS+E+TN+N LETKN+AFFSTNAVEG C+GVVI+TGD+TVMGRIANLASGLE+GMTPIAKEIN FI+IIT ++V L V F + AF+LGY+W+DA+IFLI II+A+VPEGLLATVTVCLTLTAK+MAKKNCLVK+LEA+ETLGST  IC DKTGTLT N+MTV+H++FD+ + E D + N++          WKMLAR  MLCN + F +S E+E  +L R CTGD+SESALLK +E+S G V K+R ENKK+ E+PFNS NKYQ S+HET+DGN+  LL +KGAPE++LE CST+LID +E ++ D WR+ F   Y +LG +GERV+GF D RL E  FP GFDFN +E N    G+RF+G++SM+DPPR+ VPDAV KCRSAGIKVIMVTGDHPITAKA+AK VGII EGNKTV+D+A ERGI+  +V+P+DARACVIHG+DL+DMS E LDEV+ HH+EIVFART+PQQKL+IVE CQR G +VAVTGDGVNDSPALKKADIG+AMG++GSDVSKQ+ADMILLDDNFA+IV G+EEGR+IFDNLKKSIAYTLTSNIPE+TPFL+FI+  +PLPLGTIT+L IDLGTDM PAISLAYEEAESDIM+R PRDPK DKLV   L+SMAYGQIG+++A  GFF YF++MAE GFWP RL+GLR+EWDS A+ND+ DSYGQEW F QRK+LE+TC TAFFV+IV  QW +L+ICKTRR S+F QGMWNH +T  +F   TLA   TY PGLD AL   PLRFTWWLPA+P+   I +YDEIRK+++R+ K  SWLE ETYY
Sbjct:   42 ELDLEDHRIPIDDLYYKLDTDPDNGITEEEANIRLKEYGQNLLTPVSSTPTSIIYCKNLFGGFNLLLWIGSILCFIAFGIEAGSYAYTYLPMRNLWMGIVLIVIVVLSATFSFYQEIKSNKIMESFVRLVPHKATVIRNGRTKEILAENLVVGDVITVKCGDRIPADIRIISATSFKVDNSSLTGESEAQVRSTEYTNENSLETKNLAFFSTNAVEGVCRGVVINTGDSTVMGRIANLASGLEIGMTPIAKEINFFIYIITIISVILAVIFIIAAFLLGYYWIDAIIFLIAIIIASVPEGLLATVTVCLTLTAKRMAKKNCLVKHLEAIETLGSTKVICCDKTGTLTMNKMTVSHVFFDDIVYEVDMNNNELEGEIDVTKTGWKMLARGCMLCNHSNFIQSEEDEALILNRLCTGDSSESALLKFMEISYGNVEKFREENKKVYEMPFNSINKYQFSVHETNDGNESLLLVLKGAPEKVLEYCSTVLIDEEEHKITDEWRKLFYKNYDDLGILGERVIGFADTRLSEKIFPHGFDFNEEEHNVLNGGMRFLGMISMVDPPRSTVPDAVEKCRSAGIKVIMVTGDHPITAKAVAKLVGIIDEGNKTVEDLAKERGITVHDVDPKDARACVIHGNDLKDMSPETLDEVINHHNEIVFARTTPQQKLLIVESCQRLGDVVAVTGDGVNDSPALKKADIGIAMGLSGSDVSKQSADMILLDDNFATIVIGIEEGRLIFDNLKKSIAYTLTSNIPEVTPFLLFIILGLPLPLGTITVLLIDLGTDMFPAISLAYEEAESDIMQRSPRDPKTDKLVTHSLLSMAYGQIGIMEAVAGFFAYFIVMAENGFWPQRLVGLRQEWDSPAINDVIDSYGQEWGFRQRKQLEHTCQTAFFVAIVTTQWANLLICKTRRISLFTQGMWNHYLTGAMFISATLALIFTYVPGLDTALHTAPLRFTWWLPALPYFLIILVYDEIRKYIIRRMKPNSWLERETYY 1030          
BLAST of non-gastric H ,K -ATPase alpha subunit vs. Planmine SMEST
Match: SMESG000008152.1 (SMESG000008152.1)

HSP 1 Score: 1283.09 bits (3319), Expect = 0.000e+0
Identity = 628/983 (63.89%), Postives = 769/983 (78.23%), Query Frame = 1
Query:  181 ELDIDSHKISIKDLYIRLQTDPEKGLSIEEAKIRLARDGPNALTPPKTTPEWVKFCRQLFGGFSLLLWIGAALCFLAYAILSGAYEDPPKDNLYLGIVLTAVVVITGCFSYYQEAKSSKIMESFGKMVPQKANVIRDGKILEIAAENLVTGDIIDVKFGDRVPADIRVIQASSFKVDNSALTGESEAQVRSSEFTNDNPLETKNIAFFSTNAVEGTCKGVVISTGDNTVMGRIANLASGLEMGMTPIAKEINHFIHIITGVAVFLGVSFFVIAFILGYFWLDAVIFLIGIIVANVPEGXXXXXXXXXXXXXKKMAKKNCLVKNLEAVETLGSTSTICSDKTGTLTQNRMTVAHMWFDNKIQESDTSENQITSSTKQESETWKMLARVAMLCNRAQFKSGEEEKPVLKRECTGDASESALLKCVELSIGGVTKYRGENKKIVEIPFNSTNKYQVSIHETSDGNQGYLLAMKGAPERILERCSTILIDGKEMEMDDHWRQEFNNAYLELGGMGERVLGFCDYRLDENNFPRGFDFNPDEVNFPLDGLRFVGLMSMIXXXXXXXXXXXXKCRSAGIKVIMVTGDHPITAKAIAKGVGIISEGNKTVDDIAAERGISPSEVNPRDARACVIHGSDLRDMSSEQLDEVLKHHDEIVFARTSPQQKLIIVEGCQRQGAIVAVTGDGVNDSPALKKADIGVAMGIAGSDVSKQAADMILLDDNFASIVTGVEEGRIIFDNLKKSIAYTLTSNIPEITPFLVFILADVPLPLGTITILCIDLGTDMVPAISLAYEEAESDIMKRKPRDPKHDKLVNERLISMAYGQIGMIQASGGFFVYFVIMAEQGFWPSRLLGLRKEWDSAAVNDLADSYGQEWTFDQRKKLEYTCHTAFFVSIVIVQWTDLMICKTRRNSIFQQGMWNHQMTFGLFFETTLAAFLTYCPGLDVALKMQPLRFTWWLPAIPFSASIFIYDEIRKFLLRKWKNGSWLENE 3129
            +L+ID HKIS+ DL+ RL +DP KGLS EEAKIR  ++GPNAL PPK  PE VKF ++L GGFSLLL  G+ LCF++Y I +      PKDNL LG+ L  +V+ TGCF Y+QEAKSSKI++SFG MVP KANVIRDG++ EI    LV GDI++VK+GDR+PAD+R++++SSFKVDNSALTGESE Q+R+ EFTN+N LET N+AFFSTNAVEGTC+GVVI+TGDNT+MGRIA L S L+MG TPI  EIN+F++IITG+ + LGV FF+++  +GYFWLD  +FLIGII A +P G                               L +T T+ S K  +++ N                  SEN++      ++  W  L RVAMLCNRAQFK+ +E+K V KRECTGDASESALLKC E    GV K+R EN K+ EIPFNSTNKYQ+SIHET+D ++  LL MKGAPE+ILERCS+I IDGKE+E+DD+WR EF NAY+ LGGMGERVLGF D RLD   +P+G++FN +EVNFPL+G RFVGL+SMIDPPR +VPDAV+KCRSAG+KV+MVTGDHPITAKAI+K VGIISE +KT++DIA ER ++ S+VNPR+A ACV++GS+L+ MSSEQLDE+LK+HDEIVFARTSPQQKL IVEG QRQGAIVAVTGDGVNDSPALKKADIG+AMGIAGSDVSKQAADMILLDDNFASIVTG+E+GRIIFDNLKKS+ Y     IPE+ P +++I+  +PLPLGTITILCID+GTDM+PAISLAYEEAES+IM+RKPRDP   KLV  +LIS+ +GQ+G+I+A GG FVYFVIMAE GF P RL+G+R +W+S   NDL DSYGQEWT+ QRK LEYTC+TAFFV+IV+ QW +L+I KTRRNSIFQ GMWN+ +TF LFFETTLA F+ YCPG+D+ LK QPL+F+WW  A+PF   IF+ DE++KF+LR   + SW   E
Sbjct:   33 DLEIDLHKISLTDLFERLNSDPIKGLSQEEAKIRYDKNGPNALKPPKDVPEIVKFLKELTGGFSLLLLAGSILCFVSYIIQAETDPSAPKDNLCLGLALLVIVLFTGCFCYFQEAKSSKIIKSFGNMVPDKANVIRDGELSEILTTFLVVGDIVEVKYGDRIPADLRLLKSSSFKVDNSALTGESEPQIRTVEFTNENILETSNVAFFSTNAVEGTCRGVVINTGDNTIMGRIALLTSSLKMGKTPIGNEINNFVNIITGIGISLGVIFFIVSLSIGYFWLDCFLFLIGIICAVIPVG-------------------------------LLATLTV-SLKIQSISLNT----------------KSENEV------DNIAWSNLLRVAMLCNRAQFKADQEDKIVWKRECTGDASESALLKCAEHENQGVMKFRTENPKVFEIPFNSTNKYQISIHETTDQDERLLLVMKGAPEQILERCSSIFIDGKEIEIDDYWRNEFTNAYMSLGGMGERVLGFSDCRLDLEKYPKGYEFNGEEVNFPLNGFRFVGLISMIDPPRPSVPDAVSKCRSAGVKVVMVTGDHPITAKAISKAVGIISETSKTLEDIALERNVNLSQVNPREANACVVNGSELKKMSSEQLDEILKYHDEIVFARTSPQQKLQIVEGFQRQGAIVAVTGDGVNDSPALKKADIGIAMGIAGSDVSKQAADMILLDDNFASIVTGIEQGRIIFDNLKKSVIYNFIKTIPELIPVMLYIVLSIPLPLGTITILCIDIGTDMLPAISLAYEEAESNIMRRKPRDPISGKLVTNKLISLTHGQMGIIEAVGGMFVYFVIMAENGFMPGRLIGIRPQWESTTNNDLMDSYGQEWTYHQRKNLEYTCYTAFFVAIVVQQWFNLLIVKTRRNSIFQSGMWNNHLTFALFFETTLALFIVYCPGMDIVLKTQPLKFSWWFIALPFGVYIFLCDELKKFILRHQNSKSWFSRE 961          
The following BLAST results are available for this feature:
BLAST of non-gastric H ,K -ATPase alpha subunit vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ATP1A20.000e+074.14ATPase Na+/K+ transporting subunit alpha 2 [Source... [more]
ATP1A30.000e+074.67ATPase Na+/K+ transporting subunit alpha 3 [Source... [more]
ATP1A30.000e+075.03ATPase Na+/K+ transporting subunit alpha 3 [Source... [more]
ATP1A30.000e+074.67ATPase Na+/K+ transporting subunit alpha 3 [Source... [more]
ATP1A30.000e+074.67ATPase Na+/K+ transporting subunit alpha 3 [Source... [more]
back to top
BLAST of non-gastric H ,K -ATPase alpha subunit vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
eat-60.000e+072.31Sodium/potassium-transporting ATPase subunit alpha... [more]
eat-60.000e+072.31Sodium/potassium-transporting ATPase subunit alpha... [more]
catp-40.000e+052.41Sodium/potassium-transporting ATPase subunit alpha... [more]
catp-30.000e+036.95Cation transporting ATPase [Source:UniProtKB/TrEM... [more]
catp-21.379e-17436.88Cation transporting ATPase [Source:UniProtKB/TrEM... [more]
back to top
BLAST of non-gastric H ,K -ATPase alpha subunit vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Atpalpha0.000e+076.39gene:FBgn0002921 transcript:FBtr0089516[more]
Atpalpha0.000e+076.39gene:FBgn0002921 transcript:FBtr0089514[more]
Atpalpha0.000e+076.19gene:FBgn0002921 transcript:FBtr0089515[more]
Atpalpha0.000e+076.29gene:FBgn0002921 transcript:FBtr0089510[more]
Atpalpha0.000e+076.29gene:FBgn0002921 transcript:FBtr0089511[more]
back to top
BLAST of non-gastric H ,K -ATPase alpha subunit vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
atp1a3b0.000e+074.87ATPase Na+/K+ transporting subunit alpha 3b [Sourc... [more]
atp1a3b0.000e+074.87ATPase Na+/K+ transporting subunit alpha 3b [Sourc... [more]
atp1a2a0.000e+073.50ATPase Na+/K+ transporting subunit alpha 2 [Source... [more]
atp1a3a0.000e+074.16ATPase Na+/K+ transporting subunit alpha 3a [Sourc... [more]
atp1a2a0.000e+073.50ATPase Na+/K+ transporting subunit alpha 2 [Source... [more]
back to top
BLAST of non-gastric H ,K -ATPase alpha subunit vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
naif10.000e+074.04nuclear apoptosis inducing factor 1 [Source:Xenbas... [more]
cdk20.000e+073.63cyclin-dependent kinase 2 [Source:Xenbase;Acc:XB-G... [more]
rab8b0.000e+074.16RAB8B, member RAS oncogene family [Source:Xenbase;... [more]
rab8b0.000e+074.08RAB8B, member RAS oncogene family [Source:Xenbase;... [more]
rab8b0.000e+072.69RAB8B, member RAS oncogene family [Source:Xenbase;... [more]
back to top
BLAST of non-gastric H ,K -ATPase alpha subunit vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Atp1a20.000e+074.24ATPase, Na+/K+ transporting, alpha 2 polypeptide [... [more]
Atp1a30.000e+074.57ATPase, Na+/K+ transporting, alpha 3 polypeptide [... [more]
Atp1a30.000e+074.57ATPase, Na+/K+ transporting, alpha 3 polypeptide [... [more]
Atp1a10.000e+073.45ATPase, Na+/K+ transporting, alpha 1 polypeptide [... [more]
Atp1a30.000e+074.64ATPase, Na+/K+ transporting, alpha 3 polypeptide [... [more]
back to top
BLAST of non-gastric H ,K -ATPase alpha subunit vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q6RWA9|AT1A_TAESO0.000e+080.34Sodium/potassium-transporting ATPase subunit alpha... [more]
sp|P13607|ATNA_DROME0.000e+076.29Sodium/potassium-transporting ATPase subunit alpha... [more]
sp|D2WKD8|AT1A2_PIG0.000e+074.24Sodium/potassium-transporting ATPase subunit alpha... [more]
sp|A2VDL6|AT1A2_BOVIN0.000e+074.14Sodium/potassium-transporting ATPase subunit alpha... [more]
sp|P06686|AT1A2_RAT0.000e+074.24Sodium/potassium-transporting ATPase subunit alpha... [more]
back to top
BLAST of non-gastric H ,K -ATPase alpha subunit vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
M4LUP70.000e+0100.00Sodium/potassium-transporting ATPase subunit alpha... [more]
O761540.000e+095.11Sodium/potassium-transporting ATPase subunit alpha... [more]
W6UUP90.000e+081.85Sodium/potassium-transporting ATPase subunit alpha... [more]
A0A068WQ070.000e+081.85Sodium/potassium-transporting ATPase subunit alpha... [more]
A0A068Y2K70.000e+081.74Sodium/potassium-transporting ATPase subunit alpha... [more]
back to top
BLAST of non-gastric H ,K -ATPase alpha subunit vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
atp1a3a0.000e+074.06sodium/potassium-transporting ATPase subunit alpha... [more]
atp1a3b0.000e+073.96ATPase Na+/K+ transporting subunit alpha 3 [Source... [more]
atp1a3a0.000e+075.13sodium/potassium-transporting ATPase subunit alpha... [more]
atp1a3b0.000e+075.08ATPase Na+/K+ transporting subunit alpha 3 [Source... [more]
atp1a1b0.000e+073.99sodium/potassium-transporting ATPase subunit alpha... [more]
back to top
BLAST of non-gastric H ,K -ATPase alpha subunit vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000002888.10.000e+072.63pep scaffold:Pmarinus_7.0:GL478641:194938:205936:1... [more]
ENSPMAT00000002145.10.000e+078.69pep scaffold:Pmarinus_7.0:GL482157:124:4919:1 gene... [more]
ENSPMAT00000009058.10.000e+070.36pep scaffold:Pmarinus_7.0:GL480374:1:11062:-1 gene... [more]
ENSPMAT00000001612.11.142e-9754.62pep scaffold:Pmarinus_7.0:GL478157:83838:93675:1 g... [more]
ENSPMAT00000010373.11.028e-8329.84pep scaffold:Pmarinus_7.0:GL481096:3909:20014:1 ge... [more]
back to top
BLAST of non-gastric H ,K -ATPase alpha subunit vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
PMR19.638e-11431.10High affinity Ca2+/Mn2+ P-type ATPase; required fo... [more]
PMA16.935e-5325.96Plasma membrane P2-type H+-ATPase; pumps protons o... [more]
PMA27.662e-5226.13Plasma membrane H+-ATPase; isoform of Pma1p, invol... [more]
ENA21.667e-4530.76P-type ATPase sodium pump; involved in Na+ efflux ... [more]
ENA51.883e-4530.76Protein with similarity to P-type ATPase sodium pu... [more]
back to top
BLAST of non-gastric H ,K -ATPase alpha subunit vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO406800.000e+071.59Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO364550.000e+070.48Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO356163.985e-10329.28Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO474652.786e-9829.13Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO417742.097e-5427.95Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of non-gastric H ,K -ATPase alpha subunit vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000046641.10.000e+074.67sodium/potassium-transporting ATPase subunit alpha... [more]
atp1a3a0.000e+074.06sodium/potassium-transporting ATPase subunit alpha... [more]
ENSORLT00000016540.20.000e+075.60sodium/potassium-transporting ATPase subunit alpha... [more]
atp1a3a0.000e+074.33sodium/potassium-transporting ATPase subunit alpha... [more]
atp1a2a0.000e+072.62sodium/potassium-transporting ATPase subunit alpha... [more]
back to top
BLAST of non-gastric H ,K -ATPase alpha subunit vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000041937.10.000e+0100.00SMESG000041937.1[more]
SMESG000032753.10.000e+071.01SMESG000032753.1[more]
SMESG000008146.10.000e+068.77SMESG000008146.1[more]
SMESG000078146.10.000e+067.44SMESG000078146.1[more]
SMESG000008152.10.000e+063.89SMESG000008152.1[more]
back to top
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 24..44
NoneNo IPR availablePRINTSPR00119CATATPASEcoord: 607..617
score: 73.19
coord: 713..732
score: 82.49
coord: 585..596
score: 52.73
coord: 737..749
score: 54.06
coord: 213..227
score: 53.3
coord: 373..387
score: 80.65
NoneNo IPR availablePRINTSPR00121NAKATPASEcoord: 948..972
score: 54.79
coord: 293..315
score: 68.25
coord: 503..521
score: 81.64
coord: 785..806
score: 74.1
coord: 129..149
score: 80.73
coord: 366..387
score: 98.52
coord: 102..116
score: 75.97
coord: 914..934
score: 72.87
coord: 852..872
score: 78.29
NoneNo IPR availablePFAMPF00702Hydrolasecoord: 679..727
e-value: 2.9E-6
score: 27.7
NoneNo IPR availableGENE3DG3DSA:2.70.150.10coord: 40..275
e-value: 0.0
score: 1549.6
NoneNo IPR availableGENE3DG3DSA:1.20.1110.10coord: 93..1013
e-value: 0.0
score: 1549.6
NoneNo IPR availablePFAMPF00122E1-E2_ATPasecoord: 162..353
e-value: 1.3E-45
score: 155.2
NoneNo IPR availablePFAMPF13246Cation_ATPasecoord: 426..519
e-value: 7.3E-23
score: 80.5
NoneNo IPR availableSFLDSFLDS00003Haloacid_Dehalogenasecoord: 354..765
e-value: 0.0
score: 260.3
NoneNo IPR availableSFLDSFLDF00027p-type_atpasecoord: 354..765
e-value: 0.0
score: 260.3
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1..30
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1..16
NoneNo IPR availablePANTHERPTHR43294:SF15SODIUM/POTASSIUM-TRANSPORTING ATPASE SUBUNIT ALPHA-3coord: 12..1022
NoneNo IPR availablePANTHERPTHR43294FAMILY NOT NAMEDcoord: 12..1022
NoneNo IPR availableTMHMMTMhelixcoord: 129..148
NoneNo IPR availableTMHMMTMhelixcoord: 914..933
NoneNo IPR availableTMHMMTMhelixcoord: 95..117
NoneNo IPR availableTMHMMTMhelixcoord: 954..976
NoneNo IPR availableTMHMMTMhelixcoord: 321..343
NoneNo IPR availableTMHMMTMhelixcoord: 981..999
NoneNo IPR availableTMHMMTMhelixcoord: 848..870
NoneNo IPR availableTMHMMTMhelixcoord: 289..311
IPR004014Cation-transporting P-type ATPase, N-terminalSMARTSM00831Cation_ATPase_N_a_2coord: 41..115
e-value: 1.5E-23
score: 94.2
IPR004014Cation-transporting P-type ATPase, N-terminalPFAMPF00690Cation_ATPase_Ncoord: 43..110
e-value: 1.6E-17
score: 63.0
IPR023299P-type ATPase, cytoplasmic domain NGENE3DG3DSA:3.40.1110.10coord: 383..592
e-value: 0.0
score: 1549.6
IPR023299P-type ATPase, cytoplasmic domain NSUPERFAMILYSSF81660Metal cation-transporting ATPase, ATP-binding domain Ncoord: 382..593
IPR006068Cation-transporting P-type ATPase, C-terminalPFAMPF00689Cation_ATPase_Ccoord: 797..1006
e-value: 6.9E-45
score: 153.0
IPR023214HAD superfamilyGENE3DG3DSA:3.40.50.1000coord: 370..753
e-value: 0.0
score: 1549.6
IPR001757P-type ATPaseTIGRFAMTIGR01494TIGR01494coord: 135..418
e-value: 3.7E-43
score: 145.6
coord: 687..801
e-value: 3.8E-32
score: 109.3
IPR005775P-type ATPase subfamily IIC, subunit alphaTIGRFAMTIGR01106TIGR01106coord: 27..1022
e-value: 0.0
score: 1867.8
IPR005775P-type ATPase subfamily IIC, subunit alphaCDDcd02608P-type_ATPase_Na-K_likecoord: 61..1019
e-value: 0.0
score: 1915.95
IPR018303P-type ATPase, phosphorylation sitePROSITEPS00154ATPASE_E1_E2coord: 375..381
IPR008250P-type ATPase, A domain superfamilySUPERFAMILYSSF81653Calcium ATPase, transduction domain Acoord: 165..272
IPR036412HAD-like superfamilySUPERFAMILYSSF56784HAD-likecoord: 588..762
IPR023298P-type ATPase, transmembrane domain superfamilySUPERFAMILYSSF81665Calcium ATPase, transmembrane domain Mcoord: 40..1012

Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0008556potassium-transporting ATPase activity
GO:0046872metal ion binding
GO:0000166nucleotide binding
GO:0005391sodium:potassium-exchanging ATPase activity
GO:0005524ATP binding
GO:0016787hydrolase activity
Vocabulary: biological process
TermDefinition
GO:0071805potassium ion transmembrane transport
GO:0006810transport
GO:0006811ion transport
GO:0006813potassium ion transport
GO:0006814sodium ion transport
GO:0010248establishment or maintenance of transmembrane electrochemical gradient
GO:0090662ATP hydrolysis coupled transmembrane transport
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000020protonephridia
PLANA:0000026gut
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0002075pigment cell
PLANA:0003001lateral region of the whole animal
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR001757P_typ_ATPase
IPR005775P-type_ATPase_IIC
IPR036412HAD-like_sf
IPR004014ATPase_P-typ_cation-transptr_N
IPR006068ATPase_P-typ_cation-transptr_C
IPR008250ATPase_P-typ_transduc_dom_A_sf
IPR023298ATPase_P-typ_TM_dom_sf
IPR023299ATPase_P-typ_cyto_dom_N
IPR018303ATPase_P-typ_P_site
IPR023214HAD_sf
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30024527 ID=SMED30024527|Name=non-gastric H ,K -ATPase alpha subunit|organism=Schmidtea mediterranea sexual|type=transcript|length=3362bp
ATCTGTTTAAATGCACTTCTAATATATATATAAAACAATAAAATTTAAAG
AGATAACATATTATTAATTGTAATGGCGAGTGATGAAAAAGTCAATGATA
AGGGCGATAAAAAAAACTTAAAATCTTCTCCAAAAAAGTCTAAGAAAGAT
AAAAAGAAAGACTTAGATAATCTCAAGAAAGAGTTGGATATTGATTCACA
TAAAATTTCAATCAAAGATTTATATATTCGATTACAAACTGATCCAGAAA
AAGGATTATCTATCGAAGAAGCAAAGATACGATTGGCTCGTGATGGTCCC
AATGCTCTTACTCCACCAAAAACTACACCAGAATGGGTTAAGTTTTGCAG
ACAATTGTTTGGTGGATTTTCTTTACTACTTTGGATTGGAGCAGCGCTAT
GTTTCTTGGCTTATGCAATTCTGTCAGGTGCTTACGAAGATCCGCCAAAA
GATAATTTATATCTTGGAATCGTGTTAACTGCTGTTGTCGTTATTACTGG
CTGCTTTTCTTATTATCAAGAGGCCAAATCCTCAAAGATCATGGAATCAT
TTGGGAAAATGGTGCCTCAAAAAGCAAATGTCATCCGTGATGGCAAAATT
TTGGAAATTGCTGCCGAAAATCTTGTAACTGGTGACATTATTGACGTAAA
ATTTGGCGACCGAGTTCCAGCTGATATTCGAGTTATTCAAGCCAGTTCGT
TCAAAGTTGACAATTCAGCACTTACTGGTGAATCAGAAGCTCAAGTAAGA
TCATCAGAATTCACAAATGACAACCCATTGGAAACTAAAAATATTGCTTT
CTTTTCCACGAACGCAGTTGAAGGTACTTGCAAAGGAGTTGTAATAAGTA
CTGGGGATAATACTGTTATGGGCCGCATCGCAAATTTAGCAAGTGGATTG
GAAATGGGAATGACACCAATAGCTAAAGAAATCAATCATTTCATTCACAT
TATAACCGGAGTTGCTGTTTTCCTTGGAGTGTCGTTTTTCGTCATTGCGT
TTATTCTTGGTTATTTCTGGTTAGATGCCGTCATCTTCTTGATTGGTATC
ATTGTTGCTAACGTTCCAGAAGGTTTATTAGCTACAGTCACGGTATGTCT
AACTTTAACTGCAAAAAAAATGGCTAAGAAAAATTGCTTGGTCAAGAATC
TAGAAGCCGTCGAAACTCTCGGATCTACTAGTACTATATGCTCAGATAAA
ACAGGAACTCTCACTCAGAATCGAATGACAGTTGCTCATATGTGGTTTGA
TAACAAAATTCAAGAATCTGACACGTCAGAAAATCAAATTACCTCTAGTA
CCAAACAAGAAAGTGAAACATGGAAAATGCTCGCTAGAGTAGCTATGCTA
TGCAATCGCGCTCAATTTAAATCTGGAGAAGAAGAAAAACCAGTTTTGAA
ACGGGAATGTACAGGAGATGCTTCGGAATCTGCTTTATTGAAATGTGTTG
AATTGAGTATTGGTGGAGTTACAAAATATCGTGGAGAAAACAAAAAAATT
GTAGAAATTCCATTTAATTCCACAAATAAATATCAAGTTTCAATCCACGA
AACAAGTGACGGTAACCAGGGATATCTATTAGCAATGAAAGGTGCCCCAG
AAAGAATCTTGGAACGTTGTTCAACTATTCTTATTGATGGAAAGGAAATG
GAAATGGATGATCACTGGAGACAAGAATTCAACAATGCCTATTTGGAATT
AGGTGGCATGGGAGAACGTGTGTTGGGATTTTGTGATTACCGATTGGATG
AAAATAACTTTCCAAGGGGTTTCGATTTCAATCCAGATGAAGTAAATTTC
CCACTTGATGGATTAAGATTTGTCGGACTCATGTCCATGATTGATCCACC
TCGAGCTGCCGTACCAGATGCAGTAGCTAAATGCCGATCAGCTGGAATAA
AAGTCATTATGGTTACAGGTGACCATCCCATTACTGCAAAGGCTATTGCC
AAAGGTGTCGGTATTATTAGTGAAGGAAATAAGACAGTCGATGATATTGC
TGCTGAAAGAGGAATTTCTCCATCTGAAGTCAATCCAAGAGACGCACGAG
CCTGTGTTATTCATGGCTCTGATTTAAGAGACATGAGTTCTGAGCAATTA
GACGAAGTGCTAAAGCATCACGATGAAATTGTGTTTGCCCGTACAAGTCC
ACAACAAAAACTTATTATTGTTGAAGGTTGTCAAAGACAAGGAGCAATTG
TTGCAGTCACTGGAGATGGAGTTAATGACAGTCCAGCTCTTAAAAAAGCA
GATATAGGCGTTGCAATGGGAATTGCTGGCAGTGATGTCAGTAAACAGGC
TGCTGACATGATTCTGTTAGATGACAATTTTGCGTCGATCGTTACCGGAG
TTGAAGAAGGAAGAATCATTTTCGACAATCTCAAAAAATCAATCGCTTAC
ACTTTGACATCGAATATTCCCGAAATAACACCTTTCCTTGTTTTCATACT
TGCAGACGTACCGCTGCCGCTTGGCACCATTACCATCCTCTGCATCGATC
TTGGAACTGACATGGTGCCCGCTATTTCTCTTGCATACGAAGAGGCTGAA
TCTGATATCATGAAACGAAAGCCCCGAGATCCTAAACACGACAAATTAGT
CAATGAAAGATTGATCTCAATGGCATATGGTCAAATTGGAATGATACAAG
CGTCAGGAGGATTTTTTGTATATTTTGTTATTATGGCCGAACAAGGATTC
TGGCCGAGTCGGTTATTGGGGTTACGAAAAGAATGGGATTCAGCTGCAGT
AAACGATTTGGCTGATTCATATGGACAAGAATGGACTTTTGATCAACGCA
AAAAACTCGAATATACATGCCACACAGCCTTCTTTGTATCGATTGTAATA
GTGCAATGGACAGATTTAATGATTTGTAAAACTCGAAGAAATTCCATTTT
CCAACAAGGAATGTGGAATCACCAAATGACATTTGGTCTGTTTTTTGAAA
CGACTCTTGCTGCCTTTCTGACCTATTGTCCAGGTTTAGATGTTGCTCTT
AAAATGCAGCCTTTGAGATTTACCTGGTGGTTACCAGCTATTCCATTTAG
TGCATCTATTTTCATTTACGATGAGATTAGAAAGTTCCTACTTCGTAAAT
GGAAGAACGGCTCATGGTTAGAGAACGAAACCTATTACTAGAAATACTGG
ATTTTTCTATGTATTATTACGAATATTATTATCTACAACCTATTCTGGAC
ATTCTCTGCACTAAAAATTCAGGTGTCCATTATATTAGAATAATCAATAA
TGCACTTTTCTACTATATATCTATCTATCTATGGCTTTTGTAATTTTAGT
GATTTTATCAGAATATGTTCTTTTATTATTATAATTATAATTATTATTAT
TATTATTATTAT
back to top
Cross References
External references for this transcript
DatabaseAccession
SmedGD GBrowseSMED30024527
GenBankAGF90974.1